Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G07535g2032009081e-126
YOR294W (RRS1)2031987411e-101
ABL014C2051996811e-91
Kwal_55.203102051986732e-90
KLLA0B13046g2041986523e-87
Sklu_1837.32081976514e-87
Scas_665.272031986323e-84
KLLA0B05995g49042607.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G07535g
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G07535g 714360..714971 highly similar to sp|Q08746 Saccharo...   354   e-126
YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of riboso...   290   e-101
ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH] (372112..372...   266   1e-91
Kwal_55.20310                                                         263   2e-90
KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746 S...   255   3e-87
Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement        255   4e-87
Scas_665.27                                                           248   3e-84
KLLA0B05995g 535752..537224 some similarities with ca|CA0656|IPF...    28   7.8  

>CAGL0G07535g 714360..714971 highly similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis, hypothetical start
          Length = 203

 Score =  354 bits (908), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 179/200 (89%), Positives = 179/200 (89%)

Query: 1   MSEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLI 60
           MSEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLI
Sbjct: 1   MSEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLI 60

Query: 61  NQLLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKG 120
           NQLLSLPIKKTTEHTGGNSGQGATVA                     ALTKWQKFAAKKG
Sbjct: 61  NQLLSLPIKKTTEHTGGNSGQGATVALLQLPEPSSELPREKPLPKPKALTKWQKFAAKKG 120

Query: 121 IKPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRA 180
           IKPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRA
Sbjct: 121 IKPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRA 180

Query: 181 ERKRLVKKNERQQKKNLKNA 200
           ERKRLVKKNERQQKKNLKNA
Sbjct: 181 ERKRLVKKNERQQKKNLKNA 200

>YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of ribosome
           synthesis [612 bp, 203 aa]
          Length = 203

 Score =  290 bits (741), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/198 (69%), Positives = 161/198 (81%)

Query: 3   EYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQ 62
           +YKNLPVTVEKPIPV YDLGNL+ FD+NV+D+ND+DSSNA+REE IKS+TRDNVQLLINQ
Sbjct: 5   DYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLINQ 64

Query: 63  LLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGIK 122
           LLSLP+K TTE  GG  GQ + +                      A+TKW+KFAAKKGIK
Sbjct: 65  LLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIK 124

Query: 123 PKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAER 182
           PKERAGKM++DEA+G+W PKWGY G NKKLDDQWLVEVDD  KGT+NELIDPR+LNRAER
Sbjct: 125 PKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAER 184

Query: 183 KRLVKKNERQQKKNLKNA 200
           KRLVKKNE+QQ++N+KNA
Sbjct: 185 KRLVKKNEKQQRRNMKNA 202

>ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH]
           (372112..372729) [618 bp, 205 aa]
          Length = 205

 Score =  266 bits (681), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 131/199 (65%), Positives = 155/199 (77%), Gaps = 2/199 (1%)

Query: 2   SEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLIN 61
           +E   LPVTVEKPIPVTYDLGNL+VFD+N +DRND+DSSNA REE ++++TRDNVQLLIN
Sbjct: 6   AEKSELPVTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANREEHLRALTRDNVQLLIN 65

Query: 62  QLLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGI 121
           Q+LSLPIK TT+ TG  SGQ +++A                     A TKW+ FAAKK I
Sbjct: 66  QILSLPIKSTTDSTG--SGQSSSIALVRLPEPTTDLPREKPLPKPKAPTKWELFAAKKNI 123

Query: 122 KPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAE 181
           KPKE++GKMV+DEA G+W PKWGY G NKKLDDQWLVEVDD  KGTE ELIDPR+L+RAE
Sbjct: 124 KPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTEEELIDPRTLSRAE 183

Query: 182 RKRLVKKNERQQKKNLKNA 200
           RK+L+KKNE Q K+NLKNA
Sbjct: 184 RKKLIKKNELQHKRNLKNA 202

>Kwal_55.20310
          Length = 205

 Score =  263 bits (673), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 150/198 (75%)

Query: 3   EYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQ 62
           E K+LPVTVEKPIPV YDLGNL+VFD N +DRND DSSNA+RE+ IKSVTR+NVQL+INQ
Sbjct: 7   EKKSLPVTVEKPIPVAYDLGNLAVFDPNTLDRNDFDSSNAQREKNIKSVTRENVQLMINQ 66

Query: 63  LLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGIK 122
           +LSLPIK TTE  GG SGQ A++                      A TKW+KFAA KGIK
Sbjct: 67  ILSLPIKSTTESAGGTSGQSASMTLVQLPEPTTELPREKPLPKPKAPTKWEKFAAIKGIK 126

Query: 123 PKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAER 182
            KER+GKMV+DE  G+W PKWGY G NKKLD QWLVEVDD  K  ENELIDPRSL+RAER
Sbjct: 127 AKERSGKMVYDEDAGQWVPKWGYKGANKKLDKQWLVEVDDKPKKAENELIDPRSLSRAER 186

Query: 183 KRLVKKNERQQKKNLKNA 200
           K+++KKNE QQK+NLK A
Sbjct: 187 KKIIKKNEVQQKRNLKGA 204

>KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis singleton, start by similarity
          Length = 204

 Score =  255 bits (652), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 155/198 (78%)

Query: 2   SEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLIN 61
           ++Y   PVTVEK IPVTYDLGNL+VFDTNV+DRND DSSNA RE  IK +TRDNVQLLIN
Sbjct: 4   TKYSERPVTVEKAIPVTYDLGNLAVFDTNVLDRNDFDSSNAARESNIKDLTRDNVQLLIN 63

Query: 62  QLLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGI 121
           Q+LSLPI+ TTE  GG+SGQ +++                      A TKW++FAAKKGI
Sbjct: 64  QILSLPIRATTESAGGSSGQSSSMTLVQLPEPTTELPREKPLPKPKAPTKWEQFAAKKGI 123

Query: 122 KPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAE 181
           KPKER+GKM++DEA G+W PKWGY G NK+LDDQWLVEVDD  +GTE+ELIDPR+LNRAE
Sbjct: 124 KPKERSGKMIYDEAAGEWVPKWGYKGSNKELDDQWLVEVDDKVQGTEDELIDPRTLNRAE 183

Query: 182 RKRLVKKNERQQKKNLKN 199
           RKRL+KKN+ QQK+NLKN
Sbjct: 184 RKRLIKKNQLQQKRNLKN 201

>Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement
          Length = 208

 Score =  255 bits (651), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 128/197 (64%), Positives = 159/197 (80%)

Query: 4   YKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQL 63
           +K+LPVTV+KPIPV+YDLGNL+VFD+NV+D++++DSSNAKREE IK +TRDNVQL+INQ+
Sbjct: 8   FKSLPVTVDKPIPVSYDLGNLAVFDSNVLDKDELDSSNAKREEHIKGMTRDNVQLMINQI 67

Query: 64  LSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGIKP 123
           LSLPIK TTE  G +SGQ +++                      A TKW+ FAAKKGIK 
Sbjct: 68  LSLPIKSTTESAGSSSGQASSMTLVQLPEPTSELPREKPLPKPKAPTKWELFAAKKGIKS 127

Query: 124 KERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAERK 183
           KER+GKMV+DEA+G+WAPKWGY G NKKLDDQWLVEVDD  KGTE+ELIDPR+L+RAERK
Sbjct: 128 KERSGKMVYDEASGEWAPKWGYKGTNKKLDDQWLVEVDDKVKGTEDELIDPRTLHRAERK 187

Query: 184 RLVKKNERQQKKNLKNA 200
           +L+KKNE Q K+NL+N+
Sbjct: 188 KLIKKNELQNKRNLRNS 204

>Scas_665.27
          Length = 203

 Score =  248 bits (632), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 128/198 (64%), Positives = 157/198 (79%)

Query: 3   EYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQ 62
           EYK LPVTVEKPI V+YDLGNL+VFD+NV++++D D+SN KREE IK++TRDNVQLLINQ
Sbjct: 5   EYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQLLINQ 64

Query: 63  LLSLPIKKTTEHTGGNSGQGATVAXXXXXXXXXXXXXXXXXXXXXALTKWQKFAAKKGIK 122
           LLSLPIK TT+ TGG++GQ +++                      A TKW++FAAKKGI+
Sbjct: 65  LLSLPIKTTTDSTGGSTGQNSSMTLLQLPVPITELPREKPLPKPKAPTKWEQFAAKKGIQ 124

Query: 123 PKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAER 182
           PK ++GKMV+DEATG+W PKWGY GINKKLDDQWLVEVDD  +GT +ELIDPR+L R ER
Sbjct: 125 PKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGRNER 184

Query: 183 KRLVKKNERQQKKNLKNA 200
           K+L+KKNERQQK+NLK  
Sbjct: 185 KQLIKKNERQQKRNLKGG 202

>KLLA0B05995g 535752..537224 some similarities with
           ca|CA0656|IPF12470 Candida albicans unknown function,
           hypothetical start
          Length = 490

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 160 VDDDTKGTENELIDPRSLNRAERKR-LVKKNERQQKKNLKNA 200
           V DD KGTE E I P++L        L  ++ERQ    L+N+
Sbjct: 380 VTDDNKGTEEEEIRPKTLEEMHGGHDLHYRSERQCLIKLENS 421

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,299,559
Number of extensions: 255903
Number of successful extensions: 884
Number of sequences better than 10.0: 20
Number of HSP's gapped: 877
Number of HSP's successfully gapped: 20
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)