Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06358g113904763e-63
Scas_663.25112914113e-53
ADR355C109904052e-52
YOR327C (SNC2)115923983e-51
YAL030W (SNC1)117933862e-49
KLLA0A03883g110903704e-47
CAGL0E05258g108903383e-42
Kwal_26.705474512582e-30
Kwal_56.23743162641242e-09
Scas_564.4*237691235e-09
KLLA0F19448g231691174e-08
YLR093C (NYV1)253611158e-08
CAGL0C00429g234571122e-07
AGR054C248581122e-07
Sklu_2258.720070874e-04
Kwal_47.1712120070874e-04
YKL196C (YKT6)20070858e-04
Scas_571.120070840.001
CAGL0D03498g20568780.006
AER109W20049780.007
KLLA0D02684g20071750.019
CAGL0H02739g46551680.21
ADL007C13570660.22
Scas_714.2352323621.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06358g
         (112 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   187   3e-63
Scas_663.25                                                           162   3e-53
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   160   2e-52
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   157   3e-51
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   153   2e-49
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   147   4e-47
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   134   3e-42
Kwal_26.7054                                                          103   2e-30
Kwal_56.23743                                                          52   2e-09
Scas_564.4*                                                            52   5e-09
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    50   4e-08
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    49   8e-08
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    48   2e-07
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    48   2e-07
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       38   4e-04
Kwal_47.17121                                                          38   4e-04
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    37   8e-04
Scas_571.1                                                             37   0.001
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    35   0.006
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    35   0.007
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    33   0.019
CAGL0H02739g 248511..249908 highly similar to sp|P10507 Saccharo...    31   0.21 
ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH] (696699..69...    30   0.22 
Scas_714.23                                                            28   1.1  

>CAGL0G06358g complement(612827..613168) no similarity,
          hypothetical start
          Length = 113

 Score =  187 bits (476), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%)

Query: 1  MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60
          MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK
Sbjct: 1  MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60

Query: 61 ADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          ADNLAISAQGFKRGANRVRKQMWYKDLKMK
Sbjct: 61 ADNLAISAQGFKRGANRVRKQMWYKDLKMK 90

>Scas_663.25
          Length = 112

 Score =  162 bits (411), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (94%), Gaps = 3/91 (3%)

Query: 1  MSSSVPYDPYVTPEQDETN-EQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIED 59
          MSSSVPYDPYV PE  ETN  +SQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIED
Sbjct: 1  MSSSVPYDPYVPPE--ETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIED 58

Query: 60 KADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          KADNLA+SAQGFKRGANRVRKQMW+KDLKM+
Sbjct: 59 KADNLAVSAQGFKRGANRVRKQMWWKDLKMR 89

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  160 bits (405), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 4/90 (4%)

Query: 1  MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60
          MSSSVPYDPYV PE      QSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI+DK
Sbjct: 1  MSSSVPYDPYVPPE----GAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDK 56

Query: 61 ADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          ADNLA+SAQGFKRGANRVRKQMW+KDLKM+
Sbjct: 57 ADNLAVSAQGFKRGANRVRKQMWWKDLKMR 86

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [348 bp, 115 aa]
          Length = 115

 Score =  157 bits (398), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 83/92 (90%), Gaps = 2/92 (2%)

Query: 1  MSSSVPYDPYVTPEQDET--NEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIE 58
          MSSSVPYDPYV PE+  +  N  SQ+K AAL+ EIDDTVGIMRDNINKVAERGERLTSIE
Sbjct: 1  MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIE 60

Query: 59 DKADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          DKADNLAISAQGFKRGANRVRKQMW+KDLKM+
Sbjct: 61 DKADNLAISAQGFKRGANRVRKQMWWKDLKMR 92

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  153 bits (386), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 75/93 (80%), Positives = 80/93 (86%), Gaps = 3/93 (3%)

Query: 1  MSSSVPYDPYVTPEQDE---TNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI 57
          MSSS P+DPY   E DE    N QS+S+ A L+AEIDDTVGIMRDNINKVAERGERLTSI
Sbjct: 1  MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60

Query: 58 EDKADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          EDKADNLA+SAQGFKRGANRVRK MWYKDLKMK
Sbjct: 61 EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMK 93

>KLLA0A03883g join(344642..344725,344850..345098) similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
          synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
          SNC1 synaptic vesicle-associated membrane protein,
          start by similarity
          Length = 110

 Score =  147 bits (370), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 80/90 (88%), Gaps = 3/90 (3%)

Query: 1  MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60
          MSSSVPYDPYV P  +ET     SK AALK+EIDDTV IMRDNINKVAERGERLTSI+DK
Sbjct: 1  MSSSVPYDPYV-PATEET--AGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDK 57

Query: 61 ADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          ADNLA+SAQGFKRGANRVRKQMW+KDLKM+
Sbjct: 58 ADNLAVSAQGFKRGANRVRKQMWWKDLKMR 87

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score =  134 bits (338), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (85%), Gaps = 5/90 (5%)

Query: 1  MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60
          M+S+  YDPY+  E     +  QSKAAALK+EIDDTV IMR+NINKVAERGE LTSI+DK
Sbjct: 1  MASNDNYDPYLLSE-----DGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDK 55

Query: 61 ADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          ADNLA+SAQGFKRGANRVR+QMWYKDLKM+
Sbjct: 56 ADNLAMSAQGFKRGANRVRRQMWYKDLKMR 85

>Kwal_26.7054
          Length = 74

 Score =  103 bits (258), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 51/51 (100%)

Query: 40 MRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLKMK 90
          MRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRVRKQMW+KDLKM+
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51

>Kwal_56.23743
          Length = 162

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 42/64 (65%)

Query: 26  AAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYK 85
           A A + ++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR A R++ +MW++
Sbjct: 77  AEATEQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQ 136

Query: 86  DLKM 89
           ++K+
Sbjct: 137 NVKL 140

>Scas_564.4*
          Length = 237

 Score = 52.0 bits (123), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 44/69 (63%)

Query: 20  EQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVR 79
           +   S+ A+ + ++ D V IM +NI+K  ER ER++ + DK   L  ++  FK+ A R++
Sbjct: 146 QNENSEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIK 205

Query: 80  KQMWYKDLK 88
           ++MW++ +K
Sbjct: 206 ERMWWQRMK 214

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 44/69 (63%)

Query: 21  QSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRK 80
           + Q  AA+ + E+ + + IM DNI+K  +R ER++ + D  + L  ++  F+R ++++ +
Sbjct: 142 EGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIMR 201

Query: 81  QMWYKDLKM 89
           +MW+ ++K 
Sbjct: 202 KMWWNNVKF 210

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 48.9 bits (115), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 28  ALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDL 87
           A + +I D + IM DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MW++ +
Sbjct: 170 ATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKV 229

Query: 88  K 88
           K
Sbjct: 230 K 230

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 40/57 (70%)

Query: 32  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLK 88
           ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MW++ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 37/58 (63%)

Query: 32  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLKM 89
           ++   V +M DNI+K  +R ER++ + D+   L  S+  F+R A R++++MW+ ++K 
Sbjct: 170 DLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMWWNNIKF 227

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 8   DPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAIS 67
           D Y++  QD +   S  K   ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S
Sbjct: 126 DIYISKYQDPSQADSIMK---VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSAS 182

Query: 68  AQGFKRGANR 77
           ++ F + A +
Sbjct: 183 SRMFYKQAKK 192

>Kwal_47.17121
          Length = 200

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 8   DPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAIS 67
           D Y+   QD +   S  +   ++ E+D+T  ++   I  V +RGERL ++ DK+++L+ S
Sbjct: 126 DIYIAKYQDPSQADSIMR---VQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSAS 182

Query: 68  AQGFKRGANR 77
           ++ F + A +
Sbjct: 183 SRMFYKQAKK 192

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 37.4 bits (85), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 8   DPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAIS 67
           D Y++  QD +   +  K   ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S
Sbjct: 126 DTYISKYQDPSQADAIMK---VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTAS 182

Query: 68  AQGFKRGANR 77
           ++ F + A +
Sbjct: 183 SKMFYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 8   DPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAIS 67
           D Y++  QD +   +  K   ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S
Sbjct: 126 DTYISKYQDPSQADAIMK---VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTAS 182

Query: 68  AQGFKRGANR 77
           ++ F + A +
Sbjct: 183 SKMFYKQAKK 192

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 34.7 bits (78), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 10  YVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQ 69
           Y++  QD     +  K   ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++
Sbjct: 133 YISKYQDPAQADAIMK---VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSK 189

Query: 70  GFKRGANR 77
            F + A +
Sbjct: 190 MFYKQAKK 197

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 34.7 bits (78), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 33/49 (67%)

Query: 29  LKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 77
           ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 33.5 bits (75), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 8   DPYVTPEQDETNEQSQSKAAA-LKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAI 66
           D Y+   QD     SQ+ A   ++ E+D+T   +   I  V +RGE+L ++ DK+++L+ 
Sbjct: 126 DIYIAKYQDP----SQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSA 181

Query: 67  SAQGFKRGANR 77
           +++ F + A +
Sbjct: 182 ASRMFYKQAKK 192

>CAGL0H02739g 248511..249908 highly similar to sp|P10507
           Saccharomyces cerevisiae YLR163c MAS1, start by
           similarity
          Length = 465

 Score = 30.8 bits (68), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 16  DETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIE--DKADNL 64
           DE N       AAL   +DDT  I+ D   ++   G+RL+  E  +K DN+
Sbjct: 374 DEVNRSKAQLKAALLLSLDDTTAILEDIGRQIVTTGKRLSPEEVFEKVDNI 424

>ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH]
          (696699..697106) [408 bp, 135 aa]
          Length = 135

 Score = 30.0 bits (66), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 12 TPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLT-SIEDKADNLAISAQG 70
          +P  + + + SQS  A L+++ D  VG+MR+ I  +    ER+   I   +  L      
Sbjct: 30 SPFSNPSIDYSQSTLAQLESQSDADVGVMREKIMALKTLSERMGEEIRGSSKTLDSLGST 89

Query: 71 FKRGANRVRK 80
          F   AN++++
Sbjct: 90 FDATANKLKR 99

>Scas_714.23
          Length = 523

 Score = 28.5 bits (62), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 18/23 (78%), Gaps = 2/23 (8%)

Query: 1  MSSSVPYDPYVTPEQDETNEQSQ 23
          M+S++PYDP+  PE+++ N  SQ
Sbjct: 1  MTSTIPYDPF--PEEEDNNPFSQ 21

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.126    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,834,520
Number of extensions: 92958
Number of successful extensions: 398
Number of sequences better than 10.0: 42
Number of HSP's gapped: 392
Number of HSP's successfully gapped: 42
Length of query: 112
Length of database: 16,596,109
Length adjustment: 82
Effective length of query: 30
Effective length of database: 13,757,433
Effective search space: 412722990
Effective search space used: 412722990
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)