Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06336g1418139671690.0
YAL029C (MYO4)1471143429680.0
YOR326W (MYO2)1574106429040.0
Scas_592.13*141991128900.0
Scas_663.261567104028570.0
Sklu_2164.5135091028540.0
Kwal_26.70551555103628470.0
CAGL0F00671g156691728370.0
ADR354W155891627730.0
KLLA0A03905g155091527650.0
Scas_688.22187674712941e-151
ACR068W180573512811e-149
YHR023W (MYO1)192878912671e-147
Kwal_23.5534190773912481e-144
KLLA0E11572g184875012451e-144
CAGL0J00693g188475011861e-136
Kwal_26.7587125074511441e-134
YMR109W (MYO5)121974811151e-130
KLLA0B12562g126074311161e-130
Scas_721.119123271611111e-129
CAGL0K03487g121772411011e-128
CAGL0K07590g125274311011e-128
YKL129C (MYO3)127174510721e-124
AEL306C129272510571e-121
CAGL0E00649g49184800.34
KLLA0D11484g58745742.0
ADR141W266122704.1
Sklu_1804.271493714.2
Scas_679.2677552714.3
CAGL0M09823g112885714.4
Scas_694.1958157705.6
CAGL0J08657g55749697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06336g
         (1396 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  2766   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1147   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  1123   0.0  
Scas_592.13*                                                         1117   0.0  
Scas_663.26                                                          1105   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1103   0.0  
Kwal_26.7055                                                         1101   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  1097   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  1072   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1069   0.0  
Scas_688.22                                                           503   e-151
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   498   e-149
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   492   e-147
Kwal_23.5534                                                          485   e-144
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   484   e-144
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   461   e-136
Kwal_26.7587                                                          445   e-134
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   434   e-130
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   434   e-130
Scas_721.119                                                          432   e-129
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   428   e-128
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   428   e-128
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   417   e-124
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   411   e-121
CAGL0E00649g complement(59647..61122) similar to sp|P25646 Sacch...    35   0.34 
KLLA0D11484g 985655..987418 similar to sp|P32608 Saccharomyces c...    33   2.0  
ADR141W [1882] [Homologous to ScYMR063W (RIM9) - SH] complement(...    32   4.1  
Sklu_1804.2 YIL005W, Contig c1804 2273-4417                            32   4.2  
Scas_679.26                                                            32   4.3  
CAGL0M09823g complement(971284..974670) highly similar to tr|Q06...    32   4.4  
Scas_694.19                                                            32   5.6  
CAGL0J08657g complement(855068..856741) similar to tr|Q12511 Sac...    31   7.7  

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
            cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
            cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 2766 bits (7169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1357/1396 (97%), Positives = 1357/1396 (97%)

Query: 1    MTFEVGTRCWYPSENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSNE 60
            MTFEVGTRCWYPSENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSNE
Sbjct: 1    MTFEVGTRCWYPSENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSNE 60

Query: 61   GSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQM 120
            GSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQM
Sbjct: 61   GSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQM 120

Query: 121  EELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAK 180
            EELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAK
Sbjct: 121  EELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAK 180

Query: 181  YIMRYFASLDDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFD 240
            YIMRYFASLDDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFD
Sbjct: 181  YIMRYFASLDDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFD 240

Query: 241  AKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLN 300
            AKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLN
Sbjct: 241  AKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLN 300

Query: 301  QGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXX 360
            QGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ       
Sbjct: 301  QGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSSTSSSI 360

Query: 361  XPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSL 420
             PDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSL
Sbjct: 361  SPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSL 420

Query: 421  LFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQ 480
            LFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQ
Sbjct: 421  LFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQ 480

Query: 481  HVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESWTQKL 540
            HVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESWTQKL
Sbjct: 481  HVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESWTQKL 540

Query: 541  YQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQN 600
            YQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQN
Sbjct: 541  YQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQN 600

Query: 601  DTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRC 660
            DTLISL              ASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRC
Sbjct: 601  DTLISLTKPTEETSTPPPQTASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRC 660

Query: 661  VKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWS 720
            VKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWS
Sbjct: 661  VKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWS 720

Query: 721  DVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMKGIAI 780
            DVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMKGIAI
Sbjct: 721  DVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMKGIAI 780

Query: 781  TIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQATLRSYRVR 840
            TIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQATLRSYRVR
Sbjct: 781  TIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQATLRSYRVR 840

Query: 841  IRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYRYFRKNYQA 900
            IRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYRYFRKNYQA
Sbjct: 841  IRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYRYFRKNYQA 900

Query: 901  IQXXXXXXXXXXXXXXXXXESEVTQINGVTYTELHSIVKDIHDSMTSNNQIIKELDEFNG 960
            IQ                 ESEVTQINGVTYTELHSIVKDIHDSMTSNNQIIKELDEFNG
Sbjct: 901  IQALSRSMLARSLMLKLRSESEVTQINGVTYTELHSIVKDIHDSMTSNNQIIKELDEFNG 960

Query: 961  VIDTQKSLTFTDLSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDVDSTLTNIKKVHN 1020
            VIDTQKSLTFTDLSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDVDSTLTNIKKVHN
Sbjct: 961  VIDTQKSLTFTDLSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDVDSTLTNIKKVHN 1020

Query: 1021 NIKSLDKIMLEDAHFQTGRTIISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLI 1080
            NIKSLDKIMLEDAHFQTGRTIISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLI
Sbjct: 1021 NIKSLDKIMLEDAHFQTGRTIISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLI 1080

Query: 1081 VKEIMKEEFATLEGSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDKKL 1140
            VKEIMKEEFATLEGSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDKKL
Sbjct: 1081 VKEIMKEEFATLEGSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDKKL 1140

Query: 1141 KSGFQWFSVAFTNLSVLRNSEFSLGKETSKSLSKLLADYENDLSKMLRSWILSILNDMFR 1200
            KSGFQWFSVAFTNLSVLRNSEFSLGKETSKSLSKLLADYENDLSKMLRSWILSILNDMFR
Sbjct: 1141 KSGFQWFSVAFTNLSVLRNSEFSLGKETSKSLSKLLADYENDLSKMLRSWILSILNDMFR 1200

Query: 1201 ENDKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVA 1260
            ENDKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVA
Sbjct: 1201 ENDKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVA 1260

Query: 1261 NHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEE 1320
            NHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEE
Sbjct: 1261 NHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEE 1320

Query: 1321 LRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDIIFR 1380
            LRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDIIFR
Sbjct: 1321 LRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDIIFR 1380

Query: 1381 LDSDIVKCEIDTSKEI 1396
            LDSDIVKCEIDTSKEI
Sbjct: 1381 LDSDIVKCEIDTSKEI 1396

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1434 (44%), Positives = 887/1434 (61%), Gaps = 109/1434 (7%)

Query: 1    MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
            M+FEVGT+CWYP  E GWI  EV+KN+  +G +HL+  LEDG  + ++T+S + +D    
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDD---- 56

Query: 60   EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119
            +   +PVLRNP   EST DLTTLSYLNEPAVLHAIK RYMN +IYTYSGIVL+A NPF +
Sbjct: 57   DHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDK 116

Query: 120  MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179
            ++ LYS +MI+ YS    ++EL+PHLFAIA +AY  M  +  NQT+VVSGESGAGKTVSA
Sbjct: 117  VDHLYSREMIQNYSS-KRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSA 175

Query: 180  KYIMRYFASL-DDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIM 238
            KYIMRYFAS+ + NN     EMS IE +ILATNPIMEAFGNAKT RNDNSSRFGKYLQI+
Sbjct: 176  KYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235

Query: 239  FDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYY 298
            FD    I G++IRTYLLE+SRLV+Q ++ERNYHIFYQ+L GLP  +K+EL +S+P+ ++Y
Sbjct: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295

Query: 299  LNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXX 358
             NQG  P I G+D+A+E++ T  ALS++GIN   Q+ +FKILAGLLHIGNIE+K      
Sbjct: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355

Query: 359  XXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIY 418
                +E NL++ACELLG+DP+ F+KW+ KK+I TRSEKIVTNL   QAL+ RDSV+KFIY
Sbjct: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415

Query: 419  SLLFDWLVNQINTMLHGAEV--SDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476
            S LFDWLV+ IN  L+  E+   D V SFIG+LDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475

Query: 477  EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536
            EFNQHVFKLEQEEYV+E+IEWSFIEF+DNQPCIDLIEN+LGILSLLDEESRLPSG+DESW
Sbjct: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535

Query: 537  TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596
              KLY   +KPP N+VFSKP+FGQTKF++SHYA +VEY+VEGFIEKNRD+VS   ++V K
Sbjct: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595

Query: 597  NSQNDTLISLXXXXXXXXXXXXXXASISR-----PKLINKKPTLGFMFKKSLGELMEIIN 651
             + N     +               +  +      +L  KKPTLG MFKKSLGELM IIN
Sbjct: 596  ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655

Query: 652  NTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYY 711
            +TNVHYIRC+KPNS K  WEFD+ MVLSQLRACG+LETI+ISCAGFPSRW+F EF+ RY+
Sbjct: 656  STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715

Query: 712  MLVDTTLWSDVA-SSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESL 770
            +L D +LWS +  + +   E+ + FC+ IL AT     K QIG TKIFFK+G+LA LE L
Sbjct: 716  LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775

Query: 771  RLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMM 830
            R  KM  I I IQKKIRA   R  YL+ +  ++  Q++IRS LVR  V+H+LKT+ A+++
Sbjct: 776  RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835

Query: 831  QATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQ 890
            Q  +R+   R      +  II LQC  +  L    +       A+++IQSYIR Y HKT 
Sbjct: 836  QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895

Query: 891  YRYFRKNYQAIQXXXXXXXXXXXXXXXXXESEVTQIN---GVTYTELHSIVKD------- 940
            YR  +++   +Q                 E E   I    G+   E     K+       
Sbjct: 896  YRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLE 955

Query: 941  -IHDSMTSNNQII---------KELDEFNGVIDTQKSLTFTDLSAKAEQLNSDAQKIIIK 990
             ++DS T   Q++         K+  E+  +++          + + E +N+  +K  +K
Sbjct: 956  MLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKKNALK 1015

Query: 991  HSNQEK------QIKDLKESKGDVDSTLTN-IKKVHNNIKSLDKIMLEDAHFQTGRTI-- 1041
               +++       ++ L   KG+  S L++ +K +   +  ++ ++ +D  F T  +   
Sbjct: 1016 ERKKKQSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQD--FTTTYSANK 1073

Query: 1042 ---ISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLIVKEIMKEEFATLE----- 1093
               + GLGI                +P   N+++    N  +++ +M     TLE     
Sbjct: 1074 NDKVKGLGIAGQQ-----------VKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGY 1122

Query: 1094 ---------------GSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDK 1138
                           G    I+ ++  +++    + + +FIS +  ++ S ++     D+
Sbjct: 1123 LKKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVES-IVMSLPKDE 1181

Query: 1139 KLKSGFQWFSVAFTNLSVLRNSEFSL-----GKETSKSLSKLLADYEND----LSKMLRS 1189
             +  G  W S   + L     ++ +L     G E  K     L D EN+      K+  +
Sbjct: 1182 TMLGGIFWLS-NLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYST 1240

Query: 1190 WILSILN---------DMFRENDKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIE 1240
            W++  +          DM   N+KLF +    + + + +F      +    + +    + 
Sbjct: 1241 WLVKFMKHASAHIEIFDMVL-NEKLFKNSGDEKFAKLFTF------LNEFDAVLCKFQVV 1293

Query: 1241 KSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNS 1300
             S+  K+    ++YLN+ + N ++ K P+++++ G  +++N++ L+ + E  ++ + R +
Sbjct: 1294 DSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPN 1352

Query: 1301 TRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQK-ASSDEKPMP 1353
              Q  Q  K+LQL IS++ E +++  + +ALN  QI A+L K K A+  E  +P
Sbjct: 1353 LIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVP 1406

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1064 (54%), Positives = 741/1064 (69%), Gaps = 29/1064 (2%)

Query: 1    MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
            M+FEVGTRCWYP  E GWI  EV KNE  DGKYHL+  LED  ++ +DT  ++     ++
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLN-----ND 55

Query: 60   EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119
            +   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 56   KDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115

Query: 120  MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179
            +++LY+ DMI+ Y+    R EL+PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVSA
Sbjct: 116  VDQLYTQDMIQAYAG-KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSA 174

Query: 180  KYIMRYFASLDDNNAAVVS---EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236
            KYIMRYFAS+++ N+A V    EMS+ E+KILATNPIMEAFGNAKT RNDNSSRFGKYL+
Sbjct: 175  KYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 234

Query: 237  IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296
            I+FD   +IIGA+IRTYLLERSRLV+Q   ERNYHIFYQL+AGLPA  KEEL +++   +
Sbjct: 235  ILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDY 294

Query: 297  YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXX 356
            +Y+NQG D +I+G+DDA+E++ T+ AL+++GI    Q ++FKILA LLHIGNIEIK+   
Sbjct: 295  FYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRN 354

Query: 357  XXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416
                  DEPNLKLACELLG+D Y F+KW+TKK+I TRSEKIV+NL   QALV +DSV+KF
Sbjct: 355  DASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKF 414

Query: 417  IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476
            IYS LFDWLV  INT+L    V+DQ+ SFIGVLDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 415  IYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 474

Query: 477  EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536
            EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DESW
Sbjct: 475  EFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 534

Query: 537  TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596
            TQKLYQTLDK P N+VFSKP+FGQTKF++SHYA +V YDVEGFIEKNRDTVS+  + VLK
Sbjct: 535  TQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLK 594

Query: 597  NSQNDTLISL-------XXXXXXXXXXXXXXASISRP---KLINKKPTLGFMFKKSLGEL 646
             S N+TLI++                     A   +P   + +N+KPTLG MFK+SL EL
Sbjct: 595  ASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIEL 654

Query: 647  MEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEF 706
            M  IN+TNVHYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW+F+EF
Sbjct: 655  MNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEF 714

Query: 707  IDRYYMLVDTTLWSDV-ASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLA 765
            + RYY+L+    W  +    E+  E  I   K IL AT     K QIG TKIFFK+G+LA
Sbjct: 715  VLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLA 774

Query: 766  ELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTK 825
             LE LR  KM    + IQKKIRA   R  YL+I   ++ LQN I+  ++R  V  ++K  
Sbjct: 775  YLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVN 834

Query: 826  LALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGY 885
             A ++QA  R + +R  V   L  I  LQ K R  L QR L++     A++ IQS +R +
Sbjct: 835  CATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTF 894

Query: 886  KHKTQYRYFRKNYQAIQXXXXXXXXXXXXXXXXXESE-VTQINGVTY---TELHSIVKDI 941
            + ++++   +K+   +Q                 +++ V  +  V+Y    ++  + +++
Sbjct: 895  EPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNL 954

Query: 942  HDSMTSNNQIIKELDEFNGVIDTQKSLTFTDLSAKAEQL---NSDAQKIIIKHSNQEKQI 998
               +  N ++ + + E    ++    L  T  + K E L   ++   K +      E  +
Sbjct: 955  ASKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNL 1014

Query: 999  KDLKESKGDVDSTLTNIKKVHNNIKSLDKIMLEDAHFQTGRTII 1042
            +  +++  D    L ++ K H+ +K   K  LE+   QT +T++
Sbjct: 1015 QSTEQTLKDAQLELEDMVKQHDELKEESKKQLEELE-QTKKTLV 1057

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 76/143 (53%)

Query: 1234 MGTSAIEKSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELK 1293
            M +  IE  +F  ++ TL+ Y++    N +++K   + ++ G+ L  N+  L E+C+   
Sbjct: 1369 MKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG 1428

Query: 1294 LSNCRNSTRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMP 1353
            L++     +   Q +KLLQ+   ++E++ ++   C++L   Q+  L+++ + +  E P+P
Sbjct: 1429 LTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIP 1488

Query: 1354 YIVVKKVQSWAQETKKDTSKNSD 1376
              +++ V    ++    +S  +D
Sbjct: 1489 QEILRYVADIVKKEAALSSSGND 1511

>Scas_592.13*
          Length = 1419

 Score = 1117 bits (2890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/911 (59%), Positives = 689/911 (75%), Gaps = 10/911 (1%)

Query: 1   MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
           M+FEVGTRCWYP SE GWI CEV+KN+ +DG YH++ T E G +I ++T  ++ N+++ N
Sbjct: 1   MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119
               +PVLRNP   E+T DLTTLSYLNEPAVLHAIK RY  + IYTYSGIVL+ATNPF +
Sbjct: 61  NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179
           +EELYS++MI+ Y+R  +R+E+ PH+FAIA +AY  M +  +NQTI+VSGESGAGKTVSA
Sbjct: 121 VEELYSSEMIQAYAR-KNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSA 179

Query: 180 KYIMRYFASLDD------NNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGK 233
           KYIMR+FAS+++       ++    EMSDIE KILATNP+MEAFGNAKT RNDNSSRFGK
Sbjct: 180 KYIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGK 239

Query: 234 YLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNP 293
           YLQI+FD+ KNIIG+ I+TYLLERSRLVFQ  SERNYHIFYQ+L+GL + +K++L ++N 
Sbjct: 240 YLQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNA 299

Query: 294 EQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ 353
           E F+YLNQG +  I+G+DD+ E+  TI +LS +GI+  +Q+++FKILA LLHIGNIEIK+
Sbjct: 300 EDFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKK 359

Query: 354 XXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSV 413
                     +P+L+ ACELLGLDP  FSKW+TKK+I TRSEKI++NL   QALV RDSV
Sbjct: 360 TRTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSV 419

Query: 414 SKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEK 473
           +KFIYS LFDWLV  IN +L  ++VS+ + SFIGVLDIYGFEHFE NSFEQFCINYANEK
Sbjct: 420 AKFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEK 479

Query: 474 LQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTD 533
           LQQEFN HVFKLEQEEYV+E+IEWSFIEF+DNQPCIDLIEN+LGILSLLDEESRLP+G+D
Sbjct: 480 LQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSD 539

Query: 534 ESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMN 593
           ESWT KLYQT +KPP N VF KP+FGQ KF+ISHYA +V Y+V+GFIEKN+DT+SES + 
Sbjct: 540 ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599

Query: 594 VLKNSQNDTLISL-XXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINN 652
           VLK + N TL ++               A   + K IN+KPTLG +FK+SL ELME IN+
Sbjct: 600 VLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELMETINS 659

Query: 653 TNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYM 712
           TNVHYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETIKISCAGFPSRW+F+EFI RYY+
Sbjct: 660 TNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQRYYL 719

Query: 713 LVDTTLWSDV-ASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLR 771
           L  T  W  V A  E + E  + FC  IL     S +K QIG+TKIFFK+GVLA LE +R
Sbjct: 720 LAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLEKIR 779

Query: 772 LKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQ 831
             K+  +A+ IQK IRA   R+ YL+ +  +++ Q+ IR    R  V+ ++KT  A ++Q
Sbjct: 780 SDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAATLLQ 839

Query: 832 ATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQY 891
              RS RVR +V + L +I+ +Q   R VL   ++Q    ++++IMIQS IR    K +Y
Sbjct: 840 TLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPKHRY 899

Query: 892 RYFRKNYQAIQ 902
           +  +     IQ
Sbjct: 900 QTLKTGTILIQ 910

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 97/180 (53%), Gaps = 10/180 (5%)

Query: 1191 ILSILNDMFREN--DKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLI 1248
            +L+ L D F +    + FN   +V+ S +I F  + +   + Q   GT+     L   +I
Sbjct: 1188 VLNKLQDKFYKTWLKQCFNQMKTVD-SILILFDTISEFTLFFQ---GTT----ELLTNII 1239

Query: 1249 ETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMS 1308
              L+Q++N    N +LIK  ++ +  G+  +  +  +L++C   K+ N     R  +Q  
Sbjct: 1240 TALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQAC 1299

Query: 1309 KLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETK 1368
            KLLQL IS++ + ++VC++C+ L+  Q+HALL K + +  EKP+P  V+  + + A+  +
Sbjct: 1300 KLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRER 1359

>Scas_663.26
          Length = 1567

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1040 (54%), Positives = 720/1040 (69%), Gaps = 42/1040 (4%)

Query: 1    MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
            M+FEVGTRCWYPS E GWI  EV+KN+ +DG Y ++ TLED  +++++T        L+N
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKD------LTN 54

Query: 60   EGSP-MPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118
            E  P +P+LRNP   EST+DLTTLSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 55   EKDPSLPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFD 114

Query: 119  QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178
            +M++LYS DMI+ YS    R E++PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVS
Sbjct: 115  RMDQLYSQDMIQAYSG-KRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVS 173

Query: 179  AKYIMRYFASLDDNNAAVV------SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFG 232
            AKYIMRYFAS D+ N++ +      +EMS+ E++ILATNPIMEAFGNAKT RNDNSSRFG
Sbjct: 174  AKYIMRYFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFG 233

Query: 233  KYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISN 292
            KYL+I+FD +  IIGA++RTYLLERSRLV+Q ++ERNYHIFYQ+LAGLP  +K+EL ++ 
Sbjct: 234  KYLEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTK 293

Query: 293  PEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIK 352
             + ++Y+NQG +P I G+DD  E+  TI AL+++G+    Q  +FKILA LLHIGNIEIK
Sbjct: 294  ADDYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIK 353

Query: 353  QXXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDS 412
            +         DEPNLK+ACELLG+DP  F+KW+TKK+I TRSEKIV+NL   QALV RDS
Sbjct: 354  KTRNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDS 413

Query: 413  VSKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANE 472
            V+KFIYS LFDWLV  INT+L    V DQ+ SFIGVLDIYGFEHFE NSFEQFCINYANE
Sbjct: 414  VAKFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANE 473

Query: 473  KLQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGT 532
            KLQQEFNQHVFKLEQEEY++E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+
Sbjct: 474  KLQQEFNQHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGS 533

Query: 533  DESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLM 592
            DESWTQKLYQTLDKPP N+VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  +
Sbjct: 534  DESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHL 593

Query: 593  NVLKNSQNDTLI----SLXXXXXXXXXXXXXXASISRPKL--------INKKPTLGFMFK 640
             VLK + NDTL     S+              AS  + +L        + +KPTLG MFK
Sbjct: 594  EVLKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFK 653

Query: 641  KSLGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSR 700
             SL ELM+ IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSR
Sbjct: 654  LSLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSR 713

Query: 701  WSFQEFIDRYYMLVDTTLWSDVASSESNAESS-IKFCKEILGATELSHEKCQIGQTKIFF 759
            W+F EFI RYY+L+    W+ +       E   I  CK+IL AT    EK QIG TKIFF
Sbjct: 714  WTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFF 773

Query: 760  KSGVLAELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVE 819
            K+G+LA  E LR  KM    + IQK IR+   R  Y+ +   +  L    +  ++R  VE
Sbjct: 774  KAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVE 833

Query: 820  HQLKTKLALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQ 879
            ++L+   A ++Q   R Y  R  ++  +  I+ LQ + R  L QR +Q    + A+I IQ
Sbjct: 834  YELEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQ 893

Query: 880  SYIRGYKHKTQYRYFRKNYQAIQXXXXXXXXXXXXXXXXXESE-VTQINGVTY---TELH 935
            S IR +  +  Y   R++   +Q                 +++ V  +  V+Y    ++ 
Sbjct: 894  SRIRAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVI 953

Query: 936  SIVKDIHDSMTSNNQIIKELDEFNGVIDTQKSLTFTDLSAKAEQLNSDAQKIIIKHSN-- 993
             + +++   +  N Q+ K L+E    +     +T ++L  + E    + QK +    +  
Sbjct: 954  QLTQNLAAKVKENRQLSKRLEELQATM-----VTVSELQDQLEAQKMENQKALADQKDGF 1008

Query: 994  --QEKQIKD-LKESKGDVDS 1010
                K +KD L ++  DV+S
Sbjct: 1009 VLDSKSLKDQLIKANKDVES 1028

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 91/181 (50%), Gaps = 8/181 (4%)

Query: 1203 DKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVANH 1262
            +K+FN      + ++++F         I   M +  IE  +F  +I TL+ Y++    N 
Sbjct: 1348 NKIFNSGEEYTMDDILTF------FNNIFWCMKSFHIENEVFRTVIITLLNYVDTICFND 1401

Query: 1263 VLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEELR 1322
            +++K   + ++ G+ L  N+  L E+C+   L +     +   Q +KLLQL   ++E++ 
Sbjct: 1402 LIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYLQHLIQTAKLLQLRKYTIEDID 1461

Query: 1323 VVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDIIFRLD 1382
            +V   C +L+  Q+  L+++   +  E P+P  ++K V    +  K+ TS ++DI    +
Sbjct: 1462 MVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVADIVK--KESTSAHNDIFLHPE 1519

Query: 1383 S 1383
            +
Sbjct: 1520 T 1520

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/910 (58%), Positives = 683/910 (75%), Gaps = 14/910 (1%)

Query: 1   MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
           M++EVGTRCWYP  + GWI  E++K+     K+ L+ TLED  +++++++++D       
Sbjct: 1   MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLD-----ET 55

Query: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119
           +   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 56  KDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115

Query: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179
           +E+LYS DMI+ Y+    R EL+PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVSA
Sbjct: 116 VEQLYSQDMIQAYAG-KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSA 174

Query: 180 KYIMRYFASLDDNN---AAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236
           KYIMRYFAS++ NN   A    EMS+ EKKILATNPIMEAFGNAKT RNDNSSRFGKYL+
Sbjct: 175 KYIMRYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 234

Query: 237 IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296
           I+FD + +IIGA+IRTYLLERSRLVFQ +SERNYHIFYQLLAGL    K +L ++  E +
Sbjct: 235 ILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDY 294

Query: 297 YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXX 356
           +Y+NQG + +I G+DDA+E+Q T+ ALS++GI+   Q ++FKILA LLHIGN+EIK+   
Sbjct: 295 HYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRN 354

Query: 357 XXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416
                 DEPNL +ACELLG+D + F+KW+TKK+I TRSEKIV+NL   QALV RDSV+KF
Sbjct: 355 DASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKF 414

Query: 417 IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476
           IYS LF+WLV+ INT+L   EV+ ++ SFIGVLDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 415 IYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 474

Query: 477 EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536
           EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DE+W
Sbjct: 475 EFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETW 534

Query: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596
           TQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  + VLK
Sbjct: 535 TQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLK 594

Query: 597 NSQNDTLISLXXXXXXXXXXXXXXASISR----PKLINKKPTLGFMFKKSLGELMEIINN 652
            S N+TL+S+                +++     +++N+KPTLG +FK+SL ELM  IN+
Sbjct: 595 ASTNETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINS 654

Query: 653 TNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYM 712
           TNVHYIRC+KPN  K AW FD+ MVLSQLRACG+LETI+ISCAGFPSRW++ EF+ RY++
Sbjct: 655 TNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHI 714

Query: 713 LVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRL 772
           L+ +  WS + SS++  E     C+ ILGA     +K Q+G TKIFFK+G+LA LE LR 
Sbjct: 715 LIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774

Query: 773 KKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQA 832
            ++   ++ IQKK++A   R  YL I++ +R+  +R    L R  V+ + KT+ A+++Q+
Sbjct: 775 DRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834

Query: 833 TLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYR 892
            +RS   R +    L  I  LQ   R  LAQ+ L + ++  A++ IQ  IR ++ +  + 
Sbjct: 835 MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894

Query: 893 YFRKNYQAIQ 902
             R++   +Q
Sbjct: 895 TTRRSTVVVQ 904

>Kwal_26.7055
          Length = 1555

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1036 (55%), Positives = 724/1036 (69%), Gaps = 34/1036 (3%)

Query: 1    MTFEVGTRCWYPSEN-GWIPCEVSK-NEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLS 58
            M+FEVGTRCWYP +  GW+  EV+K ++P +GK+ L+  LE+G  ++++T++++      
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLN-----E 55

Query: 59   NEGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118
            ++   +P+LRNP   E+ +DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 56   SQNEKLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFD 115

Query: 119  QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178
            ++E+LYS DMI+ Y+    R EL+PHLFAIA +AY  M    +NQTIVVSGESGAGKTVS
Sbjct: 116  RVEQLYSQDMIQAYAG-RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVS 174

Query: 179  AKYIMRYFASLDDNNAAVVS-----EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGK 233
            AKYIMRYFAS++  NA   S     +MS+ E++ILATNPIMEAFGNAKT RNDNSSRFGK
Sbjct: 175  AKYIMRYFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGK 234

Query: 234  YLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNP 293
            YL+I+FD   +IIGA+IRTYLLERSRLVFQ Q ERNYHIFYQL+ GL  + KEEL ++  
Sbjct: 235  YLEILFDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKV 294

Query: 294  EQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ 353
            E ++YL QG D RI GVDDA E+Q T+ AL ++G +   Q ++FKILA LLHIGNIE+K+
Sbjct: 295  EDYHYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKK 354

Query: 354  XXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSV 413
                     DEPNLK+AC+LLG+D   FSKW+TKK+ITTRSEKIV+NL   QALV RDSV
Sbjct: 355  TRNDASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSV 414

Query: 414  SKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEK 473
            +KFI+S LFDWLV  INT+L   +VSDQ+ SFIGVLDIYGFEHFE NSFEQFCINYANEK
Sbjct: 415  AKFIFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEK 474

Query: 474  LQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTD 533
            LQQEFNQHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+D
Sbjct: 475  LQQEFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSD 534

Query: 534  ESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMN 593
            ESWTQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDV GFIEKNRDTVS+  + 
Sbjct: 535  ESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLE 594

Query: 594  VLKNSQNDTLISLXXXXXXXXXXXXXXASISR---PKLINKKPTLGFMFKKSLGELMEII 650
            VLK S+NDTL+S+                 ++   P  + KKPTLG MFK+SL ELM  I
Sbjct: 595  VLKASKNDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTI 654

Query: 651  NNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRY 710
            ++TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW++ EF+ RY
Sbjct: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714

Query: 711  YMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESL 770
            ++L+ +  W+ + +SE++ +     CK+ILGAT     K Q+G TKIFFK+G+LA LE L
Sbjct: 715  HILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774

Query: 771  RLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMM 830
            R  KM    + IQKKI+    R  YL I N + ++Q  I     R  V+H+ KT  A+ +
Sbjct: 775  RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834

Query: 831  QATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQ 890
            Q   R  R R      L  I+ +Q   R  +AQ+ + E ++++A++ IQ  IRG+  +  
Sbjct: 835  QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894

Query: 891  YRYFRKNYQAIQXXXXXXXXXXXXXXXXXESE-VTQINGVTYTELHSIVKDIHDSMTSNN 949
            Y   R +   IQ                 +++ V  +  V+Y +L + V  +  S+    
Sbjct: 895  YNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSY-KLENKVIQLTQSLAEK- 952

Query: 950  QIIKELDEFNGVI-DTQKSLTFTDLSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDV 1008
              +KE  +    I D QKSL   + SA  + L  DAQK        +   +DL+E K   
Sbjct: 953  --VKENRDMTAKIQDLQKSL---NESANIKSL-LDAQK--------DDHSRDLQEQKTSH 998

Query: 1009 DSTLTNIKKVHNNIKS 1024
            D+ L N K   +N K+
Sbjct: 999  DAELANKKIELDNAKA 1014

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
           Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
           Saccharomyces cerevisiae YAL029c MYO4, start by
           similarity
          Length = 1566

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/917 (59%), Positives = 675/917 (73%), Gaps = 22/917 (2%)

Query: 1   MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDT-DSIDYNDSLS 58
           M+FEVGTRCWYPS E GWI  EV+KN+ +DG YH++  LEDG  ++++T D  D +D   
Sbjct: 1   MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDE-- 58

Query: 59  NEGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118
                +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 59  ----SLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFD 114

Query: 119 QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178
           ++++LYS DMI+ Y+    R E++PHLFAIA +AY  M     NQTIVVSGESGAGKTVS
Sbjct: 115 RVDQLYSQDMIQAYAG-KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVS 173

Query: 179 AKYIMRYFASLDDNNAAVVS---EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYL 235
           AKYIMRYFAS+++ N+  V    EMS+ E+KILATNPIMEAFGNAKT RNDNSSRFGKYL
Sbjct: 174 AKYIMRYFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYL 233

Query: 236 QIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQ 295
           +I+FD   +IIGA+IRTYLLERSRLV+Q ++ERNYHIFYQ++AGL    K EL +   E 
Sbjct: 234 EILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAED 293

Query: 296 FYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXX 355
           +YY+NQG D +I+GVDD QE+  T+ AL+++GI++  Q  +FKILA LLHIGNIEIK+  
Sbjct: 294 YYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTR 353

Query: 356 XXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSK 415
                  DE NLK+ACELLG+D + F+KW+TKK+I TRSEKIV+NL   QALV RDSV+K
Sbjct: 354 NDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAK 413

Query: 416 FIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQ 475
           FIYS LFDWLV  INT+L    V D+V SFIGVLDIYGFEHFE NSFEQFCINYANEKLQ
Sbjct: 414 FIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQ 473

Query: 476 QEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDES 535
           QEFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DES
Sbjct: 474 QEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDES 533

Query: 536 WTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVL 595
           WTQKLYQTLDKPP N+VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  + VL
Sbjct: 534 WTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 593

Query: 596 KNSQNDTLISLXXXXXXXXXXXXXXASI---SRP------KLINKKPTLGFMFKKSLGEL 646
           K S N+TLI++                    S+P      + + +KPTLG MFK+SL EL
Sbjct: 594 KASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIEL 653

Query: 647 MEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEF 706
           M  I +TN HYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW+F EF
Sbjct: 654 MTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 713

Query: 707 IDRYYMLVDTTLWSDVASSESNAESS-IKFCKEILGATELSHEKCQIGQTKIFFKSGVLA 765
           I RYY+L+  + WS + + +   E   I  C +IL  T    EK QIG TKIFFK+G+LA
Sbjct: 714 ILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLA 773

Query: 766 ELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTK 825
            LE LR  KM   ++ IQK IRA   R  +L I++ +  LQ R++ ++ R  ++ + K K
Sbjct: 774 FLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNK 833

Query: 826 LALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGY 885
            A  +Q+ LR YR R ++   +  I  +Q K R  L +++ Q      A++ IQS +R +
Sbjct: 834 AATEIQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSF 893

Query: 886 KHKTQYRYFRKNYQAIQ 902
           K +  +   R+    +Q
Sbjct: 894 KPRKAFLEDRRKTVVVQ 910

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 69/127 (54%)

Query: 1234 MGTSAIEKSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELK 1293
            M +  IE  +F K++ TL+ Y++    N +++K   + ++ G+ L  N+  L E+C+   
Sbjct: 1363 MKSFQIENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG 1422

Query: 1294 LSNCRNSTRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMP 1353
            + +  +  +   Q SKLLQ+   S+E++ ++   C +L   Q+  L+ + + +  E P+P
Sbjct: 1423 VPDGTDCLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIP 1482

Query: 1354 YIVVKKV 1360
              ++K V
Sbjct: 1483 QEILKYV 1489

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C
           (MYO4) - SH] complement(1328357..1333033) [4677 bp, 1558
           aa]
          Length = 1558

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/916 (57%), Positives = 665/916 (72%), Gaps = 22/916 (2%)

Query: 1   MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
           M++EVGTRCWYP  E GWI  E++K+     KY L  TLE+G ++++   S++       
Sbjct: 1   MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE------- 53

Query: 60  EGS--PMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPF 117
           EGS   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF
Sbjct: 54  EGSCEELPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPF 113

Query: 118 AQMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTV 177
            ++++LYS DMI+ Y+    R EL+PHLFAIA +AY+ M +  +NQTIVVSGESGAGKTV
Sbjct: 114 DRVDQLYSQDMIQAYAG-RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTV 172

Query: 178 SAKYIMRYFASLDDNNAAVVS------EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRF 231
           SAKYIMRYFA+++ +N           EMS+ EKKILATNPIMEAFGNAKT RNDNSSRF
Sbjct: 173 SAKYIMRYFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRF 232

Query: 232 GKYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCIS 291
           GKYL+I+FD   +IIGA+IRTYLLERSRLVFQ  SERNYHIFYQLLAGLP   K+EL + 
Sbjct: 233 GKYLEILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLG 292

Query: 292 NPEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEI 351
             E+++Y+NQG    I GVDD +E+  T  ALS++ I +  Q  +FK+LA LLHIGNI++
Sbjct: 293 GVEEYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDV 352

Query: 352 KQXXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRD 411
           K+          +P+L++ACELLG+D Y F+KW+TKK+ITTRSEKIV+NL   QA+V RD
Sbjct: 353 KKTRNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARD 412

Query: 412 SVSKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYAN 471
           SV+KFIYS LFDWLV  IN +L    V +++ SFIGVLDIYGFEHFE NSFEQFCINYAN
Sbjct: 413 SVAKFIYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYAN 472

Query: 472 EKLQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSG 531
           EKLQQEFNQHVFKLEQEEYV+E+I+WSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G
Sbjct: 473 EKLQQEFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAG 532

Query: 532 TDESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESL 591
           +DE+WTQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  
Sbjct: 533 SDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGH 592

Query: 592 MNVLKNSQNDTLIS-LXXXXXXXXXXXXXXASISRP----KLINKKPTLGFMFKKSLGEL 646
           + VLK S N+TL++ L               S  +P    + +N+KPTLG +FK+SL EL
Sbjct: 593 LEVLKGSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVEL 652

Query: 647 MEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEF 706
           M  IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFP+RW++ EF
Sbjct: 653 MSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEF 712

Query: 707 IDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAE 766
             RY++LV +T W+ + ++ +  E   + CK IL  T    EK Q+G TKIFFK+G+LA 
Sbjct: 713 ALRYHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF 772

Query: 767 LESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKL 826
           LE  R  K+   +  IQKKI+    R  YLEI N ++   +  +  L+R  ++ + KT  
Sbjct: 773 LEKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWA 832

Query: 827 ALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYK 886
           A+ +Q+  R   +R      LD II  Q   R  LA++ L+      A+I IQ  IR +K
Sbjct: 833 AITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFK 892

Query: 887 HKTQYRYFRKNYQAIQ 902
            +T Y   R++   +Q
Sbjct: 893 PRTSYITNRRSTIVVQ 908

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 92/173 (53%), Gaps = 9/173 (5%)

Query: 1204 KLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVANHV 1263
            K+F+  +S ++ ++++F         I   M    +E  ++ ++I +L++Y++    N +
Sbjct: 1326 KIFSSSSSYKMDDILTF------FNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFNDL 1379

Query: 1264 LIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEELRV 1323
            ++K   + ++ G+ L  N+  L E+C+   +    +      Q SKLLQL  +++E++ +
Sbjct: 1380 IMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKKANMEDINI 1439

Query: 1324 VCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSD 1376
            + + C +L   QI  L+++  A+  E P+P  ++  V   A   KK+++ ++D
Sbjct: 1440 IWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFV---ADRVKKESALSND 1489

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
           Saccharomyces cerevisiae YOR326w MYO2 myosin heavy
           chain, start by similarity
          Length = 1550

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/915 (57%), Positives = 678/915 (74%), Gaps = 19/915 (2%)

Query: 1   MTFEVGTRCWYPSEN-GWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59
           M +EVGTRCWYPS++ GWI  EV+K+  +   Y+L+ TLEDG  ++L   S+D     S 
Sbjct: 1   MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPS- 59

Query: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119
               +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 60  ----LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115

Query: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179
           +++LYS +MI+ Y+    R EL+PHLFAIA +AY  M +  +NQTI+VSGESGAGKTVSA
Sbjct: 116 VDQLYSQEMIQAYAG-KLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSA 174

Query: 180 KYIMRYFASLDDNN---AAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236
           KYIMRYFAS+++NN   A    EMS+ EKKILATNPIMEAFGNAKTIRNDNSSRFGKYL+
Sbjct: 175 KYIMRYFASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLE 234

Query: 237 IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296
           I+FD   +IIGA++RTYLLERSRLVFQ ++ERNYHIFYQ+L+GL    K +L +++ + +
Sbjct: 235 ILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDY 294

Query: 297 YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXX 356
           +Y+NQG D  I+GVDDA E+ DT+ ALS++GI+   Q ++FKILA LLHIGNIE+K+   
Sbjct: 295 HYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRN 354

Query: 357 XXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416
                 DEPNL++A +LLG+D ++F+KW+TKK+I TRSEKIV++L   QA+V RDSV+KF
Sbjct: 355 DASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKF 414

Query: 417 IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476
           IYS LFDWLV+ INT+L   EV  ++ +FIGVLDIYGFEHF+ NSFEQFCINYANEKLQQ
Sbjct: 415 IYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQ 474

Query: 477 EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536
           EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN++GILSLLDEESRLP+GTDE W
Sbjct: 475 EFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGW 534

Query: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596
           T KLY+TL+KPP N+VFSKP+FGQT+F++SHYA +V YDV+GFIEKNRDTVS+  + VLK
Sbjct: 535 THKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLK 594

Query: 597 NSQNDTLISL-----XXXXXXXXXXXXXXASISRP----KLINKKPTLGFMFKKSLGELM 647
            S N+TL+S+                    S  +P    + I +KPTLG MFK+SL +LM
Sbjct: 595 ASNNETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLM 654

Query: 648 EIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFI 707
           E IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW++ EF 
Sbjct: 655 ETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFA 714

Query: 708 DRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAEL 767
            RY++LV + LWS++  S+ + E     CKEIL  T     K Q G TKIFFK+G+LA L
Sbjct: 715 LRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHL 774

Query: 768 ESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLA 827
           E LR  K+   ++ IQKKI+    R  YL  V+ ++ LQ  +  K++RL  E++ K   A
Sbjct: 775 EKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAA 834

Query: 828 LMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKH 887
           L++Q+  R   VR  V+  +  II +Q   R  +  + L E +R  A++ IQ  +R ++ 
Sbjct: 835 LLIQSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQP 894

Query: 888 KTQYRYFRKNYQAIQ 902
           +  + + +K    IQ
Sbjct: 895 RKSFLHEKKGTVVIQ 909

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 77/154 (50%), Gaps = 7/154 (4%)

Query: 1234 MGTSAIEKSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELK 1293
            M +  IE  +F  +I  L++ L+    N ++++   + ++ G+ L  N+  + E+C+   
Sbjct: 1351 MKSYDIEMEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHH 1410

Query: 1294 LSNCRNSTRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMP 1353
            +S      +   Q +KLLQL    V ++ ++   C  L   Q+  L+ +   +  E+P+ 
Sbjct: 1411 ISEVSVCLQHILQAAKLLQLKKRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIA 1470

Query: 1354 YIVVKKVQSWAQETKKDTSK----NSDIIFRLDS 1383
              +++ V   A++ K DTSK    N+D+   +D+
Sbjct: 1471 PEILQYV---AEKVKNDTSKAEVGNNDVFLPVDN 1501

>Scas_688.22
          Length = 1876

 Score =  503 bits (1294), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 285/747 (38%), Positives = 447/747 (59%), Gaps = 60/747 (8%)

Query: 69  NPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDM 128
           NP S +   +++ L++LNE +VLH ++ RY +  IYTYSG+ LVA NP+  ++ +Y+ + 
Sbjct: 62  NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNIK-IYTQEY 120

Query: 129 IKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFAS 188
           I  Y+  +S+E+  PH++AIA +AY  + ++ ++Q+++V+GESGAGKT + K I++Y AS
Sbjct: 121 INLYNG-SSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLAS 179

Query: 189 LDDN-------------NAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYL 235
           +  N             N   +++    E KIL +NPI+E+FGNA+T+RN+NSSRFGK++
Sbjct: 180 ITSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFI 239

Query: 236 QIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLP--AAIKEELCISNP 293
           +I FD +  I GA I  YLLE+SR++ Q   ERNYHIFYQLLAGL      K EL   + 
Sbjct: 240 KIEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSV 299

Query: 294 EQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ 353
             + YL++ S+P I GV+DAQ+FQD + A + +G        ++++L+ +LHIGN++   
Sbjct: 300 SDYKYLSK-SNPSIPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTS 358

Query: 354 XXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSV 413
                    ++P+     +LLG+   EF+  +   +     E +  +    QA  + +S+
Sbjct: 359 EKSQQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSL 416

Query: 414 SKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEK 473
           S+ +Y  LF ++V +IN  L   + S    ++IG+LDI GFE F+ NSFEQ CINY NEK
Sbjct: 417 SRTLYEKLFSFIVERINNSL---DHSSMTANYIGLLDIAGFEIFKHNSFEQLCINYTNEK 473

Query: 474 LQQEFNQHVFKLEQEEYVREKIEWSFIEFN-DNQPCIDLIENR---LGILSLLDEESRLP 529
           LQQ FN H+F LEQ EY++E I+W+F++F  D Q  IDLIEN+    G+L LLDEES LP
Sbjct: 474 LQQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILP 533

Query: 530 SGTDESWTQKLYQTLDKPPMNQVFSKPKFGQTK----FVISHYADNVEYDVEGFIEKNRD 585
           + +D+S+  KL  T D+         PKF ++K    FV+ HYA  VEY++EG++ KN+D
Sbjct: 534 NSSDDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKNKD 586

Query: 586 TVSESLMNVLKNSQNDTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGE 645
            +SE ++++L +S N+ + S                + +R +   ++  L          
Sbjct: 587 PLSECMISMLSSSTNEIVTSFFNESNKNVRGSSFRTASARHR---EQQML---------- 633

Query: 646 LMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQE 705
           L++ +  T+ H++RC+ PN+ K A +FD  ++L QLR  G+LE I+I+  G+P+R  F+E
Sbjct: 634 LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFKE 693

Query: 706 FIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLA 765
           F  RY +L D   +         A    K C+ +L +  L     +IG +K+FFK+GVLA
Sbjct: 694 FFQRYRLLSDENHF---------ATGFKKNCEILLSSLHLDPSLYKIGTSKLFFKAGVLA 744

Query: 766 ELESLRLKKMKGIAITIQKKIRAYKIR 792
           ELE+ + ++++ I I     +R   IR
Sbjct: 745 ELETKKDQRIRSIVIRFNSHLRGRIIR 771

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  498 bits (1281), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/735 (38%), Positives = 438/735 (59%), Gaps = 50/735 (6%)

Query: 69  NPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDM 128
           NP + +   D++ L++LNE +VL+ ++ RY +  IYTYSG+ LVA NP++ ++ +Y+ D 
Sbjct: 59  NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNIK-VYTQDY 117

Query: 129 IKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFAS 188
           +  Y   + +E+ +PH+FA+A  AY  + +Q ++Q+++V+GESGAGKT + K I++Y AS
Sbjct: 118 VNLYHG-SPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLAS 176

Query: 189 LDDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGA 248
           +  +     + +   E+KIL  NPI+E+FGNA+T+RN+NSSRFGK+++I FD    I GA
Sbjct: 177 ITSDEKLAHTNLESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKINGA 236

Query: 249 QIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAA-IKEELCISNPEQFYYLNQGSDPRI 307
            I  YLLE+SR++ Q   ERNYH+FYQLL+G+PA  +K    +SN    Y   + S+P I
Sbjct: 237 HIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYLRDSNPSI 296

Query: 308 DGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNL 367
            GVDDA +F   ++A +V+G  +    ++F+ +A +LHIGN+E            +  ++
Sbjct: 297 PGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIKN--DV 354

Query: 368 KLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVN 427
              C+L+G+D   F   + K +     E +  +    Q+  + +S+S+ +Y  LF  +V 
Sbjct: 355 APLCKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFAHIVR 414

Query: 428 QINTML-HGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLE 486
           +IN  L HG+       ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F LE
Sbjct: 415 RINRSLDHGS----MTENYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMFVLE 470

Query: 487 QEEYVREKIEWSFIEFN-DNQPCIDLIE---NRLGILSLLDEESRLPSGTDESWTQKLYQ 542
           Q EYV+E I+W FI++  D +  I+LIE   N  GILS+LDEES LP  TDES+  KL  
Sbjct: 471 QREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFYSKLMS 530

Query: 543 TLDKPPMNQVFSKPKFGQTK----FVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNS 598
             D          PKF ++K    FV+ HYA +VEY+V+ ++ KN+D +++ L+ +L  S
Sbjct: 531 AWDGKS-------PKFKRSKLQQCFVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLSES 583

Query: 599 QNDTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYI 658
            N  LIS                  SR        T     K+ L  L++ +++T+ H++
Sbjct: 584 SN-KLIS------------EFYTEQSRGHF---SKTASNRHKEQLTLLLDQLSSTDPHFV 627

Query: 659 RCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTL 718
           RC+ PN+ K A  FD  ++L QLR  G+LE I+I+  G+P+R  F+EF  RY +L     
Sbjct: 628 RCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYKILGADPK 687

Query: 719 WSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMKGI 778
           +S+         +S K C+ +L    L     ++G TK+FFK+GVLA+LE+ + +K+ GI
Sbjct: 688 FSN---------NSKKNCEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQKEEKISGI 738

Query: 779 AITIQKKIRAYKIRT 793
              +   I    +RT
Sbjct: 739 VTGLNAIIHGKTVRT 753

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  492 bits (1267), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 304/789 (38%), Positives = 475/789 (60%), Gaps = 51/789 (6%)

Query: 65  PVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELY 124
           PV  NP + +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ LVA NP+  +  LY
Sbjct: 68  PV--NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LY 124

Query: 125 SNDMIK----KYSRIT-------SREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGA 173
           S D I     K++R++       S E+L PH+FAIA +AY  + S+ ++Q+I+V+GESGA
Sbjct: 125 SEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGA 184

Query: 174 GKTVSAKYIMRYFASLDD---NNAAVVSEMSDIEK---KILATNPIMEAFGNAKTIRNDN 227
           GKT + K I++Y AS+     +N A VS  S +E    KIL +NPI+E+FGNA+T+RN+N
Sbjct: 185 GKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNN 244

Query: 228 SSRFGKYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEE 287
           SSRFGK+++I F+    I GA I  YLLE+SR+V Q   ERNYHIFYQLL+GL  +  + 
Sbjct: 245 SSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKN 304

Query: 288 LCIS--NPEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLH 345
           L +   N + +  L+  +   I G++D + F++ ++AL++IG +      +F+++A +L 
Sbjct: 305 LRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILL 364

Query: 346 IGNIEIKQXXXXXXXXPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQ 405
           IGNIE            ++  +   C  LG+D  +F   + +       E +  +   +Q
Sbjct: 365 IGNIEFVSDRAEQASFKND--VSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQ 422

Query: 406 ALVVRDSVSKFIYSLLFDWLVNQINTML-HGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQ 464
           A  + +++S+ +Y  LF ++V+ IN  L HG+       ++IG+LDI GFE FE NSFEQ
Sbjct: 423 AKFILNALSRNLYERLFGYIVDMINKNLDHGS----ATLNYIGLLDIAGFEIFENNSFEQ 478

Query: 465 FCINYANEKLQQEFNQHVFKLEQEEYVREKIEWSFIEFN-DNQPCIDLIENR---LGILS 520
            CINY NEKLQQ FN H+F LEQ EY++E I+W +I++  D Q  IDLIE++    G+L 
Sbjct: 479 LCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLP 538

Query: 521 LLDEESRLPSGTDESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFI 580
           LLDEE+ LP  TDES+  KL  T D+       S+ K G   F++ HYA +VEY VEG++
Sbjct: 539 LLDEEAVLPKSTDESFYSKLISTWDQNSSKFKRSRLKNG---FILKHYAGDVEYTVEGWL 595

Query: 581 EKNRDTVSESLMNVLKNSQNDTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFK 640
            KN+D ++++L+++L +SQND +  L              A+IS  ++  KK      FK
Sbjct: 596 SKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEV--KKSARTSTFK 653

Query: 641 KSLGE-------LMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKIS 693
            +          L+  + +T+ H++RC+ PN+ K    F+  ++L QLR  G+LE I+++
Sbjct: 654 TTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLA 713

Query: 694 CAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIG 753
             G+P+R +FQEF  RY +L      +   SS+  A S+ + C+ +L + +L  +  +IG
Sbjct: 714 REGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKA-STKQNCEFLLTSLQLDTKVYKIG 772

Query: 754 QTKIFFKSGVLAELESLRLKKMKGIAITIQKKIRAYKIR---TWYLEIVNCVRDLQN--R 808
            TK+FFK+GVLA+LE  +  K+  I I +   IR Y +R   T++L+ +   R + N  R
Sbjct: 773 NTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRVIGNTFR 832

Query: 809 IRSKLVRLD 817
           + ++LV+ D
Sbjct: 833 LYNRLVKED 841

>Kwal_23.5534
          Length = 1907

 Score =  485 bits (1248), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 281/739 (38%), Positives = 438/739 (59%), Gaps = 58/739 (7%)

Query: 69  NPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDM 128
           NP + +   D++ L++LNEP+VLH ++ RY +  IYTYSG+ LVA NP++ +  +YS D 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNIR-IYSQDY 113

Query: 129 IKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFAS 188
           +  Y   + +E+  PH+FAIA +AY  + S+ R+Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 114 VNLY-HGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLAS 172

Query: 189 L--DDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNII 246
           +  DD  +   S+ S  E+KIL +NPI+E+FGNA+T+RN+NSSRFGK+++I FD    I 
Sbjct: 173 ITSDDKLSPDTSQES-FERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKIN 231

Query: 247 GAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPA-AIKEELCISNPEQFYYLNQGSDP 305
           GA +  YLLE+SR++ Q   ERNYHIFYQ+L+G+ A  ++     +N  + Y   + S+P
Sbjct: 232 GAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYLRNSNP 291

Query: 306 RIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEP 365
            I GVDD+Q+F+  +++  ++G ++     +   ++ +LHIGNIE             + 
Sbjct: 292 SIPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEF--VSERAEQASFDG 349

Query: 366 NLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWL 425
           +++  C LLG+   +F   + K       + +       QA  + +S+S+ +Y  LF  +
Sbjct: 350 SVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAHI 409

Query: 426 VNQINTML-HGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFK 484
           V +IN  L HG+       ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F 
Sbjct: 410 VQRINNNLDHGS----MTENYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFV 465

Query: 485 LEQEEYVREKIEWSFIEFN-DNQPCIDLIE---NRLGILSLLDEESRLPSGTDESWTQKL 540
           LEQ EY++E ++W+FI++  D Q  IDLIE    + GIL LLDEES LP  TDES+  KL
Sbjct: 466 LEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL 525

Query: 541 YQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQN 600
            +T           K    Q  FV+ HYA +VEY+V+G++ KN+D + E+L+ +L NS N
Sbjct: 526 -ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSN 582

Query: 601 DTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKS-------LGELMEIINNT 653
           + +                          ++K + G  FK +       L  L++ +++T
Sbjct: 583 ELIRG----------------------FYSEKDSRGSSFKTTSIRHRDQLKSLLDRLSST 620

Query: 654 NVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYML 713
             H++RC+ PN  K A +F+  ++L QLR  G+LE I+I+  G+P+R  F+EF  RY +L
Sbjct: 621 EPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKIL 680

Query: 714 VDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLK 773
            D   +S+         +S K C+ +L +  L     ++G +K+FFK+GVLA LE+ +  
Sbjct: 681 SDEYRFSN---------TSKKNCEIVLSSLRLDPSVFKVGNSKLFFKAGVLASLEAKKEG 731

Query: 774 KMKGIAITIQKKIRAYKIR 792
           ++  +A  +  +I    +R
Sbjct: 732 RISDMASKLNARINGNAVR 750

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  484 bits (1245), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 285/750 (38%), Positives = 440/750 (58%), Gaps = 55/750 (7%)

Query: 69  NPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDM 128
           NP + +   DL+ L++LNE +VL  ++ RY +  IYTYSG+ LVA NP++ ++ +YSN  
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNIK-IYSNSY 117

Query: 129 IKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFAS 188
           IK Y   + +E+  PH+FA+A  AY  +  Q ++Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 118 IKLYHG-SPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLAS 176

Query: 189 LDDNNAAVVSEMSD-IEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIG 247
           +  ++  ++++ ++  E+KIL +NPI+E+FGNA+T+RN+NSSRFGK+++I FD    I G
Sbjct: 177 ITTDDKILLNQTNESFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYGKING 236

Query: 248 AQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPE-----QFYYLNQG 302
           A I  YLLE+SR++     ERNYHIFYQ+L+G+    K+EL     E      + YL + 
Sbjct: 237 AHIEWYLLEKSRVIQAHARERNYHIFYQILSGMS---KQELRAIGLESNSIVDYQYL-RH 292

Query: 303 SDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXP 362
           S+P I G+DD Q +Q+ ++A   +G        + K ++ +LHIGN+E            
Sbjct: 293 SNPSIPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQASIK 352

Query: 363 DEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSLLF 422
           +  ++K  C+LLG+   +F   + K +     E +       QA  + +S+S+ +Y  LF
Sbjct: 353 N--DIKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLYEKLF 410

Query: 423 DWLVNQINTML-HGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQH 481
           +++VNQIN  L HG+        FIG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H
Sbjct: 411 EYIVNQINKSLEHGS----MTEYFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHH 466

Query: 482 VFKLEQEEYVREKIEWSFIEFN-DNQPCIDLIENR----LGILSLLDEESRLPSGTDESW 536
           +F LEQ EY +E I+W+FI++  D Q  IDLIE +     GIL +L+EES LP  +D S+
Sbjct: 467 MFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSDASF 526

Query: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596
             KL  + D       F + K     F++ HYA +VEY+V  ++ KN+D ++E+L+ VL 
Sbjct: 527 YSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLLQVLN 583

Query: 597 NSQNDTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVH 656
           +  N  L+S               ++  R +               L  L+E + NT+ H
Sbjct: 584 DCAN-PLVSQFFADRIRGSSFRTSSNKHREQ---------------LHTLIEQLGNTDPH 627

Query: 657 YIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDT 716
           ++RC+ PN+ K A +FD  ++L QLR  G+LE I+I+  G+P+R  F+EF  RY +L D 
Sbjct: 628 FVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFFQRYKILSDE 687

Query: 717 TLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMK 776
             +++         +S K C+ +L +  L     ++G TK+FFK+GVLA LE L+ +++ 
Sbjct: 688 CRFTN---------NSKKNCEILLSSLHLDPTIYKVGNTKLFFKAGVLANLELLKEQRLS 738

Query: 777 GIAITIQKKIRAYKIRTWYLEIVNCVRDLQ 806
                +   I A  +R    EI + ++ LQ
Sbjct: 739 AAVTRLNAIISANSVRK---EIRSHLKKLQ 765

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  461 bits (1186), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 278/750 (37%), Positives = 420/750 (56%), Gaps = 47/750 (6%)

Query: 65  PVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELY 124
           PV  NP + +   +++ L++LNEP+VL+ ++ RY +  IYTYSG+ LVA NP+ ++  LY
Sbjct: 59  PV--NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLY 116

Query: 125 SNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMR 184
           SN  IK Y          PH+F +A  AY  + S+ ++Q+I+V+GESGAGKT + K I++
Sbjct: 117 SNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQ 176

Query: 185 YFASLDDNNAAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKN 244
           Y AS+  ++  V    ++ E KIL +NP++E+FGNA+T+RN+NSSRFGK+++I FD    
Sbjct: 177 YLASITSDSFEVS---NNFEMKILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSGK 233

Query: 245 IIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEEL--CISNPEQFYYLNQG 302
           I GA I  YLLE+SR+  + ++ERNYHIFYQLL G      E +    SN    Y +   
Sbjct: 234 INGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILAN 293

Query: 303 SDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIE-IKQXXXXXXXX 361
           S+  I GVDDA EFQ  + AL  +G        +FKI+A +LH GNIE + +        
Sbjct: 294 SNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASFK 353

Query: 362 PDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKFIYSLL 421
            D   +     LLG+   +F   + K       E +       QA  + +S+ + +Y  L
Sbjct: 354 SD---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEHL 410

Query: 422 FDWLVNQINTML-HGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQ 480
           F ++V+ IN  L HG+  ++    +IG+LDI GFE FE NSFEQ CINY NEKLQQ FN 
Sbjct: 411 FGYIVDTINMSLNHGSMTAN----YIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNH 466

Query: 481 HVFKLEQEEYVREKIEWSFIEFN-DNQPCIDLIENR---LGILSLLDEESRLPSGTDESW 536
           H+F LEQ EY++E I+W ++++  D Q  I+L+E +    GIL LLDEE+ LP   D S+
Sbjct: 467 HMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSF 526

Query: 537 TQKLYQTLDKPPMNQVFSKPKFGQTK----FVISHYADNVEYDVEGFIEKNRDTVSESLM 592
             KL  T  +       +  KF ++K    FV+ HYA +VEY V G++ KN+D ++E+L+
Sbjct: 527 YSKLISTWQQ-------NSTKFKRSKLDMCFVLKHYAGDVEYHVNGWLAKNKDPLNENLV 579

Query: 593 NVLKNSQNDTLISLXXXXXXXXXXXXXXASISRPKLINKKPTLG----------FMFKKS 642
           N+L  S N  +                   ++         +LG             ++ 
Sbjct: 580 NILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTALSRHREQ 639

Query: 643 LGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWS 702
              L+  +  TN H++RC+ PN+ K++  FD  ++L QLR  G+LE I+I+  G+P+R  
Sbjct: 640 QSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRIL 699

Query: 703 FQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSG 762
           F+EF +RY +L +     D +S   N + S +    ++    L     ++G +K+FFK+G
Sbjct: 700 FKEFYERYRILSEHL---DKSSDAINYKQSSQI---LISELHLDPTTYKVGTSKLFFKAG 753

Query: 763 VLAELESLRLKKMKGIAITIQKKIRAYKIR 792
            LAELES +   +  I +     IR +  R
Sbjct: 754 TLAELESKKESILFEITVRFNSIIRGWSQR 783

>Kwal_26.7587
          Length = 1250

 Score =  445 bits (1144), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 270/745 (36%), Positives = 412/745 (55%), Gaps = 44/745 (5%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++ A+   +K R+ N  IYTY G VL++ NPF  +  +Y++ +++ Y    +
Sbjct: 40  DLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPFRDLG-IYTDSVLRSYVG-KN 97

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  M + + NQ +++SGESGAGKT +AK IM+Y A+  + ++  +
Sbjct: 98  RLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSDSI 157

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+A+       I  YLLE+
Sbjct: 158 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEK 214

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q + ERN+HIFYQ   G     ++   +  PEQ+ Y +      +D +DD  +FQ
Sbjct: 215 QRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDDLSDFQ 274

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
           +T+ A+SVIGI    Q EVF+ LA +L IGNI   +         D         LL +D
Sbjct: 275 ETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAYLLQVD 334

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                + L ++ + T     R       L   QA  V+D+++K IY+ LFDW V+++N  
Sbjct: 335 SNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVDRVNLS 394

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           L     +++    IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQEEY R
Sbjct: 395 LQALPGANKS---IGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQEEYAR 451

Query: 493 EKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMN 550
           E+IEW+ I++ DN+   DLIE R   GI++ +++         ++  Q   Q L     N
Sbjct: 452 EQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL-----N 506

Query: 551 QVFSKPKF--GQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLXX 608
              S P F    +KF+I HYA +V YD+ G  +KN+D + + L+ ++K S N+ L SL  
Sbjct: 507 LFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFLCSLFP 566

Query: 609 XXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKV 668
                        S  RP      P+ G    KS  EL+E ++     YIR +KPN +K 
Sbjct: 567 TVVDKN-------SKRRP------PSAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKS 613

Query: 669 AWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESN 728
             ++DD  VL Q++  G+ E ++I  AGF  R  F +F++R+Y+L     ++   + + +
Sbjct: 614 PNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPQCSYAGDYTWQGD 673

Query: 729 AESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQKKIR 787
              ++K    IL    +   + Q+G +K+F K+   L  LE++R K    +A  IQ+  R
Sbjct: 674 TLEAVKL---ILKDASIPPTEYQLGVSKVFIKTPESLFALETMRDKYWHNMAARIQRAWR 730

Query: 788 AYKIRTWYLEIVNCVRDLQNRIRSK 812
            + +R      ++    +Q  IR K
Sbjct: 731 RFLLRR-----IDAASRIQRAIREK 750

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  434 bits (1115), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 265/748 (35%), Positives = 410/748 (54%), Gaps = 50/748 (6%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++ A+   +K R++N  IYTY G VL++ NPF  +  +Y++ ++ +Y +  +
Sbjct: 40  DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLG-IYTDAVMNEY-KGKN 97

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  M S + NQ +++SGESGAGKT +AK IM+Y A+    +   +
Sbjct: 98  RLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESI 157

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+ +       I  YLLE+
Sbjct: 158 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEK 214

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G   A ++   +  PEQ+ Y         + +DD Q++Q
Sbjct: 215 QRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQ 274

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
           +T+ A+ VIG+    Q ++F++LA +L IGN+   +         D         LL +D
Sbjct: 275 ETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQID 334

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ + T     R       L   QA  VRD+++K IY+ LFDW+V+++N  
Sbjct: 335 SQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKS 394

Query: 433 LH---GAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEE 489
           L    GAE S      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQE 
Sbjct: 395 LQAFPGAEKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQET 448

Query: 490 YVREKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKP 547
           Y REKI+W+ I++ DN+   DLIE R   GI + +++          +  Q   Q L   
Sbjct: 449 YEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL--- 505

Query: 548 PMNQVFSKPKFG--QTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLIS 605
             N   + P F     KFVI HYA +V YD++G  +KN+D + + L+ ++  + N  L +
Sbjct: 506 --NLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLAT 563

Query: 606 LXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNS 665
           +               S  RP      PT G    KS  +L+E ++     YIR +KPN 
Sbjct: 564 IFPDTVDRE-------SKRRP------PTAGDKIIKSANDLVETLSKAQPSYIRTIKPNE 610

Query: 666 SKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASS 725
           +K   ++DD  VL Q++  G+ E ++I  AGF  R  F++F++R+Y+L     ++   + 
Sbjct: 611 TKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTW 670

Query: 726 ESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQK 784
           + +   ++K+   IL  + +  ++ Q+G T +F K+   L  LE +R +    +A  IQ+
Sbjct: 671 QGDTLDAVKY---ILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQR 727

Query: 785 KIRAYKIRTWYLEIVNCVRDLQNRIRSK 812
             R +  R      ++    +Q  IR +
Sbjct: 728 AWRRFLQRR-----IDAATKIQRTIRER 750

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  434 bits (1116), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 262/743 (35%), Positives = 413/743 (55%), Gaps = 40/743 (5%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++ A+   +K R+ N  IYTY G VL++ NPF  +  +Y++ +++ Y +  +
Sbjct: 38  DLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPFRDLG-IYTDAVLESY-KGKN 95

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  + + + NQ +++SGESGAGKT +AK IM+Y A+    + A +
Sbjct: 96  RLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHEASI 155

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+ +      QI  YLLE+
Sbjct: 156 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITNYLLEK 212

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G     ++   +  P+Q+ Y +      +D +DD  ++Q
Sbjct: 213 QRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDDLHDYQ 272

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
           +TI A+ VIG++   Q ++F++L+ +L IGN+   +         D         L+ +D
Sbjct: 273 ETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFVAYLMQVD 332

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ + T     R       L   QA  VRD+++K IY+ LFDW+V+++N  
Sbjct: 333 SGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIVDRVNVS 392

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           L        V+S IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQEEY +
Sbjct: 393 LKA--FPGAVKS-IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEEYNK 449

Query: 493 EKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMN 550
           E+I+W+ I++ DN+   DLIE++   GI + LD+          +  Q   Q L+    N
Sbjct: 450 EQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRLNLFSTN 509

Query: 551 QVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLXXXX 610
             F       +KFVI HYA +V YD+ G  +KN+D + + L  +++ + N  L ++    
Sbjct: 510 AHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLSTI---- 562

Query: 611 XXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKVAW 670
                     +S  RP      PT G    KS  EL+E ++     YIR +KPN +K   
Sbjct: 563 ---FPDTIDKSSKRRP------PTAGNKIIKSANELVETLSKAQPSYIRTIKPNQTKSPR 613

Query: 671 EFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESNAE 730
           ++DD  VL Q++  G+ E ++I  AGF  R +F++F++R+Y+L     ++   + + +  
Sbjct: 614 DYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPKCSYAGDYTWQGDTL 673

Query: 731 SSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQKKIRAY 789
            ++   K+IL    +   + Q+G TK+F K+   L  LE +R +    +A  IQ+  R +
Sbjct: 674 GAV---KQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRDRYWYNMAARIQRAWRRF 730

Query: 790 KIRTWYLEIVNCVRDLQNRIRSK 812
             R      ++    +Q  IR K
Sbjct: 731 IQRR-----IDSAIKIQRAIREK 748

>Scas_721.119
          Length = 1232

 Score =  432 bits (1111), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 258/716 (36%), Positives = 394/716 (55%), Gaps = 39/716 (5%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++  +   +K R+MN  IYTY G VL++ NPF  +  +Y++ +++ Y +  +
Sbjct: 40  DLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPFRDLG-IYTDAIVESY-KGKN 97

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  M S + NQ +++SGESGAGKT +AK IM+Y AS    ++  +
Sbjct: 98  RLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASASTTHSESI 157

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+++       I  YLLE+
Sbjct: 158 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEK 214

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G   A ++   +  PEQ+ Y +      +D +DD  +++
Sbjct: 215 QRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDDVNDYR 274

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
           +T+ A+ VIG++   Q ++F++LA +L IGN+   +         D         LL +D
Sbjct: 275 ETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFVAYLLQID 334

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ + T     R       L   QA  VRD+++K IY+ LF+W+V ++N  
Sbjct: 335 APLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVGRVNVS 394

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           L     +D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQE Y R
Sbjct: 395 LQAYPGADRS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYKR 451

Query: 493 EKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMN 550
           EKI+W+ I++ DN+   DLIE +   GI + +++          +  Q   Q L     N
Sbjct: 452 EKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRL-----N 506

Query: 551 QVFSKPKF--GQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLXX 608
              S P F     KFVI HYA +V YDV G  +KN+D + + L+ ++  + N  L  +  
Sbjct: 507 MFSSNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFLSGIFP 566

Query: 609 XXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKV 668
                        S  RP      PT G    KS  EL+E ++     YIR +KPN +K 
Sbjct: 567 VEVDKE-------SKRRP------PTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKS 613

Query: 669 AWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESN 728
             ++DD  VL Q++  G+ E ++I  AGF  R +F++F++R+Y+L     +   A   + 
Sbjct: 614 PNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPHCSY---AGDYTW 670

Query: 729 AESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQ 783
              ++   + IL    +   + Q+G T +F K+   L  LE +R +    +A  IQ
Sbjct: 671 QGETLDAVQHILNDASIPASEYQLGTTSVFIKTPETLFALEHMRDRYWHNMAARIQ 726

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  428 bits (1101), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 256/724 (35%), Positives = 402/724 (55%), Gaps = 43/724 (5%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT L+ +++ ++   +K R++N  IYTY G VL++ NPF  +  +Y++ ++K Y +  +
Sbjct: 41  DLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLG-IYTDAIMKSY-QGKN 98

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH++AI+   Y  + + + NQ +++SGESGAGKT +AK IM Y A+    ++  +
Sbjct: 99  RLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSESI 158

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+++       I  YLLE+
Sbjct: 159 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEK 215

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q  +ERN+HIFYQ   G     ++   +  PEQ+ Y +      +D +DD ++F+
Sbjct: 216 QRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDDVKDFE 275

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
            TI A+ VIG+    Q ++F++LA +L IGNI   +         D         LL +D
Sbjct: 276 ATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAYLLQVD 335

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ + T     R       L   QA  VRD+++K IY+ LF+W+V+++N  
Sbjct: 336 SQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVDRVNKS 395

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           LH    +D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ+ Y R
Sbjct: 396 LHAYPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYAR 452

Query: 493 EKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLP----SGTDESWTQKLYQTLDK 546
           EKI+W+ I++ DN+   DLIE +   GI + +++         S  D+++ Q+L      
Sbjct: 453 EKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLSLFSSN 512

Query: 547 PPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISL 606
           P   Q        Q KFVI HYA +V YDV G  +KN+D + + L+ ++  + N  L +L
Sbjct: 513 PHFEQR-------QNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTTL 565

Query: 607 XXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSS 666
                             RP      PT G    KS  EL+E ++     YIR +KPN +
Sbjct: 566 FPNQVDKDNKR-------RP------PTAGDKIIKSANELVETLSKAQPSYIRTIKPNQT 612

Query: 667 KVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSE 726
           K   ++DD  VL Q++  G+ E ++I  AGF  R  F++F++R+Y+L     ++   +  
Sbjct: 613 KSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPRCSYAGDYTWT 672

Query: 727 SNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQKK 785
            +   +++    IL    +  ++ Q+G T++F K+   L  LE++R K    +A  IQ+ 
Sbjct: 673 GDILEAVRL---ILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKFWHNMAARIQRA 729

Query: 786 IRAY 789
            R Y
Sbjct: 730 WRRY 733

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  428 bits (1101), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 265/743 (35%), Positives = 406/743 (54%), Gaps = 40/743 (5%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++ ++   +K R+ +  IYTY G VL++ NPF  +  +Y++D +K Y +  +
Sbjct: 40  DLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLG-IYTDDTMKSY-QGKN 97

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E  PH+FAIA + Y  + S + NQ +++SGESGAGKT +AK IM+Y A+    ++  +
Sbjct: 98  RLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSESI 157

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
           S++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I FDA        I  YLLE+
Sbjct: 158 SKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITNYLLEK 214

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G P   ++   +  PEQ+ Y +      ++ +DD +EF 
Sbjct: 215 QRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDDVEEFN 274

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
           +T+ A+  IG+  S Q ++F+ LA +L IGNI   +         D+        LL + 
Sbjct: 275 ETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAYLLEVQ 334

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ I T     R     + L   QA  VRD+++K IY+ LF+W+V ++N  
Sbjct: 335 EELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVERVNNS 394

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           L     +D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ+ Y +
Sbjct: 395 LQAFPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYKK 451

Query: 493 EKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMN 550
           E+I W+ IE+ DN+   DLIE +   GI + +++         ++  Q   Q L+    N
Sbjct: 452 EQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLNLFTTN 511

Query: 551 QVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLXXXX 610
             F   +  Q KFV+ HYA +V YD+ G  +KN+D + + L+ +L  + N  +  +    
Sbjct: 512 PHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVREIFPDQ 568

Query: 611 XXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKVAW 670
                      S  RP      PT G    KS  EL+E ++     YIR +KPN +K + 
Sbjct: 569 PQTD-------SRRRP------PTSGDKIIKSANELVETLSKAQPSYIRTIKPNDTKSST 615

Query: 671 EFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESNAE 730
            +DD  VL Q++  G+ E ++I  AGF  R  F++F++R+Y+L     ++     +    
Sbjct: 616 IYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQCSYAGDYVWDGETL 675

Query: 731 SSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQKKIRAY 789
            ++K    IL    +   + +IG T+IF K    L  LE++R K    +A  IQ+  R Y
Sbjct: 676 DAVKL---ILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWYNMAARIQRAWRRY 732

Query: 790 KIRTWYLEIVNCVRDLQNRIRSK 812
             +      ++    +QN IR K
Sbjct: 733 LQKR-----IDAAIRIQNAIRGK 750

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  417 bits (1072), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 263/745 (35%), Positives = 406/745 (54%), Gaps = 45/745 (6%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++ ++   +K R+ N  IYTY G VL++ NPF  +  +Y+N +++ Y +  +
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLG-IYTNAVLESY-KGKN 97

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  + S + NQ +++SGESGAGKT +AK IM+Y A+  ++++  +
Sbjct: 98  RLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESI 157

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
            ++ D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+++       I  YLLE+
Sbjct: 158 GKIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEK 214

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G     K+   +  PEQ+ Y         D +   ++++
Sbjct: 215 QRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQL-MRKDYE 273

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
            T+ A+  IG+    Q ++F++LA +L IGNI   +         D         LL +D
Sbjct: 274 GTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQVD 333

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ + T     R       L   QA  VRD+++K IY+ LFDW+V+++N  
Sbjct: 334 ASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVS 393

Query: 433 LHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVR 492
           L     +D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQE Y R
Sbjct: 394 LQAFPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYER 450

Query: 493 EKIEWSFIEFNDNQPCIDLIE--NRLGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMN 550
           EKI+W+ I++ DN+   DLIE  N  GIL+ +++          +  Q   Q L     N
Sbjct: 451 EKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL-----N 505

Query: 551 QVFSKPKF--GQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLXX 608
              S P F     KFVI HYA +V YD+ G  +KN+D + + L+ ++  + N  L ++  
Sbjct: 506 LFNSNPYFELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFP 565

Query: 609 XXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKV 668
                        S  RP      PT G    KS  EL+E ++     YIR +KPN +K 
Sbjct: 566 DDVDKD-------SKRRP------PTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKS 612

Query: 669 AWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESN 728
             ++DD  VL Q++  G+ E ++I  AGF  R +F++F++R+Y+L     ++   + + +
Sbjct: 613 PNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGD 672

Query: 729 AESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQKKIR 787
              ++K    IL    +  ++ Q+G T +F K+   L  LE +R K    +A  IQ+  R
Sbjct: 673 TLEAVKL---ILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWR 729

Query: 788 AYKIRTWYLEIVNCVRDLQNRIRSK 812
            +  R      ++    +Q  IR K
Sbjct: 730 RFLQRR-----IDAAIKIQRTIREK 749

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  411 bits (1057), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 255/725 (35%), Positives = 399/725 (55%), Gaps = 45/725 (6%)

Query: 78  DLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITS 137
           DLT LS +++  +   +K R+ N  IYTY G VL++ NPF  +  +Y++ +++ Y +  +
Sbjct: 39  DLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLG-IYTDQVLETY-KGRN 96

Query: 138 REELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVV 197
           R E+ PH+FAIA   Y  + + + NQ +++SGESGAGKT +AK IM+Y A+   ++ A +
Sbjct: 97  RLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEASI 156

Query: 198 SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLER 257
             + D+   +LATNP++E+FG AKT+RN+NSSR GKYL+I F+A+      QI  YLLE+
Sbjct: 157 GRIKDM---VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITNYLLEK 213

Query: 258 SRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQ 317
            R+V Q ++ERN+HIFYQ   G     ++   +  PEQ+ Y +      +D +DD  +++
Sbjct: 214 QRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDDLNDYE 273

Query: 318 DTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQXXXXXXXXPDEPNLKLACELLGLD 377
            T+ A++VIG++ + Q E+F++L+ +L IGN+   +         D         LL +D
Sbjct: 274 ATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTFMEDDEGNAKIADTSITDFVAYLLQVD 333

Query: 378 PYEFSKWLTKKEITT-----RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTM 432
                K L ++ I T     R       L   QA  VRD+++K IY+ LF+W+V+++N  
Sbjct: 334 AGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEWIVDRVNVS 393

Query: 433 LH---GAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEE 489
           L    GAE S      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQEE
Sbjct: 394 LQALPGAEKS------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEE 447

Query: 490 YVREKIEWSFIEFNDNQPCIDLIENR--LGILSLLDEESRLPSGTDESWTQKLYQTLDKP 547
           Y +E+I+W+ I++ DN+   +LIE +   GI + L++          +  Q   Q L   
Sbjct: 448 YAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFAQRL--- 504

Query: 548 PMNQVFSKPKF--GQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLIS 605
             N   S P F    +KFVI HYA +V YD+ G  +KN+D +   L+ +L ++ N  L +
Sbjct: 505 --NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSNTFLAT 562

Query: 606 LXXXXXXXXXXXXXXASISRPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNS 665
           +                           T G    +S  EL++ ++     YIR +KPN 
Sbjct: 563 IFPDTGDKDSKRIPS-------------TAGDKIIRSANELVDTLSKAQPSYIRTIKPNQ 609

Query: 666 SKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASS 725
           +K   ++DD  VL Q++  G+ E ++I  A +  R  F +F++R+Y+L     ++   + 
Sbjct: 610 TKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERFYLLSPQCSYAGDYTW 669

Query: 726 ESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSG-VLAELESLRLKKMKGIAITIQK 784
           + N   ++     IL  T +   + Q+G TK+F K+   L  LE++R K    +A  IQ+
Sbjct: 670 QGNTLDAVNL---ILRDTSIPVTEYQLGVTKVFIKTPETLFALENMRDKYWHNMASRIQR 726

Query: 785 KIRAY 789
             R +
Sbjct: 727 AWRRF 731

>CAGL0E00649g complement(59647..61122) similar to sp|P25646
           Saccharomyces cerevisiae YCR079w, hypothetical start
          Length = 491

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 6/84 (7%)

Query: 695 AGFPSRWSFQEFIDRYYMLVDTTLWSDV-ASSESNAESSIKFCKE-----ILGATELSHE 748
           AG+PS   F   +DRY  L+    W+D+  S E   +  IK C       + GA +    
Sbjct: 138 AGYPSEQDFFHLLDRYRKLIGGKYWNDLYQSREQFYDKFIKNCNTKQELVLFGADQKGSR 197

Query: 749 KCQIGQTKIFFKSGVLAELESLRL 772
                   I  K+ +L +LE LRL
Sbjct: 198 MIFDKWGNIIDKTSLLTDLERLRL 221

>KLLA0D11484g 985655..987418 similar to sp|P32608 Saccharomyces
           cerevisiae YGL252c RTG2 retrograde regulation protein
           singleton, start by similarity
          Length = 587

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 29  DGKYHLQFTLEDGSLIDLDTDSIDYNDSLSNEGSPMPVLRNPHSR 73
           DG +H   + +D S IDL   SID N  LS  G P P   NP+ R
Sbjct: 498 DGVFHFSTSEKDESAIDLQMLSIDEN--LSGNGKPTPT-GNPNKR 539

>ADR141W [1882] [Homologous to ScYMR063W (RIM9) - SH]
            complement(954614..955414) [801 bp, 266 aa]
          Length = 266

 Score = 31.6 bits (70), Expect = 4.1,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 51/122 (41%), Gaps = 19/122 (15%)

Query: 1102 ILGEMIKLKQFLSAKQFISTLFESIH------SNVIEESSYDKKLKSGFQWFSVAFTNLS 1155
            ++G M  ++  L     ++ LF+S        SN +  S ++      F W     T+ +
Sbjct: 1    MMGGMSVVEWLLLGSTTLALLFQSFATFSVPLSNGVTLSHFNGYKFGVFGWCDTTHTHCT 60

Query: 1156 VLR-------------NSEFSLGKETSKSLSKLLADYENDLSKMLRSWILSILNDMFREN 1202
             L+               E SL  +   SLSKLL  +   L  M+  W++ +L+  ++ +
Sbjct: 61   PLKLGYSAEDGFLFAGQDELSLPTQAKYSLSKLLVVHPLALCSMVVLWLMVVLSQCYKHS 120

Query: 1203 DK 1204
            D+
Sbjct: 121  DR 122

>Sklu_1804.2 YIL005W, Contig c1804 2273-4417
          Length = 714

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 29/93 (31%)

Query: 693 SCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQI 752
           +CAGF   W          +L +  L S ++S+  N ES+ K CKE LG           
Sbjct: 217 NCAGFQRTWK---------ILSNKLLTSGISSAHFNCESNQKICKE-LGF---------- 256

Query: 753 GQTKIFFKSGVLAELESLRLKKMKGIAITIQKK 785
                    G LAEL + R+ +   +A+ +  K
Sbjct: 257 ---------GGLAELTNHRISRHPEVALVLPGK 280

>Scas_679.26
          Length = 775

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%)

Query: 1319 EELRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKD 1370
            +EL+  CQ C  +NL  ++++   +KA      + Y+  K++ S   E  +D
Sbjct: 69   DELKPTCQKCINMNLECVYSMPKPRKAKGSSTSVRYVTHKQMTSEDDEQGQD 120

>CAGL0M09823g complement(971284..974670) highly similar to tr|Q06685
            Saccharomyces cerevisiae YLR410w, hypothetical start
          Length = 1128

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 8/85 (9%)

Query: 1182 DLSKMLRSWILSILNDMFREN-DKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIE 1240
            D+SK+   W  S    +F+E  +KLF +F SVE       K    KI  +   M   A+ 
Sbjct: 756  DVSKLQERWCTSEDPGLFKERWNKLFKEFVSVE-------KADPSKISELYDTMKYDALH 808

Query: 1241 KSLFGKLIETLIQYLNLNVANHVLI 1265
               F + I    +  N N++NH L+
Sbjct: 809  NREFLQNIFDPGELANENISNHSLV 833

>Scas_694.19
          Length = 581

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 28 RDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSNEGSPMPVLRNPHSRESTQDLTTLSY 84
          +DG YHL  TL   +  ++D DS+  +D   NE           + EST   T L+Y
Sbjct: 40 KDGLYHLNGTLSRATTREIDGDSLQSSDEEKNE----------QASESTSPYTLLTY 86

>CAGL0J08657g complement(855068..856741) similar to tr|Q12511
           Saccharomyces cerevisiae YOR090c PTC5, hypothetical
           start
          Length = 557

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 560 QTKFVISHYADNVEYDV---EGFIEKNRDTVSESLMNVLKNSQNDTLIS 605
             K + S Y  N+ +DV   +GF++ + D V  SL  +LK   ND +++
Sbjct: 213 HNKALTSDYTHNMNFDVALEKGFVQLDNDIVYHSLGKLLKEPTNDNMLA 261

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 44,138,795
Number of extensions: 1966671
Number of successful extensions: 8179
Number of sequences better than 10.0: 120
Number of HSP's gapped: 8312
Number of HSP's successfully gapped: 137
Length of query: 1396
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1282
Effective length of database: 12,649,657
Effective search space: 16216860274
Effective search space used: 16216860274
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)