Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06314g65364330300.0
YAL028W5281473772e-38
Scas_663.275591663684e-37
Scas_592.145491733595e-36
YOR324C6021662941e-27
KLLA0A03938g4201421745e-13
Sklu_2164.44651511729e-13
Kwal_26.70633781851471e-09
YOL093W (TRM10)29371721.0
YLR200W (YKE2)11437652.9
KLLA0F24684g973118693.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06314g
         (643 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06314g complement(603668..605629) some similarities with s...  1171   0.0  
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...   149   2e-38
Scas_663.27                                                           146   4e-37
Scas_592.14                                                           142   5e-36
YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...   117   1e-27
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    72   5e-13
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         71   9e-13
Kwal_26.7063                                                           61   1e-09
YOL093W (TRM10) [4727] chr15 (142814..143695) Member of the prot...    32   1.0  
YLR200W (YKE2) [3602] chr12 (549014..549358) Prefoldin subunit 6...    30   2.9  
KLLA0F24684g complement(2294708..2297629) similar to sp|Q12389 S...    31   3.4  

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score = 1171 bits (3030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/643 (89%), Positives = 578/643 (89%)

Query: 1   MDLLIQRMENPNMKHQPKIPFTDINTRIHRNKLAMKSANEEGSGQDSDSGNDEAMQDHLL 60
           MDLLIQRMENPNMKHQPKIPFTDINTRIHRNKLAMKSANEEGSGQDSDSGNDEAMQDHLL
Sbjct: 1   MDLLIQRMENPNMKHQPKIPFTDINTRIHRNKLAMKSANEEGSGQDSDSGNDEAMQDHLL 60

Query: 61  AKADESKRHVKRANTIGITPKGNLNVHRPRRGTLIISDDEDGVSMHSASFTNMDDINGID 120
           AKADESKRHVKRANTIGITPKGNLNVHRPRRGTLIISDDEDGVSMHSASFTNMDDINGID
Sbjct: 61  AKADESKRHVKRANTIGITPKGNLNVHRPRRGTLIISDDEDGVSMHSASFTNMDDINGID 120

Query: 121 YSKVXXXXXXXXXKKRLDTKKIFEPYVQRSVSDPKRSFKAGSNTDIEPKLGNSKPMIIRQ 180
           YSKV         KKRLDTKKIFEPYVQRSVSDPKRSFKAGSNTDIEPKLGNSKPMIIRQ
Sbjct: 121 YSKVNTNNNLNSNKKRLDTKKIFEPYVQRSVSDPKRSFKAGSNTDIEPKLGNSKPMIIRQ 180

Query: 181 VTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTK 240
           VTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTK
Sbjct: 181 VTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTK 240

Query: 241 TEKPTPNRLGDQQEEVGNGGQATLFTADKFIKSPVKSLDNEERPELSXXXXXXXXXXXXX 300
           TEKPTPNRLGDQQEEVGNGGQATLFTADKFIKSPVKSLDNEERPELS             
Sbjct: 241 TEKPTPNRLGDQQEEVGNGGQATLFTADKFIKSPVKSLDNEERPELSNGQNQSKNQNQTQ 300

Query: 301 FHKEHKKHRHQKSFSQSYGSNDQKRLVNQFLQSIEKXXXXXXXXXXXXXXXXXTLSVGKN 360
           FHKEHKKHRHQKSFSQSYGSNDQKRLVNQFLQSIEK                 TLSVGKN
Sbjct: 301 FHKEHKKHRHQKSFSQSYGSNDQKRLVNQFLQSIEKSGNNSALSSNNASAYGSTLSVGKN 360

Query: 361 GVFNIPQHEQMPDLMDYXXXXXXXXXXYHDLADPSGSKRKYSKVYSNPNMRPGSATPFXX 420
           GVFNIPQHEQMPDLMDY          YHDLADPSGSKRKYSKVYSNPNMRPGSATPF  
Sbjct: 361 GVFNIPQHEQMPDLMDYSSNLSLQSLLYHDLADPSGSKRKYSKVYSNPNMRPGSATPFSY 420

Query: 421 XXXXXXXXXXXXXXAIGSYRSGLATSSFFFSNAKLTSKEKIKNSEIINSNANDSNMFLGT 480
                         AIGSYRSGLATSSFFFSNAKLTSKEKIKNSEIINSNANDSNMFLGT
Sbjct: 421 SSASLTSNSDDSRSAIGSYRSGLATSSFFFSNAKLTSKEKIKNSEIINSNANDSNMFLGT 480

Query: 481 NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL 540
           NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL
Sbjct: 481 NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL 540

Query: 541 KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM 600
           KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM
Sbjct: 541 KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM 600

Query: 601 RKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIG 643
           RKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIG
Sbjct: 601 RKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIG 643

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/147 (49%), Positives = 103/147 (70%)

Query: 481 NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL 540
           +E DYYQ+HI  +L + E+ +K+ LK  +LKDE +L  NI +FD +  +L++L+S+ +G 
Sbjct: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415

Query: 541 KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM 600
           K  +  +YL  LK DFD+ NPESFE++L  T+  NV  L+ LE +M+ C+ +L  +KE M
Sbjct: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475

Query: 601 RKMESLLYLENSLMVSKKNTGLAYKYR 627
           RKMESLL LENSLM+SKKN   A KYR
Sbjct: 476 RKMESLLSLENSLMISKKNVTFASKYR 502

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 86/207 (41%), Gaps = 43/207 (20%)

Query: 148 QRSVSDPKRSFKAGSNTDIEPKLGN-----SKPMIIRQVTASNLAALADGKNRLV----- 197
           +R + D K+   AG+     P +G+     +KP +  Q + SNLAAL + + +       
Sbjct: 28  KRPLEDVKQMIDAGT-----PDVGHKSTVETKPNVGWQASHSNLAALHEKEQKYEMEHHH 82

Query: 198 EKKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVG 257
            +  L R  IPDYTS +T  FS+CMFN   +K  + +  K++      P           
Sbjct: 83  ARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLSTMKSSGLSPKHP----------- 131

Query: 258 NGGQATLFTADKFIKSPVKSLDNEERPELSXXXXXXXXXXXXXFH-KEHKKHRHQ----- 311
                  F      K P      E +P                   ++H  HRH      
Sbjct: 132 -------FNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYKDNDK 184

Query: 312 ---KSFSQSYGSNDQKRLVNQFLQSIE 335
              KS S+S+   D+KRLV++FL+S+E
Sbjct: 185 YGLKSPSRSF-VKDKKRLVHRFLKSME 210

>Scas_663.27
          Length = 559

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 115/166 (69%)

Query: 478 LGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQI 537
           +  NE +YYQ HI + L + E  +K +L++ ++KDE +L   ++ FDNLT  LQN+K++I
Sbjct: 383 INCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRI 442

Query: 538 LGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQK 597
             L + I  +YL+ +K  F+E++  SFE +LR +VE ++K LE LEN+M  CQ +L +Q+
Sbjct: 443 DELYDVINEKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKLQEQR 502

Query: 598 ETMRKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIG 643
           ETMR++++L+ +ENSL+ SKKN    Y YR++++DIL +  ++  G
Sbjct: 503 ETMRQLDNLILIENSLLESKKNVKHIYSYRFLVFDILVIFVVLYFG 548

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 21/136 (15%)

Query: 199 KKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVGN 258
           +K L+   +PDY++ + G FS+C+FN  L K+             PT   L + +    +
Sbjct: 108 RKHLESQPLPDYSAASLGTFSDCIFNDALSKE-------------PT---LTNAKGNYLD 151

Query: 259 GGQATLFTADKFIKSPVKSLDNEERPELSXXXXXXXXXXXXXFHKEHKKHRHQKSFSQSY 318
           GG+  L +  +   S   S +       +                  K+ ++++S S ++
Sbjct: 152 GGEKCLRSRRQ--SSIYSSRNTSPYKRRTSSFGASGPLGFSQVQNSGKQLKNKRSNSNNH 209

Query: 319 GSN---DQKRLVNQFL 331
            +N   D+KRLVN+FL
Sbjct: 210 STNLASDKKRLVNEFL 225

>Scas_592.14
          Length = 549

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 113/173 (65%)

Query: 471 ANDSNMFLGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDL 530
            N +++ L  NE DYYQ+HI  RL K E+ +K +L+ +ILK E +L NN+ +FD    DL
Sbjct: 368 GNGTDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDL 427

Query: 531 QNLKSQILGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQ 590
           + LK QI+ L+  + N+YL +LK DFD NN  SFE+ L + + +NV  L+ LE +M    
Sbjct: 428 KKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSG 487

Query: 591 SQLVDQKETMRKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIG 643
            +L +QKETM++ME+L+ LENSL +S+KN     K + ++YD+  +  L+L G
Sbjct: 488 ERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSG 540

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 174 KPMIIRQVTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAFSECMFN 224
           +P ++RQ +  NL AL    N   E   L R   PDYTS NTG FS+ +FN
Sbjct: 95  QPKLVRQQSQPNLVALGAKANGHRESATL-RSGKPDYTSANTGMFSDHIFN 144

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 109/166 (65%), Gaps = 4/166 (2%)

Query: 481 NETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGL 540
           +E +YYQ HI++ L K+E++++ +L   I+K+E  ++  I  +D L+ +L  L  ++  L
Sbjct: 427 DELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLLDEMTTL 486

Query: 541 KNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETM 600
           + T+ N++L  LK+DFDE++ ++F ++L+ +VEE+V  L+ LE +M  CQ +L  QK ++
Sbjct: 487 RTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSL 546

Query: 601 RKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTL----GFLVLI 642
           R+M+SL+ L+N L  SK NT   Y YRY + DI+      GF+V +
Sbjct: 547 REMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYV 592

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 80/142 (56%)

Query: 486 YQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGLKNTIA 545
           Y +HI+  LT LE ++K+ L  VIL  E++   NI    NL+  +  L   I  +K+   
Sbjct: 249 YIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTK 308

Query: 546 NEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETMRKMES 605
           + YL  L A F+ ++ ESF S+L   ++ +V  L+ LE K  + Q++L  +K  +RK+E+
Sbjct: 309 DIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLEN 368

Query: 606 LLYLENSLMVSKKNTGLAYKYR 627
           L+ L + +   K+N  L+ K +
Sbjct: 369 LIKLNDMIGDFKRNMKLSEKLK 390

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 84/151 (55%), Gaps = 3/151 (1%)

Query: 486 YQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGLKNTIA 545
           Y+++I + + K ES IKN +  V+   E  ++++  +   L  +L+ ++++I+ L   + 
Sbjct: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354

Query: 546 NEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETMRKMES 605
             YL  L+  F+  + ESF SQL + ++E++  LE LE ++   +  L  QK  +  MES
Sbjct: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414

Query: 606 LLYLENSLMVSKKNTGLAYK---YRYMLYDI 633
           ++ L+  +  SKKN   + +   Y+ +L+D 
Sbjct: 415 IVKLKQLVADSKKNMTFSDRLKEYKGILWDF 445

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 15/17 (88%)

Query: 208 PDYTSVNTGAFSECMFN 224
           PDYTS +TG FS+C+F+
Sbjct: 73  PDYTSASTGKFSDCIFH 89

>Kwal_26.7063
          Length = 378

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 86/185 (46%), Gaps = 6/185 (3%)

Query: 461 IKNSEIINSNANDSNMFLGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNI 520
           +K+  +I  N + +    G   T   QQ+  + L+K +  I+ DL + I  DE  +    
Sbjct: 184 LKDPAVIRENCHSAQP--GNKSTVLPQQYFANELSKFDHYIR-DLMASISSDESRITKTR 240

Query: 521 TSFDNLTSDLQNLKSQILGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLE 580
           T  D+L   ++  KS I  +   I ++ + +L+  F+  +  SF S+    +    + L 
Sbjct: 241 TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKSFESEDESSFISRFSAAIATYSESLA 300

Query: 581 FLENKMSECQSQLVDQKETMRKMESLLYLENSLMVSKKNTGL---AYKYRYMLYDILTLG 637
             E ++ +C+  L  QK T+ K+E+ + L   +  S+ N        +Y+ ++YD   L 
Sbjct: 301 SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFCALI 360

Query: 638 FLVLI 642
            L+ +
Sbjct: 361 LLIAL 365

>YOL093W (TRM10) [4727] chr15 (142814..143695) Member of the protein
           of unknown function (DUF425) family, has moderate
           similarity to uncharacterized C. albicans Orf6.5919p
           [882 bp, 293 aa]
          Length = 293

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 14/71 (19%)

Query: 521 TSFDNLTSDLQNLKSQILGLKNTI---------ANEYLTVLKADFDENNPESFESQLRKT 571
            SFD L +D      +I+ L N +         AN +  +  A FD+   + FE+ L+ T
Sbjct: 101 CSFDELMND-----KEIVSLSNQVTRAYSANRRANHFAEIKVAPFDKRLKQRFETTLKNT 155

Query: 572 VEENVKHLEFL 582
             EN  H +FL
Sbjct: 156 NYENWNHFKFL 166

>YLR200W (YKE2) [3602] chr12 (549014..549358) Prefoldin subunit 6,
           component of the Gim protein complex that promotes
           formation of functional alpha- and gamma-tubulin, and
           actin [345 bp, 114 aa]
          Length = 114

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 577 KHLEFLENKMSECQSQLVDQKETMRKMES-LLYLENS 612
           K LEF+E +++ C+  + D++E + KM S L+ L N+
Sbjct: 70  KRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNT 106

>KLLA0F24684g complement(2294708..2297629) similar to sp|Q12389
           Saccharomyces cerevisiae YDL031w DBP10 putative RNA
           helicase involved in ribosome biogenesis, start by
           similarity
          Length = 973

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 13/118 (11%)

Query: 442 GLATSSFFFSNAKLTSKEKIKNS-EIINSNANDSNMFLGTN----ETDYYQ--QHINSRL 494
            L     +F      S E +K S EI+ S  ++ N++ G N    + D+    QH N++ 
Sbjct: 611 ALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKE 670

Query: 495 TKLE-SQIKNDLKSVILKDELELKNNITSFDNLTSDLQNL--KSQILGLKNTIANEYL 549
           T  E ++  +D  SV++K     +  I        + Q L  K +++GL+++I +E L
Sbjct: 671 TVFEFARNPDDEMSVLMKRR---RRQIAPIQRKAKERQELLEKERMIGLRHSIEDEIL 725

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,018,166
Number of extensions: 867867
Number of successful extensions: 3523
Number of sequences better than 10.0: 165
Number of HSP's gapped: 3649
Number of HSP's successfully gapped: 195
Length of query: 643
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 535
Effective length of database: 12,857,365
Effective search space: 6878690275
Effective search space used: 6878690275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)