Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06292g25324912181e-172
Scas_592.152542524443e-54
YAL027W2612584192e-50
ADR352C2541652562e-26
Kwal_26.70662041971948e-18
KLLA0A03960g2252221501e-11
CAGL0J11946g7673602.3
Sklu_2296.362190643.6
YDL112W (TRM3)143680626.0
CAGL0D05742g48491609.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06292g
         (249 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...   473   e-172
Scas_592.15                                                           175   3e-54
YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...   166   2e-50
ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...   103   2e-26
Kwal_26.7066                                                           79   8e-18
KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...    62   1e-11
CAGL0J11946g 1169082..1169312 no similarity, hypothetical start        28   2.3  
Sklu_2296.3 YJL085W, Contig c2296 3920-5785 reverse complement         29   3.6  
YDL112W (TRM3) [757] chr4 (258915..263225) tRNA 2'-O-ribose meth...    28   6.0  
CAGL0D05742g complement(545384..546838) similar to sp|P41543 Sac...    28   9.5  

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score =  473 bits (1218), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/249 (94%), Positives = 236/249 (94%)

Query: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSNNTIVCLKSPLTKIYLS 60
           MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSNNTIVCLKSPLTKIYLS
Sbjct: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSNNTIVCLKSPLTKIYLS 60

Query: 61  NTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFPQSIQGSLK 120
           NTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFPQSIQGSLK
Sbjct: 61  NTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFPQSIQGSLK 120

Query: 121 ESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCLQKQ 180
           ESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCLQKQ
Sbjct: 121 ESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCLQKQ 180

Query: 181 QSLLVMGQKLSESTNQDPIIXXXXXXXXXXXXXSAEDQPNNEKPEIAFTYEPQLSLIQCL 240
           QSLLVMGQKLSESTNQDPII             SAEDQPNNEKPEIAFTYEPQLSLIQCL
Sbjct: 181 QSLLVMGQKLSESTNQDPIILQEEEELNLNYEQSAEDQPNNEKPEIAFTYEPQLSLIQCL 240

Query: 241 DLYILKRPK 249
           DLYILKRPK
Sbjct: 241 DLYILKRPK 249

>Scas_592.15
          Length = 254

 Score =  175 bits (444), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 152/252 (60%), Gaps = 5/252 (1%)

Query: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKV-QAPLLSNNTIVCLKSPLTKIYL 59
           M  +IA ++++K++I+ +RV INR+++L   + E +  QAPLLSNN+I+CLKSPL +I +
Sbjct: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60

Query: 60  SNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKF--PQSIQG 117
           SN D++ L  E+ D IILI+Y+LSSP + + +  K+R+G   DF+ + L K     ++  
Sbjct: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120

Query: 118 SLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCL 177
            L    L ++ RV K KYKL ++ NW++DIFI+N+ KL  IR +L+F D +        L
Sbjct: 121 DLVNVPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAARTLEL 180

Query: 178 QKQQSLLVMGQKLSESTNQDPIIXXXXXXXXXXXXXSAEDQPNNEKPEIAFTYEPQLSLI 237
              + +L+  QK S  +   P+I             + +D   + KP+I   Y P ++L 
Sbjct: 181 PPNRRILLTEQKTSLESEGSPMI--PLEVDGDEMIETTQDAVEDVKPDIKLKYNPIINLG 238

Query: 238 QCLDLYILKRPK 249
           +CL ++IL+RP+
Sbjct: 239 ECLSIHILQRPR 250

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score =  166 bits (419), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 154/258 (59%), Gaps = 20/258 (7%)

Query: 1   MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESK------VQAPLLSNNTIVCLKSPL 54
           M  +IA +K+A+D +LP+R+ +NR+QIL T  + S        +APLLSNN+I+CLKSP 
Sbjct: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60

Query: 55  TKIYLSNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKK-FPQ 113
           T+IYLS  D KNL  E+++D++LI+YEL+SP +  ++ SKIRVG   DF  + L K F  
Sbjct: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120

Query: 114 SIQGSLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNE 173
           +   +   S++ S+ R+ K KYKL Y+  W++DIFI++I K+  +R YL+F  Q    N 
Sbjct: 121 ADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF--QTLTLNG 178

Query: 174 YPCLQKQQSLLVMGQKLSESTNQDPIIXXXXXXXXXXXXXSAEDQPNNE--KPEIAFTYE 231
           +      ++LL   +K+ E   Q P                A D P  E  KP I F Y+
Sbjct: 179 FSLNAGPKTLL--ARKI-EKQPQVP------NLLIENGDADALDTPVEEDIKPVIEFMYK 229

Query: 232 PQLSLIQCLDLYILKRPK 249
           P ++L + +D+++L RP+
Sbjct: 230 PVINLGEIIDVHVLHRPR 247

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score =  103 bits (256), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 98/165 (59%), Gaps = 12/165 (7%)

Query: 6   AYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSNNTIVCLKSPLTKIYLSNTDLK 65
           A +++    ++PVRV INRR++L+ A   S  +AP+LSN+ IV LKSP  +++LS  D +
Sbjct: 6   ALLQLQPGYVMPVRVFINRREVLNNAASCSLFEAPILSNSAIVRLKSPSVRVHLSEDDKQ 65

Query: 66  NLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFPQSIQGSLKESNLT 125
           +L+ E+ DD++ I+YEL SP  ++ +  K ++G + DF  D ++    + QG   E  + 
Sbjct: 66  SLLAELRDDLLYIIYELGSPGAEETL-RKFKIGGLADF-RDIVRA---AEQGDRPEQPIP 120

Query: 126 SL-------KRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLI 163
            L       +R+ K ++ L +  NW V+I +++I KL   R  L+
Sbjct: 121 GLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLL 165

>Kwal_26.7066
          Length = 204

 Score = 79.3 bits (194), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 25/197 (12%)

Query: 76  ILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFP---QSIQGSLKESNLTSLKRVGK 132
           +LILYEL++  + + +  KI+VG + +  +D + +FP    +        +LT+L+R GK
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEM-KDIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59

Query: 133 MKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQY------------PQWNEYPCLQKQ 180
            +YKL Y  NW++DIF+S+I KL  IR+ L+ +  +               ++   L++ 
Sbjct: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119

Query: 181 QSLLVMGQKLS-------ESTNQDPIIXXXXXXXXXXXXXSAE--DQPNNEKPEIAFTYE 231
           +  +V  Q+ S       ES  +D                  E  D  + +KP+  F+  
Sbjct: 120 REEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNV 179

Query: 232 PQLSLIQCLDLYILKRP 248
             L+L  C+D++ILKRP
Sbjct: 180 QMLNLGNCIDIHILKRP 196

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 96/222 (43%), Gaps = 38/222 (17%)

Query: 64  LKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDE--DTLKKFPQ-------- 113
           +K L+ E+ D ++ +LYEL SP +++ + +K+++    DF +  + LKK           
Sbjct: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60

Query: 114 --SIQGSLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQ- 170
              I G   + ++TS++R GK  YKL +  NW +DI I NI+KL   R  L   D     
Sbjct: 61  YNPIDGI--DVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSV 118

Query: 171 ---WNEYPCL--QKQQSLLVMGQK-LSESTN----QDPIIXXXXXXXXXXXXXSAE---- 216
                  P     K  ++LV   K L   TN    +DP I               E    
Sbjct: 119 SNTGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMV 178

Query: 217 ---------DQPNNEKPEIAFTYEPQLSLIQCLDLYILKRPK 249
                    D  +++KP   + Y+      +C+ +++L RPK
Sbjct: 179 DQDPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPK 220

>CAGL0J11946g 1169082..1169312 no similarity, hypothetical start
          Length = 76

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 15/73 (20%)

Query: 101 YDFDEDTLKKFPQSIQGSLKESNLTSLKRVGKMK------YKLTYRKNWD------VDIF 148
           YDF    LK +P SI  +L++  L+ +             YK +YR+ WD       DIF
Sbjct: 7   YDFIR-CLKDWPFSILKTLRDKALSGIYARYSCNNDYLQMYKKSYRRKWDFENVNLFDIF 65

Query: 149 ISNINKLETIRTY 161
           I  I+KL T  TY
Sbjct: 66  I--ISKLCTHLTY 76

>Sklu_2296.3 YJL085W, Contig c2296 3920-5785 reverse complement
          Length = 621

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 14  SILPVRVHINRRQILSTATEESKVQAPLLSNNT-IVCLKSPLTKIYLSNTDLKNLVTEME 72
           ++L  +++ +  +I ST  E SK+ AP++S NT +  L+  +     S + +K+L  +  
Sbjct: 22  TLLASKINNSLGRIASTTNESSKLFAPIVSTNTSLNILQRNIESSLDSISSIKDLANDAS 81

Query: 73  DDIILILYELSSPAMKQNIFSKIRVGQVYD 102
              I++  ++S   +KQ I +  +V  + D
Sbjct: 82  KHEIVLSGDISQVGLKQYIKAIHKVDDILD 111

>YDL112W (TRM3) [757] chr4 (258915..263225) tRNA 2'-O-ribose
            methyltransferase, required for the formation of Gm18
            modification [4311 bp, 1436 aa]
          Length = 1436

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 12/80 (15%)

Query: 42   LSNNTIVCLKSPLTKIYLSNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVY 101
             SN+ I+ L  P  K YLS+  L+N++             L S A K  IF + R G   
Sbjct: 1135 FSNSLIISL-WPTFKAYLSDHTLRNIIE-----------NLYSNAKKTQIFGQYRAGDAN 1182

Query: 102  DFDEDTLKKFPQSIQGSLKE 121
             +D    +K      G LK+
Sbjct: 1183 IWDLKGDRKLTNMFGGVLKK 1202

>CAGL0D05742g complement(545384..546838) similar to sp|P41543
           Saccharomyces cerevisiae YJL002c OST1, hypothetical
           start
          Length = 484

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 21/91 (23%)

Query: 30  TATEESKVQAPLLSNNTIVCLKSPL------TKIYLSNTDLKN-----------LVTEME 72
           TA +E +    L    T++  KSPL      T    S  DLKN           LV+E+ 
Sbjct: 379 TAYDEVEYSVYLPEGATVIDTKSPLPVVQTTTSFESSYFDLKNGHTKVTLKFRNLVSELA 438

Query: 73  DDIILILYELSSPAMKQNIFSKIRVGQVYDF 103
           D  ILI Y+L++     N + K     +Y F
Sbjct: 439 DGKILITYKLTN----ANFYGKFLNISLYGF 465

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,820,362
Number of extensions: 326277
Number of successful extensions: 1020
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1012
Number of HSP's successfully gapped: 32
Length of query: 249
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 150
Effective length of database: 13,168,927
Effective search space: 1975339050
Effective search space used: 1975339050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)