Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06270g1328130869860.0
YAL026C (DRS2)1355131854290.0
Kwal_26.70701315126549280.0
KLLA0A04015g1343131948620.0
ADR350W1311131046060.0
Scas_505.4102546021650.0
CAGL0G08085g1578105317940.0
AGR120C1547103317440.0
KLLA0C17644g1576103917350.0
CAGL0L11814g1576104217220.0
YER166W (DNF1)1571103917140.0
Scas_636.161554105516930.0
YDR093W (DNF2)1612106016880.0
Scas_576.81591104716710.0
YIL048W (NEO1)1151117911271e-133
Scas_704.381161106511131e-131
Sklu_2193.11143108710961e-129
Kwal_23.57891133106310941e-129
ADL079C1166107110961e-129
CAGL0L00715g1144107310881e-128
KLLA0C08393g1148103410831e-127
KLLA0E01650g15505218793e-97
CAGL0H04477g16265328724e-96
Kwal_23.355615975238643e-95
YMR162C (DNF3)16565408494e-93
Scas_669.316385948077e-88
AFL191W15755168013e-87
Scas_89.12712694013e-43
Scas_665.3014393832102e-16
AFL011W12427412084e-16
KLLA0B08217g14397691951e-14
CAGL0M11308g14523281923e-14
Scas_583.14*8752891814e-13
AFR567W14497731815e-13
Kwal_26.920714694891806e-13
KLLA0E22352g12067111743e-12
YOR291W14723051718e-12
Kwal_47.1754712403171682e-11
CAGL0L01419g12146871654e-11
KLLA0A08910g12803081646e-11
CAGL0K12034g10874511621e-10
YEL031W (SPF1)12152791592e-10
AFR354C12103181564e-10
KLLA0F20658g10823011512e-09
CAGL0A00517g11223091483e-09
CAGL0J01870g9464591474e-09
YGL006W (PMC1)11732421451e-08
AEL301W9575531441e-08
YGL167C (PMR1)9507151441e-08
CAGL0I04312g9514651441e-08
YDR040C (ENA1)10913181342e-07
YDR039C (ENA2)10913181332e-07
YDR038C (ENA5)10913181332e-07
Scas_707.48*7417031305e-07
KLLA0E14630g10823051271e-06
Kwal_14.14989393101252e-06
Kwal_23.316011003121243e-06
AGL097C10963001224e-06
Kwal_56.234672801571178e-06
KLLA0A03157g9383051191e-05
Kwal_47.17522899317840.14
KLLA0F07447g975223830.18
AGL085C909296820.23
KLLA0A09031g899297800.36
YPL036W (PMA2)947297790.56
Scas_297.180059780.58
YGL008C (PMA1)918297770.82
Kwal_26.833342285760.91
Scas_569.0d46860760.94
Scas_710.41904304751.4
CAGL0I07909g303666751.5
YDR270W (CCC2)1004141741.7
Scas_615.994245722.9
Scas_688.191329722.9
KLLA0D04092g1152119722.9
Scas_630.1470159722.9
CAGL0A00495g90229723.1
CAGL0M08602g1012278705.7
Scas_634.242499688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06270g
         (1308 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...  2695   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...  2095   0.0  
Kwal_26.7070                                                         1902   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...  1877   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...  1778   0.0  
Scas_505.4                                                            838   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   695   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   676   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   672   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   667   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   664   0.0  
Scas_636.16                                                           656   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   654   0.0  
Scas_576.8                                                            648   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   438   e-133
Scas_704.38                                                           433   e-131
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         426   e-129
Kwal_23.5789                                                          426   e-129
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   426   e-129
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   423   e-128
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   421   e-127
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   343   3e-97
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   340   4e-96
Kwal_23.3556                                                          337   3e-95
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   331   4e-93
Scas_669.3                                                            315   7e-88
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   313   3e-87
Scas_89.1                                                             159   3e-43
Scas_665.30                                                            86   2e-16
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    85   4e-16
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    80   1e-14
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    79   3e-14
Scas_583.14*                                                           74   4e-13
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    74   5e-13
Kwal_26.9207                                                           74   6e-13
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    72   3e-12
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    70   8e-12
Kwal_47.17547                                                          69   2e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    68   4e-11
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    68   6e-11
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    67   1e-10
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    66   2e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    65   4e-10
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    63   2e-09
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    62   3e-09
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    61   4e-09
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    60   1e-08
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    60   1e-08
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    60   1e-08
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    60   1e-08
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    56   2e-07
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    56   2e-07
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    56   2e-07
Scas_707.48*                                                           55   5e-07
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    54   1e-06
Kwal_14.1498                                                           53   2e-06
Kwal_23.3160                                                           52   3e-06
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    52   4e-06
Kwal_56.23467                                                          50   8e-06
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    50   1e-05
Kwal_47.17522                                                          37   0.14 
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    37   0.18 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    36   0.23 
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    35   0.36 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    35   0.56 
Scas_297.1                                                             35   0.58 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    34   0.82 
Kwal_26.8333                                                           34   0.91 
Scas_569.0d                                                            34   0.94 
Scas_710.41                                                            33   1.4  
CAGL0I07909g 763900..773010 similar to sp|P19158 Saccharomyces c...    33   1.5  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    33   1.7  
Scas_615.9                                                             32   2.9  
Scas_688.1                                                             32   2.9  
KLLA0D04092g complement(344666..348124) some similarities with s...    32   2.9  
Scas_630.14                                                            32   2.9  
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    32   3.1  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    32   5.7  
Scas_634.2                                                             31   8.9  

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 2695 bits (6986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1296/1308 (99%), Positives = 1296/1308 (99%)

Query: 1    MSSRMGKGTRVPTGDTLFDIDFNDGNKIRASENERTTSHGFPEEIIDLDNDSIENDLHDN 60
            MSSRMGKGTRVPTGDTLFDIDFNDGNKIRASENERTTSHGFPEEIIDLDNDSIENDLHDN
Sbjct: 1    MSSRMGKGTRVPTGDTLFDIDFNDGNKIRASENERTTSHGFPEEIIDLDNDSIENDLHDN 60

Query: 61   PFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQSNSEPQSFEMS 120
            PFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQSNSEPQSFEMS
Sbjct: 61   PFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQSNSEPQSFEMS 120

Query: 121  NYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRFG 180
            NYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRFG
Sbjct: 121  NYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRFG 180

Query: 181  YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
            YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV
Sbjct: 181  YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240

Query: 241  LIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIP 300
            LIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIP
Sbjct: 241  LIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIP 300

Query: 301  ADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPNS 360
            ADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPNS
Sbjct: 301  ADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPNS 360

Query: 361  SLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATPIKR 420
            SLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATPIKR
Sbjct: 361  SLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATPIKR 420

Query: 421  TAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLT 480
            TAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLT
Sbjct: 421  TAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLT 480

Query: 481  FWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYI 540
            FWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYI
Sbjct: 481  FWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYI 540

Query: 541  FSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSD 600
            FSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSD
Sbjct: 541  FSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSD 600

Query: 601  DCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVT 660
            DCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPD            YKFLIRKPNSVT
Sbjct: 601  DCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVEGGALLGYKFLIRKPNSVT 660

Query: 661  ILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYV 720
            ILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYV
Sbjct: 661  ILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYV 720

Query: 721  DATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIES 780
            DATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIES
Sbjct: 721  DATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIES 780

Query: 781  GLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLL 840
            GLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLL
Sbjct: 781  GLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLL 840

Query: 841  IISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGK 900
            IISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGK
Sbjct: 841  IISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGK 900

Query: 901  MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 960
            MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA
Sbjct: 901  MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 960

Query: 961  ARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQS 1020
            ARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQS
Sbjct: 961  ARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQS 1020

Query: 1021 IMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIV 1080
            IMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIV
Sbjct: 1021 IMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIV 1080

Query: 1081 NGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTK 1140
            NGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTK
Sbjct: 1081 NGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTK 1140

Query: 1141 FTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTR 1200
            FTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTR
Sbjct: 1141 FTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTR 1200

Query: 1201 DFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQ 1260
            DFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQ
Sbjct: 1201 DFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQ 1260

Query: 1261 AEEGQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPF 1308
            AEEGQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPF
Sbjct: 1261 AEEGQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPF 1308

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 2095 bits (5429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1015/1318 (77%), Positives = 1124/1318 (85%), Gaps = 24/1318 (1%)

Query: 15   DTLFDIDFNDGNKIRASENERTT-----------SHGFPEEIIDLD--NDSIENDLHDNP 61
            DTLFDIDF D     +    + T           SH  PEE IDLD  +D+IEND+H+N 
Sbjct: 17   DTLFDIDFLDDTTSHSGSRSKVTNSHANGYYIPPSHVLPEETIDLDADDDNIENDVHENL 76

Query: 62   F--SEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQSNSEPQSFEM 119
            F  + +  +  WN NRFD    QP   +      +F R G  +K  FTF+    P+SFEM
Sbjct: 77   FMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPESFEM 136

Query: 120  SNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRF 179
            ++YN V+  E+DDN+  SRNKF+IKILFN+Y+LRKN  D + +GEPR IHI+D  +N+ F
Sbjct: 137  NHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSF 196

Query: 180  GYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMV 239
            GY DNHISTTKYN ATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTL+V
Sbjct: 197  GYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLV 256

Query: 240  VLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPI 299
            VLIVSA+KE +ED+KRA+SD ELNNS AEI+ EA  DF++KRWIDI+VGDIIRV SEEPI
Sbjct: 257  VLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPI 316

Query: 300  PADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPN 359
            PAD IILSSSEPEGLCYIETANLDGETNLKIKQ+R ETAK +D + L+N+ G + SEQPN
Sbjct: 317  PADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPN 376

Query: 360  SSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATPIK 419
            SSLYTYEGT+ +N  +IPLSP+QMILRGATLRNT WIFG+VIFTGHETKL+RNATATPIK
Sbjct: 377  SSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIK 436

Query: 420  RTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFL 479
            RTAVEK+IN QII LFTVL+VLILISSIGNVIMSTADAKHLSYLYL+GTNKAGLFFKDFL
Sbjct: 437  RTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFL 496

Query: 480  TFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEY 539
            TFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYE+TDTPTVV+TSSLVEELGQIEY
Sbjct: 497  TFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEY 556

Query: 540  IFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNS 599
            IFSDKTGTLTRNIMEFKSCSIAG CY + IPEDK AT EDGIEVGYR FDDLKK+L   S
Sbjct: 557  IFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKLNDPS 616

Query: 600  D-DCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNS 658
            D D  II++FLTLLATCHTVIPEFQ+DGSIKYQAASPD            YKF+IRK NS
Sbjct: 617  DEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNS 676

Query: 659  VTILINEE-EEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGN 717
            VT+L+ E  EE+EYQLLNICEFNSTRKRMSAIFRFPD SIKL CKGAD+VILERL +  N
Sbjct: 677  VTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEAN 736

Query: 718  FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE 777
             YV+AT RHLEDYA+EGLRTLCLA +DI E EY  WN  Y +AATTLD+RAEKLD  A  
Sbjct: 737  QYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANL 796

Query: 778  IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDM 837
            IE  L LIGATAIEDKLQ+GVP+TI TLQEAGIKIWVLTGD+QETAINIGMSCRLLSEDM
Sbjct: 797  IEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDM 856

Query: 838  NLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLA 897
            NLLII+EET++ T RN+ EK+ AL+EH LS HDM +LALVIDG SL FALE +LEDY L 
Sbjct: 857  NLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLT 916

Query: 898  IGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEG 957
            + K+CKAVICCRVSPLQKALVVKMVKRK++SLLLAI  GANDVSMIQAAHVGVGISGMEG
Sbjct: 917  VAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEG 976

Query: 958  MQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1017
            MQAARSADI++GQF+FLKKLLLVHG+WSYQRISVAILYSFYKNTALYMTQFWYVFANAFS
Sbjct: 977  MQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFS 1036

Query: 1018 GQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWG 1077
            GQSIMESWTMS YN+FFTV PPFVIGVFDQFV+SRLLERYPQLYKLGQKGQFFSV IFWG
Sbjct: 1037 GQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWG 1096

Query: 1078 WIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ 1137
            WI+NGF+HSA+VF+GTIL YRYGFAL  HGE ADHWSWG+ +YT+SVIIVLGKAALVTNQ
Sbjct: 1097 WIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQ 1156

Query: 1138 WTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFA 1197
            WTKFTL AIPGSL FWLIFFPIY SIFP+A ISREY+GVV+HTYGS  FWLTLIVLP FA
Sbjct: 1157 WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFA 1216

Query: 1198 LTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFA 1257
            L RDF+WKYYKRMY PE+YH+IQEMQKYN+SD RPHVQ FQNAIRKVRQVQRMKKQRGFA
Sbjct: 1217 LVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKKQRGFA 1276

Query: 1258 FSQAEE-GQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNE------ENPF 1308
            FSQAEE GQEKI+RMYDTTQKRGKYGEL DASA+PF+D + L   + E      ENPF
Sbjct: 1277 FSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGSNDFESAEPFIENPF 1334

>Kwal_26.7070
          Length = 1315

 Score = 1902 bits (4928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 910/1265 (71%), Positives = 1055/1265 (83%), Gaps = 22/1265 (1%)

Query: 42   PEEIIDLD--------NDSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGN 93
            P+E ++LD         D+IEND+  NPFS+       + N+        HLT     G+
Sbjct: 59   PQETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQ-----GVVHLTP--QNGS 111

Query: 94   VFTRMGRSIK-GIFTFQSNSEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLL 152
             F R    IK G+    S +  Q FEM NY+ +     DD + KSRNKFDIKI+F +Y+L
Sbjct: 112  AFQRAINKIKKGLGRSGSGNSYQGFEMHNYDDLGN---DDRYAKSRNKFDIKIIFKRYIL 168

Query: 153  RKNTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLF 212
            R+N     D   PR+I+I+D+E+N   G+  NHISTTKYN ATF+PKFLFQEFSKYANLF
Sbjct: 169  RRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLF 228

Query: 213  FLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFE 272
            FL TSAIQQVP+V+PTNRYTTIGTL++VLIVSAIKE VEDLKRA SD+ELN+S+A+++ E
Sbjct: 229  FLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSE 288

Query: 273  AEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332
               DF   +W++I VGDII+VNSEE IPAD+I+++SSEPEGLCYIETANLDGETNLKIKQ
Sbjct: 289  QLQDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQ 348

Query: 333  ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRN 392
            AR ET+K +D  +L  ++G + SE PNSSLYTYEGT+ +NG  I LSPEQM+LRGATLRN
Sbjct: 349  ARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRN 408

Query: 393  TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452
            T WI+G+V+FTGHETKLMRNATATPIKRTAVE+VINMQI+ALF VL+VL LISSIGNVI 
Sbjct: 409  TAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIK 468

Query: 453  STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDL 512
             T+DA+HL+YLYLQGTNK GLFFKD LT+WILFSNLVPISLFVTVE+IKYYQA+MI SDL
Sbjct: 469  VTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDL 528

Query: 513  DLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPED 572
            DLY E +D+PTVV+TSSLVEELGQIEYIFSDKTGTLTRN+MEFKSCSIAG+CY E IPED
Sbjct: 529  DLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPED 588

Query: 573  KAATFEDGIEVGYRSFDDLKKQLTTNSD-DCKIIDEFLTLLATCHTVIPEFQADGSIKYQ 631
            KAAT EDGIE+G+R FD +K+ L    D D  II++FLTLLATCHTVIPEFQ DGSIKYQ
Sbjct: 589  KAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQ 648

Query: 632  AASPDXXXXXXXXXXXXYKFLIRKPNSVTILINE-EEEREYQLLNICEFNSTRKRMSAIF 690
            AASPD            YKF+IRKPNSV++LI +  +E+EYQLLNICEFNSTRKRMSAIF
Sbjct: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIF 708

Query: 691  RFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEY 750
            R P+  IKL CKGAD+VILERL    N Y++AT RHLEDYA EGLRTLCLA++ + E EY
Sbjct: 709  RLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEY 768

Query: 751  NAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGI 810
              W   Y  A+TTLD RA+KLD  AE IE  L L+GATAIEDKLQ+GVP+TI TLQ+AGI
Sbjct: 769  AEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGI 828

Query: 811  KIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHD 870
            K+WVLTGD+QETA+NIGMSCRLLSEDMNLLII+EE KEATR+N+ EKL A+ +H +S+ D
Sbjct: 829  KVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQD 888

Query: 871  MNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL 930
            MN+LALVIDG SL FALEADLEDY LAIGK+CKAVICCRVSPLQKALVVKMVKRKT+SLL
Sbjct: 889  MNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL 948

Query: 931  LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRIS 990
            LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD ++ QF++LKKLLLVHG+WSYQRIS
Sbjct: 949  LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRIS 1008

Query: 991  VAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVN 1050
             AILYSFYKN ALYMTQFWYVFANA+SGQSIMESWTM+ YNVFFTVLPPFV+GVFDQFV+
Sbjct: 1009 QAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVS 1068

Query: 1051 SRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETA 1110
            SRLL+RYPQLYKLGQ+GQFFSV IFWGW++NGFYHSAV F+G+ LFYR G  L  HGETA
Sbjct: 1069 SRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETA 1128

Query: 1111 DHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKIS 1170
            DHW+WG++IYT SVIIV+GKAALVTNQWTKFT FAIPGSL FWL+FFPIY SI P+A +S
Sbjct: 1129 DHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVS 1188

Query: 1171 REYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDY 1230
            +EY+GVV H YGSATFWL  IVLPTFAL RD +WKYYKR Y PESYH++QEMQKYN+ DY
Sbjct: 1189 KEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDY 1248

Query: 1231 RPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAEE-GQEKIIRMYDTTQKRGKYGELHDASA 1289
            RP ++ FQ AIR+VRQVQRMKKQRGFAFSQ+E  GQ+K++RMYDTT KRG++GEL DASA
Sbjct: 1249 RPRIEQFQKAIRRVRQVQRMKKQRGFAFSQSETGGQDKVMRMYDTTLKRGEHGELQDASA 1308

Query: 1290 DPFSD 1294
            +PF D
Sbjct: 1309 NPFRD 1313

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 1877 bits (4862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 913/1319 (69%), Positives = 1071/1319 (81%), Gaps = 36/1319 (2%)

Query: 5    MGKGTRVPTGDTLFDIDFNDGN---KIRASENER-----------TTSHGF-PEEIIDLD 49
            M   T+    D LFD+DF D +    +R S               T+  G  P+E IDL 
Sbjct: 25   MSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQETIDL- 83

Query: 50   NDSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQ 109
            +D+IEND+ +NPF++       +TN  + +  QP         + F R   ++K      
Sbjct: 84   SDNIENDI-ENPFNDRYSASFADTNPRNSVLPQP---------SGFNRFMSNVKSAVGMN 133

Query: 110  SNSEPQ--SFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPRE 167
               + Q  SFEM++Y+  +T    + ++ S  KFDIK+LFN+Y+LRK  +  + S EPR 
Sbjct: 134  GGHKGQFQSFEMNDYDQSNT----NRYESSTRKFDIKVLFNRYILRKGKTSCK-SDEPRT 188

Query: 168  IHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSP 227
            I ++D  +N+RFGY DNHISTTKYNAATFLPKFLFQEFSKYANLFFL TS IQQVP+V+P
Sbjct: 189  ILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 248

Query: 228  TNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKV 287
            TNRYTTIGTL+VVLIVSA+KESVEDLKR+++D ELN+S  ++  E  G+F++K+WIDI V
Sbjct: 249  TNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAV 308

Query: 288  GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
            GDIIRV SEE IPAD+IILSSSEPEGLCYIETANLDGETNLKIKQAR ETA  +D + L 
Sbjct: 309  GDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALC 368

Query: 348  NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
             + G + SE PNSSLYTYEGT+ +NG+  PLSP+QM+LRGATLRNT WIFG+++FTGHET
Sbjct: 369  KLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET 428

Query: 408  KLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQG 467
            KLMRNATATPIKRTAVE+VINMQI+ALF VL+VL LISS GNVIM+  D+ HL YLY++G
Sbjct: 429  KLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEG 488

Query: 468  TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKT 527
            TNKAGLFFKD LTFWILFSNLVPISLFVTVE+IKYYQA+MIGSDLDLY+EE+DTPTVV+T
Sbjct: 489  TNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRT 548

Query: 528  SSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRS 587
            SSLVEELGQIEYIFSDKTGTLTRN+MEFKS SIAGRCY E IPED+ AT EDGIE+G+ S
Sbjct: 549  SSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHS 608

Query: 588  FDDLKKQLTTNSDD-CKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXX 646
            F+ LK ++T   DD   I+ EFLTLLATCHTVIPE Q+DG+IKYQAASPD          
Sbjct: 609  FESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAAD 668

Query: 647  XXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADS 706
              ++F IR+PNSV+I     E+ EYQLLNICEFNSTRKRMSAIFR PD SIKL CKGAD+
Sbjct: 669  LGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADT 728

Query: 707  VILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766
            VILERL    N YV +T RHLEDYA EGLRTLC+A++ IPE EY  W+K Y  A+TT+  
Sbjct: 729  VILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKD 788

Query: 767  RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
            R E+LD  AE IE  L  +GATAIEDKLQEGVP+TI  LQEAG+K+WVLTGD+QETAINI
Sbjct: 789  RTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINI 848

Query: 827  GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886
            GMSCRLLSEDMNLLI++EETKE TR N++ KL A+  H +S+ DMN+LALVIDG SL +A
Sbjct: 849  GMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYA 908

Query: 887  LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946
            LE DLED FL IGK+CKAVICCRVSPLQKALVVKMVKRKT+SLLLAIGDGANDVSMIQAA
Sbjct: 909  LEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAA 968

Query: 947  HVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMT 1006
            HVGVGISGMEGMQAARSAD ++GQFRFL+KLL+VHG+WSYQRIS+AILYSFYKN ALYMT
Sbjct: 969  HVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMT 1028

Query: 1007 QFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQK 1066
            QFWYVFANAFSGQSIMESWT++ YNVFFTV+PPFVIG+FDQFV SRLL+RYPQLYKLGQK
Sbjct: 1029 QFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK 1088

Query: 1067 GQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVII 1126
            GQFFSV+IFWGW++NGFYHSAVVF+G++LFYRYG  L   GETADHW WG+ IYT+S+II
Sbjct: 1089 GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII 1148

Query: 1127 VLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATF 1186
            VLGKAAL+T+QWTKFTL AIPGSL  WL+FFP Y ++FP   +S+EY+G++ H YGSATF
Sbjct: 1149 VLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208

Query: 1187 WLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQ 1246
            WL  IVLP FAL RDF+WKYYKR Y+PESYH++QEMQKYN+SDYRP ++ FQ AIRKVRQ
Sbjct: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQ 1268

Query: 1247 VQRMKKQRGFAFSQAEE-GQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLV-PENN 1303
            VQRMKKQRGFAFSQ+EE GQ++IIRMYDTT KRG +GEL DAS +PF+DT   V P +N
Sbjct: 1269 VQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPAQVEPSSN 1327

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 1778 bits (4606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/1310 (67%), Positives = 1040/1310 (79%), Gaps = 40/1310 (3%)

Query: 15   DTLFDIDFND------------------GNKIRASENE--RTTSHGFPEEIIDLDN---- 50
            +TLFDIDF D                  G  I +  ++  +    GFP+E+IDLD+    
Sbjct: 11   ETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQEVIDLDDEPPF 70

Query: 51   ---DSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFT 107
               DSIENDL +NPF +  G+      R+    N+  + Q      +   +  S+ G  T
Sbjct: 71   RHDDSIENDLIENPFDDERGQ-----QRYLASANRLSVPQPSGWQRLVGGLRDSVGGRGT 125

Query: 108  FQSNSEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPRE 167
               NS+ QSFEM +Y    +G   D +Q+SRNKF++K LF+ Y+LRK  +    +GEPR 
Sbjct: 126  --ENSQYQSFEMQDYRDTHSG---DRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV 180

Query: 168  IHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSP 227
            I+I++R +N   GY DNHISTTKYNAATFLPKFLFQEFSKYANLFFL TS IQQVP+V+P
Sbjct: 181  IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 240

Query: 228  TNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKV 287
            TNR+TTIGTL+VVL+VSAIKESVEDLKR++SD ELN+S+A++Y +  G FI K+WIDI V
Sbjct: 241  TNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV 300

Query: 288  GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
            GDIIRV SEE IPAD+I+LSSSEPEGLCYIETANLDGETNLKIKQAR ET+KI+D REL 
Sbjct: 301  GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS 360

Query: 348  NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
             ++G I SEQPN+SLYTYEGT+ ++  +IPLSP+Q++LRGATLRNT WIFGIVIFTGHET
Sbjct: 361  AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET 420

Query: 408  KLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQG 467
            KL RNATATPIKRTAVE+VIN+QI+ALF VL+ L LISS GN+I+     ++LSYLYLQG
Sbjct: 421  KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQG 480

Query: 468  TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKT 527
            TN   LFFK+ LTFWILFSNLVPISLFVTVE+IKYYQA+MI SDLDL++EE++ PTVV+T
Sbjct: 481  TNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRT 540

Query: 528  SSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRS 587
            SSLVEELGQIEYIFSDKTGTLT+N+MEFKSCSIAGRCY + IPEDK A F++GIEVGYR+
Sbjct: 541  SSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRT 600

Query: 588  FDDLKKQL-TTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXX 646
            +DD+ + L T  S D  IIDEFLTLL+ CHTVIPEFQ +GSIKYQAASPD          
Sbjct: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAAD 660

Query: 647  XXYKFLIRKPNSVTILINE-EEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGAD 705
              YKF+IRKPNSVTIL  +  EE  Y+LLNICEFNSTRKRMSAIFRFPD+SI+LLCKGAD
Sbjct: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGAD 720

Query: 706  SVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLD 765
            +VILERL+ T N YV AT RHLEDYA EGLRTLC+A++ IPE EY  W+K Y  AATT+ 
Sbjct: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780

Query: 766  HRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAIN 825
            +R+E+LD VAE IE GL L+GATAIEDKLQ+GVP+TI TLQ+AGIK+WVLTGD+QETAIN
Sbjct: 781  NRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAIN 840

Query: 826  IGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSF 885
            IGMSC+LLSEDMNLLI++E+TKE+TR N+ +KL A+++H +S+ DMNTLALVIDG SL F
Sbjct: 841  IGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGF 900

Query: 886  ALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQA 945
            ALE DLE++ LAIGKMC+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGANDVSMIQA
Sbjct: 901  ALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQA 960

Query: 946  AHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYM 1005
            AHVGVGISGMEGMQAARSAD ++GQF++LKKLLLVHG+WSYQRIS AILYSFYKN ALYM
Sbjct: 961  AHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYM 1020

Query: 1006 TQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQ 1065
            TQFWYV  NAFSGQSIMESWT++ YN   T  PP      DQF  S LL R  Q   +GQ
Sbjct: 1021 TQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQ 1080

Query: 1066 KGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVI 1125
            KGQF+  +IF G  +NG YH+ +   G I+ YRYG A   HGETADHW WG+AI  +S+I
Sbjct: 1081 KGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSII 1140

Query: 1126 IVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSAT 1185
             VLGKAAL+TNQWTKFT+ AIPGSL FWL+FFPIY  + P   +S+EY+G+V H YGS T
Sbjct: 1141 FVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFT 1200

Query: 1186 FWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVR 1245
            FW    VLP  AL RD +WKYYKR Y PESYH++QEMQKY++SD RP ++ FQ AIRKVR
Sbjct: 1201 FWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVR 1260

Query: 1246 QVQRMKKQRGFAFSQAEE-GQEKIIRMYDTTQKRGKYGELHDASADPFSD 1294
            QVQRMKKQRGFAFSQ+EE GQ++I+RMYDTTQKRG +GEL D S +PF D
Sbjct: 1261 QVQRMKKQRGFAFSQSEEAGQDRIVRMYDTTQKRGTHGELQDPSMNPFKD 1310

>Scas_505.4
          Length = 1025

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/460 (84%), Positives = 424/460 (92%), Gaps = 10/460 (2%)

Query: 850  TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCR 909
            TR+NM +K+ AL EH LS+H+MNTLALVIDG SLS+ALE+DLEDY LA+GK+CKAV+CCR
Sbjct: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593

Query: 910  VSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVG 969
            VSPLQKALVVKMVKRKT+SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADI+VG
Sbjct: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653

Query: 970  QFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSL 1029
            QFRFLKKLLLVHG+WSYQRISVAILYSFYKNTALYMTQFW+VFANAFSGQSIMESWTMS 
Sbjct: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713

Query: 1030 YNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVV 1089
            YNVFFTV PPFVIGVFDQFV+SRLLERYPQLYKLGQ+G+FFSV IFWGWIVNGFYHSAVV
Sbjct: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

Query: 1090 FVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGS 1149
            ++GT+LFYRYG AL  HGE ADHWSWGIA+YTSS++IVLGKAALVTNQWTKFTLFAIPGS
Sbjct: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833

Query: 1150 LFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKR 1209
              FW+IFFPIY S+FPYA ISREYFGVV+HTYGS TFWLTLIVLP FAL RDF+WKYY+R
Sbjct: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893

Query: 1210 MYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAEE-GQEKI 1268
            MY PESYHL+QEMQK+N+SD RPHVQHFQN IRKVRQVQRMKKQRGFAFSQ+EE GQ+KI
Sbjct: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953

Query: 1269 IRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPF 1308
            IRMYDTTQKRG YGELHD  A+PFS+       NN EN F
Sbjct: 954  IRMYDTTQKRGVYGELHD--ANPFSN-------NNAENIF 984

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 368/475 (77%), Gaps = 18/475 (3%)

Query: 5   MGKGTRVPTGDTLFDID-FNDGNKI------------RASENERTTSHGFPEEIIDLDND 51
           M K  +V   DTLFDID  ND  +             R +E      H FPEE IDLDND
Sbjct: 49  MSKDAKV-ADDTLFDIDILNDSAEPSNSTQPHIIANNRDAEARVIPPHTFPEETIDLDND 107

Query: 52  -SIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQS 110
            +IEND++DNPF +      W+TNRF+  N QP L   G +   F      +K IF F +
Sbjct: 108 DNIENDIYDNPFQD-EESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNT 166

Query: 111 N-SEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIH 169
             S+  S+EM+ YN V+  E+D  +  SRN+F+IKILFN+Y+LRKN     D G PREI+
Sbjct: 167 KPSDSGSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVG-ASDDGTPREIY 225

Query: 170 ISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTN 229
           ++DR +N+ F Y DNHISTTKYN ATFLPKFLFQEFSKYANLFFLCT+AIQQVPHVSPTN
Sbjct: 226 LNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTN 285

Query: 230 RYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGD 289
           RYTT+GTLMVVLIVSA KES+ED+KRA+SD ELNNSK EIY E  GDFI++RWIDI+ GD
Sbjct: 286 RYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGD 345

Query: 290 IIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNI 349
           +IRV SEE IPAD+I++SSSEPEGLCYIETANLDGETNLKIKQAR ETA++MDSR+L N 
Sbjct: 346 VIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNF 405

Query: 350 KGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKL 409
           KG + SEQPNSSLYTYEGTLE N  KIPLSPEQMILRGATLRNT W+FG+VIFTGHETKL
Sbjct: 406 KGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKL 465

Query: 410 MRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464
           MRNATATPIKRTAVE+VIN+QI+ALF VL+VL+LISS+GN I+S+   KHLSYLY
Sbjct: 466 MRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNAIISSTQEKHLSYLY 520

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1053 (39%), Positives = 600/1053 (56%), Gaps = 97/1053 (9%)

Query: 272  EAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIK 331
            + E  F +  W ++KVGDI+R+++ E IPADII+LS+S+ +G CY+ET NLDGETNLK++
Sbjct: 395  DMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVR 454

Query: 332  QARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEG-----TLEMNGTKI-PLSPEQMIL 385
            Q+   T+ I  S ++   +  I SE P+++LY+Y+G     +LE N  K  P++   ++L
Sbjct: 455  QSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLL 514

Query: 386  RGATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILIS 445
            RG TLRNT W  G+V FTG +TK+M NA  TP K++ + K +N+ ++  F +L VL  I+
Sbjct: 515  RGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIA 574

Query: 446  SIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKY 502
             + N I      +   +    GT   G     F++FW   IL+ +LVPISL+++VE+IK 
Sbjct: 575  GLYNGIYHNKHPRSRDFFDF-GTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKT 633

Query: 503  YQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG 562
             QA  I  D+ +Y E+ D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G
Sbjct: 634  AQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 693

Query: 563  RCYAEHIPEDKAATFE-DGIEVGYRSF---DDLKK----------QLTTNS--------- 599
              Y     E  A   +  G++V + S    + +K+           L  NS         
Sbjct: 694  VSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTF 753

Query: 600  ------DDC---------KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDXXXXXX 642
                  DD          K    F+  LA CH+V+  P  +    ++ +A SPD      
Sbjct: 754  VSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVT 813

Query: 643  XXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK---- 698
                  + FL +K     +L  +  E+E+Q+LNI EFNS+RKRMS I + P D       
Sbjct: 814  TARDMGFSFL-KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPK 872

Query: 699  --LLCKGADSVILERLSETG---NFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753
              L+CKGADSVI  RL +TG      ++ T  HLE YATEGLRTLCLA +++  +EY  W
Sbjct: 873  ALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERW 932

Query: 754  NKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIW 813
            NKKY  AA  +  R E+L+ V++EIE  L L+G TAIED+LQ+GVPD+I  L EAGIK+W
Sbjct: 933  NKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLW 992

Query: 814  VLTGDKQETAINIGMSCRLLSEDMNLLIISE-----ETKEATRRNMEEKLAALHEH---- 864
            VLTGDK ETAINIG SC LL+ DM LL+I       E   AT +++ + L + + H    
Sbjct: 993  VLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFG 1052

Query: 865  ----------SLSEHDM--NTLALVIDGHSLSFALEA-DLEDYFLAIGKMCKAVICCRVS 911
                      + +EHD+     A++IDG +L +AL   D++  FL + K CK+V+CCRVS
Sbjct: 1053 MAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVS 1112

Query: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971
            P QKA VVK+VK   + + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D ++GQF
Sbjct: 1113 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQF 1172

Query: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031
            R+L +LLLVHG W Y+R++  I   FYKN    +  FW+   N + G  + E   ++ YN
Sbjct: 1173 RYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYN 1232

Query: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091
            + FT +P  ++G+FDQ V+  +   +PQLY++G   + +S + F  ++++G Y S + F 
Sbjct: 1233 LAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFF 1292

Query: 1092 GTILFYRYGFALRKHGETADHWSW-GIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSL 1150
               L YR    +  +G   DH  + G+ +   + I       +    W  F  F +  S+
Sbjct: 1293 FPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI 1352

Query: 1151 FFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRM 1210
               +IFF   G I+  A  S E++      +G+ TFW  L V   F L   F    +KR 
Sbjct: 1353 ---MIFFTWTG-IWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRY 1408

Query: 1211 YAPESYHLIQEM----------QKYNVSDYRPH 1233
            + P+   +I+EM          +KY+ +D   H
Sbjct: 1409 FYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVH 1441

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%)

Query: 164 EPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVP 223
           +P    + D ++     Y  N I TTKY   TFLPK +  +F  +AN++FL    +    
Sbjct: 179 QPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQ 238

Query: 224 HVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269
               TN   +   L+V++I++AIK+ +ED +R   D E+NN+K  +
Sbjct: 239 IFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHV 284

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/1033 (39%), Positives = 583/1033 (56%), Gaps = 102/1033 (9%)

Query: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336
            F +  W DI+VGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 400  FGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKC 459

Query: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILRGATL 390
            + +I +S+++   K  + SE P+++LY+Y+G  +   ++       P++   M+LRG +L
Sbjct: 460  SHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSL 519

Query: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450
            RNT W  GIV+FTG +TK+M NA  TP KR+ + + +N  +I  F  L VL L + + N 
Sbjct: 520  RNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNG 579

Query: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507
            I    DA   ++    GT     F    L F+   IL+ +LVPISL++++E+IK  QA  
Sbjct: 580  IYYRRDATSRTFFEF-GTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAF 638

Query: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG----R 563
            I  D+ LY  + D P   +T ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G    R
Sbjct: 639  IYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698

Query: 564  CYAE----------------------HIPEDKAATFEDGIEVGYRSFDD------LKKQL 595
             Y E                       I EDK    E  +++G  S  D      + K+L
Sbjct: 699  AYTEALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKEL 758

Query: 596  T-----TNSDDCK-IIDEFLTLLATCHTVIPEFQADGSIKY--QAASPDXXXXXXXXXXX 647
                   NS + K  ++ F+  LA CH+V+ E   +   K   +A SPD           
Sbjct: 759  VQDLGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDM 818

Query: 648  XYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP--DDSIK----LLC 701
             + F+ R  N V I I +  ++E+++LN+ EFNSTRKRMS I + P  D++ K    LLC
Sbjct: 819  GFSFVGRTKNGVIIEI-QGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLC 877

Query: 702  KGADSVILERLSETGN--FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMD 759
            KGADSVI  RL  + N    ++ T  HLE +ATEGLRTLC+A ++I  DEY  WN++   
Sbjct: 878  KGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERREL 937

Query: 760  AATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDK 819
            AA +LD+R E L+ VA+ IE  L L+G TAIED+LQ+GVPD+I  L +AGIK+WVLTGDK
Sbjct: 938  AAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDK 997

Query: 820  QETAINIGMSCRLLSEDMNLLIISEETKEA--------------------TRRNM----E 855
             ETAINIG SC LL  DM LL+I    ++                     T  NM    E
Sbjct: 998  VETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPE 1057

Query: 856  EKLAALHEHSLSEHDMNTLALVIDGHSLSFALEA-DLEDYFLAIGKMCKAVICCRVSPLQ 914
            E  AA  +H+  +   +   +VIDG +L  AL   D+   FL + K CKAV+CCRVSP Q
Sbjct: 1058 ELAAARKDHTPPQ---SAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQ 1114

Query: 915  KALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFL 974
            KA VVK+VK   + + LAIGDG+NDV+MIQAA VG+GI+G EG QA  SAD ++GQFR+L
Sbjct: 1115 KAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYL 1174

Query: 975  KKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFF 1034
             +L+LVHG WSY+R++  I   FYKN    +  FW+   + + G  + E   +  YN+ F
Sbjct: 1175 TRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAF 1234

Query: 1035 TVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTI 1094
            T LP   +G+ DQ  +  L    PQLYK+G     ++ + FW +  +G Y S + F    
Sbjct: 1235 TSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPY 1294

Query: 1095 L-FYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFT---LFAIPG 1148
            L +YR G  + K+    DH  +   ++ +S+ +V     ++ +Q  W  FT   +F   G
Sbjct: 1295 LCYYRTGL-ITKNAYGLDH-RYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCG 1352

Query: 1149 SLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYK 1208
             LFFW         ++  A  S E++      Y    FW  L V   F L   F W   +
Sbjct: 1353 ILFFWT-------GVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQ 1405

Query: 1209 RMYAPESYHLIQE 1221
            +++ P    +++E
Sbjct: 1406 KLFFPRDIDIVRE 1418

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           Y  N I TTKY   +FLPK L  +F   AN++FL    +  V     TN       L+ +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 241 LIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGD 276
           ++++ +K++ ED +R   D E+NN ++ I    E +
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHILHGVENN 298

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1039 (38%), Positives = 583/1039 (56%), Gaps = 91/1039 (8%)

Query: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336
            F +  W  + VGDI+RV++ + IPADII+LSSS+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 438  FAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKC 497

Query: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILRGATL 390
            +  I +SR +   K  + SE P+S+LY+Y+G L+    +       P++   ++LRG TL
Sbjct: 498  SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557

Query: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450
            RNT W  GIV+FTG +TK+M NA  TP K + + + +N+ +   F +L VL   + I N 
Sbjct: 558  RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNG 617

Query: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507
            +    D    +Y    G+          ++FW   IL+ ++VPISL++++E+IK  QA  
Sbjct: 618  VYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676

Query: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG----R 563
            I  D+ LY E  D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G    R
Sbjct: 677  IYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736

Query: 564  CYAEHIP----------EDKAATFEDGI-----------------------EVGYRSFDD 590
             Y E +           E++ A  ++GI                        V + S + 
Sbjct: 737  AYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEF 796

Query: 591  LKKQLTTNSDDCKIIDE-FLTLLATCHTVIPEFQADGS--IKYQAASPDXXXXXXXXXXX 647
            ++     N +  K  +E F+  LA CHTV+ E   D    + ++A SPD           
Sbjct: 797  VQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856

Query: 648  XYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK------LLC 701
             + F+ R  N V + I +  ++EY+LLN+ EFNSTRKRMS I + P ++        L+C
Sbjct: 857  GFSFVGRTKNGVIVDI-QGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLIC 915

Query: 702  KGADSVILERLSETGN-FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDA 760
            KGADS+I  RLS+  +   ++ T  HLE YATEGLRTLC+A +++   EY  WN+K+  A
Sbjct: 916  KGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIA 975

Query: 761  ATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQ 820
            A  L  R ++++ VA+ IE  LTL+G TAIED+LQ+GVPD+I TL EAGIK+WVLTGDK 
Sbjct: 976  AAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035

Query: 821  ETAINIGMSCRLLSEDMNLLII--------------SEETKEATRRNMEEK--LAALHEH 864
            ETAINIG SC LL+ +M LL+I              +E  K    + ++EK  ++  +E 
Sbjct: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095

Query: 865  -----SLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVSPLQKALV 918
                  + E       ++IDG +L  AL  D ++  FL + K CKAV+CCRVSP QKA V
Sbjct: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155

Query: 919  VKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLL 978
            VK+VK   + + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D ++GQFR+L +L+
Sbjct: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215

Query: 979  LVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLP 1038
            LVHG WSY+R++  I   FYKN    ++ FWY   N + G  + E   ++L+N+ FT LP
Sbjct: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275

Query: 1039 PFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYR 1098
               +G+ DQ VN  +    PQLY++G     ++ + FW ++ +  Y S + F    L Y 
Sbjct: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYY 1335

Query: 1099 YGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSLFFWLIF 1156
                + ++G   DH  W + ++ +++ +V     ++ +Q  W  F+      SLF  L  
Sbjct: 1336 KTGIVTQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFS------SLFIALSC 1388

Query: 1157 FPIYG--SIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPE 1214
              I+    I+     S E++    H YG   FW  +     F L   F    + R Y P+
Sbjct: 1389 LCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPK 1448

Query: 1215 SYHLIQEMQKYNVSDYRPH 1233
               +I+E  K    D+ P 
Sbjct: 1449 DIDIIRECWKRGDFDHYPE 1467

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 67/144 (46%), Gaps = 14/144 (9%)

Query: 126 STGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRFGYIDNH 185
           S  + D+N+ KS  + + + ++  Y L            P    I D + N+   Y  N 
Sbjct: 199 SDDDNDENYDKSHRQRETRTIY--YNL------------PLPEDILDEDGNSTIYYPRNK 244

Query: 186 ISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSA 245
           I TTKY   TF PK +  +F   AN++FL    +         N       L+V++++++
Sbjct: 245 IRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTS 304

Query: 246 IKESVEDLKRASSDNELNNSKAEI 269
            K+++ED +R   D E+NN+   I
Sbjct: 305 FKDAIEDSRRTILDMEVNNAPTHI 328

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1042 (38%), Positives = 575/1042 (55%), Gaps = 96/1042 (9%)

Query: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336
            F +  W  +KVGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448

Query: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGT------KIPLSPEQMILRGATL 390
            + KI  SR++   +  I SE P+++LY+Y+G L+   +        P++   M+LRG TL
Sbjct: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508

Query: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450
            RNT W  GIV+FTG +TK+M NA  TP K++ + + +N  ++  F VL +L  IS + N 
Sbjct: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568

Query: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507
            I      +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627

Query: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAE 567
            I  D+ LY  + D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687

Query: 568  HIPEDKAATFE-DGIEV---GYRSFDDLKKQLTTNSDDC--------------------- 602
               E  A   +  GI+V   G R  +++ K      +D                      
Sbjct: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747

Query: 603  -------------KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDXXXXXXXXXXX 647
                         K  + F+  LA CH+V+  P       ++ +A SPD           
Sbjct: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807

Query: 648  XYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP----DDSIK--LLC 701
             + F+ +    + + I +  ++E+++LNI EFNS RKRMS I + P    +D  +  L+C
Sbjct: 808  GFCFMGKTKTGMVVEI-QGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLIC 866

Query: 702  KGADSVILERLS----ETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKY 757
            KGADSVI  RLS    E     ++ T  HLE YATEGLRTLCLA +++   EY  WN +Y
Sbjct: 867  KGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARY 926

Query: 758  MDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTG 817
              AA +L +R E+L+ V++ IE  L L+G TAIED+LQ+GVP++I  L EAGIK+WVLTG
Sbjct: 927  DIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTG 986

Query: 818  DKQETAINIGMSCRLLSEDMNLLII----------SEETKEATR----RNMEEKLA---- 859
            DK ETAINIG SC LL+ DM LL++           E+  E       + + EK      
Sbjct: 987  DKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGS 1046

Query: 860  ------ALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVSP 912
                  A  +HS  + D    A+VIDG +L  AL  D ++  FL + K CKAV+CCRVSP
Sbjct: 1047 EMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103

Query: 913  LQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFR 972
             QKA VVK+VK   + + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D ++GQFR
Sbjct: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163

Query: 973  FLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNV 1032
            +L +LLLVHG WSY+R+S  I   FYKN    +  FWY   N F G  + E   +  YN+
Sbjct: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223

Query: 1033 FFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVG 1092
             FT +P  ++G+ DQ VN  +    PQLY++G     ++ + F  ++ +G Y S + F  
Sbjct: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFF 1283

Query: 1093 TILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSL 1150
              L Y+    + K+G   +H  + + I  +++ +      ++ +Q  W  F+ F I    
Sbjct: 1284 PYLLYKRNGVVTKNGMGLEH-RYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFI---- 1338

Query: 1151 FFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRM 1210
            F   I    +  I+  +  S + +   E  Y S +FW    +   F L   F W  Y + 
Sbjct: 1339 FLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398

Query: 1211 YAPESYHLIQEMQKYNVSDYRP 1232
            + P    +I+EM K    D+ P
Sbjct: 1399 FNPSDVQIIREMWKRGDYDHYP 1420

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%)

Query: 165 PREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPH 224
           P    + D E N    Y  N I TTKY   +F PK L  +F  +AN++FL    +     
Sbjct: 168 PLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQI 227

Query: 225 VSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269
              TN   +   L+V++I++AIK+ +ED +R   D E+NN++  I
Sbjct: 228 FGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHI 272

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1039 (37%), Positives = 573/1039 (55%), Gaps = 90/1039 (8%)

Query: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336
            F +  W  +KVGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452

Query: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNG------TKIPLSPEQMILRGATL 390
            T  I  S+++   K  I SE P+S+LYTY+G ++            P++   ++LRG TL
Sbjct: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512

Query: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450
            RNT W  G+V+FTG +TK+M N+  TP K++ + + +N  ++  F +L +L  +S I N 
Sbjct: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572

Query: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507
            +      +   + Y  GT         F++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631

Query: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAE 567
            I  D+ LY  + D P   K+ ++ ++LGQ+EYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691

Query: 568  HIPEDKAATFE-DGIEV---GYRSFDDLKKQLTTNSDDCKII------------------ 605
               E  A   +  GI+V   G R   ++ K   T  D+ + +                  
Sbjct: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751

Query: 606  ----------------DEFLTLLATCHTVIPEFQADGSIKY--QAASPDXXXXXXXXXXX 647
                            + F+  LA CH+V+ E   D   K   +A SPD           
Sbjct: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811

Query: 648  XYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP------DDSIKLLC 701
             + F+ +    + I + +  ++E+++LNI EFNS+RKRMS I + P      +    L+C
Sbjct: 812  GFSFVGKTKKGLIIEM-QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLIC 870

Query: 702  KGADSVILERLSETGNFYVDA----TTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKY 757
            KGADS+I  RLS       +A    T  HLE YATEGLRTLC+A +++   EY  WN+KY
Sbjct: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930

Query: 758  MDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTG 817
              AA +L +R ++L+ VA+ IE  L L+G TAIED+LQ+GVPD I  L EAGIK+WVLTG
Sbjct: 931  DIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTG 990

Query: 818  DKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNME--EKLAALHEHSLSEH------ 869
            DK ETAINIG SC LL+ +M LL+I     +      E  E + AL    L E+      
Sbjct: 991  DKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGS 1050

Query: 870  -------------DMNTLALVIDGHSLSFALEA-DLEDYFLAIGKMCKAVICCRVSPLQK 915
                              A+VIDG +L  AL   D+   FL + K C+AV+CCRVSP QK
Sbjct: 1051 EEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQK 1110

Query: 916  ALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLK 975
            A VVK+VK   + + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D ++GQFR+L 
Sbjct: 1111 AAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLA 1170

Query: 976  KLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFT 1035
            +L+LVHG WSY+R++  I   FYKN    +  FWY   N F G  + E   M  YN+ FT
Sbjct: 1171 RLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFT 1230

Query: 1036 VLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTIL 1095
             LP   +G+ DQ VN  +    PQLY++G   + ++   F  ++++G Y S + F    L
Sbjct: 1231 SLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYL 1290

Query: 1096 FYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSLFFW 1153
             Y     +  +G   DH  + + +Y +++ ++     ++ +Q  W  F+   I  S    
Sbjct: 1291 VYHKNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC--- 1346

Query: 1154 LIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAP 1213
            L+ F   G I+  A  SRE+F      YG+ +FW    V   F L   F +  +++ + P
Sbjct: 1347 LVVFAWTG-IWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYP 1405

Query: 1214 ESYHLIQEMQKYNVSDYRP 1232
                +++EM ++   D+ P
Sbjct: 1406 TDVEIVREMWQHGHFDHYP 1424

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%)

Query: 165 PREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPH 224
           P    + D E N    Y  N I TTKY   TFLPK +  +F  +AN++FL    +     
Sbjct: 175 PLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQI 234

Query: 225 VSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269
              TN   +   L+V++I++AIK+++ED +R   D E+NN+K  I
Sbjct: 235 FGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279

>Scas_636.16
          Length = 1554

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1055 (37%), Positives = 579/1055 (54%), Gaps = 109/1055 (10%)

Query: 273  AEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332
            A   F    W +++VGDI+R+++ + IPAD+I+LS+S+ +G CY+ET NLDGE+NLK++Q
Sbjct: 368  ANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQ 427

Query: 333  ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLE----MNGT--KIPLSPEQMILR 386
            +   T  I +SR++   K  + SE P+++LY Y+G L+    ++G     P++   M+LR
Sbjct: 428  SLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLR 487

Query: 387  GATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISS 446
            G TLRNT W  GIV+FTG +TK M NA  TP K++ + + +N  ++  F  L +L LI+ 
Sbjct: 488  GCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAG 547

Query: 447  IGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYY 503
            + N        +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  
Sbjct: 548  VANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTA 606

Query: 504  QAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGR 563
            QA  I  D+ LY E  D P   K+ S+ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G 
Sbjct: 607  QAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV 666

Query: 564  CYA--------------------------EHIPEDKAATFEDGIEVGYRS---------- 587
             Y                           E I +D+    +D  ++   S          
Sbjct: 667  SYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFV 726

Query: 588  FDDLKKQLTTNSDDC--KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDXXXXXXX 643
              +  + L  N+ +   K    F+  LA CH+V+  P+      ++  A SPD       
Sbjct: 727  SKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTT 786

Query: 644  XXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK----- 698
                 + F+ +    + + + +  ++E+Q+LNI EFNS+RKRMS I + P  + K     
Sbjct: 787  ARDMGFSFIGKTKQGLLVEV-QGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRA 845

Query: 699  -LLCKGADSVILERLSETGNF----YVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753
             L+CKGADSVI  RLS    +     ++ T  HLE YATEGLRTLC+  ++I   EY  W
Sbjct: 846  LLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEW 905

Query: 754  NKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIW 813
            N+KY  AA +L  R E+LD VA+ IE  L L+G TAIED+LQ+GVPD+I  L EAGIK+W
Sbjct: 906  NEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLW 965

Query: 814  VLTGDKQETAINIGMSCRLLSEDMNLLII---SEETKE-----------------ATRRN 853
            VLTGDK ETAINIG SC LL+ DM LL+I    E+ KE                   + N
Sbjct: 966  VLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFN 1025

Query: 854  M----EEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICC 908
            M    EE  AA  +HS  + +    A++IDG +L  AL  D ++  FL + K CKAV+CC
Sbjct: 1026 MTGSEEELAAAKKDHSPPQGE---FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCC 1082

Query: 909  RVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISV 968
            RVSP QKA VVK+VK   + + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D ++
Sbjct: 1083 RVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAI 1142

Query: 969  GQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMS 1028
            GQFR++ +L+LVHG W Y+R++  I   FYKN    +  FWY   N F G  + E   ++
Sbjct: 1143 GQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLT 1202

Query: 1029 LYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAV 1088
             YN+ FT LP   +G+ DQ V++ +    PQLY+ G   Q ++ + F  ++ +G Y S +
Sbjct: 1203 FYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVI 1262

Query: 1089 VFVGTILFYRYGFALRKHGETADHWSW------GIAIYTSSVIIVLGKAALVTNQWTKFT 1142
             +    L YR    + ++G   DH  +      GIA+ + +  +++ +      +W  FT
Sbjct: 1263 CYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQY-----RWDWFT 1317

Query: 1143 LFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDF 1202
             F      F   I +  +  I+  +  S E++      YG+ +FW    V   F +   F
Sbjct: 1318 TFFA----FLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRF 1373

Query: 1203 IWKYYKRMYAPESYHLIQEMQKYN-----VSDYRP 1232
             +  + +   P    +I+EM ++        DY P
Sbjct: 1374 TYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDP 1408

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN       L+V+
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI 269
           +I++AIK+++ED +R   D E+NN++  I
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHI 256

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1060 (36%), Positives = 584/1060 (55%), Gaps = 105/1060 (9%)

Query: 274  EGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQA 333
            E  F +  W ++KVGDI+RV++ + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+
Sbjct: 435  ECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQS 494

Query: 334  RTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILRG 387
               +  I  SR++   K  + SE P+++LY+Y+G  +   T+       P++   ++LRG
Sbjct: 495  LKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRG 554

Query: 388  ATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSI 447
             TLRNT W  G+VIFTG +TK+M NA  TP K++ + + +N  +I  F +L +L   + I
Sbjct: 555  CTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGI 614

Query: 448  GNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQ 504
             N +      +   Y    GT         F++FW   IL+ +LVPISL+++VE+IK  Q
Sbjct: 615  VNGVYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 673

Query: 505  AFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRC 564
            A  I +D+ LY  + D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  
Sbjct: 674  AIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 733

Query: 565  YAEHIPEDKAATFE-DGIEV---GYRSFDDLKK----------QLTTNSDDC-------- 602
            Y     E  A   +  G++V   G R  +++ K           ++ N+  C        
Sbjct: 734  YGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVS 793

Query: 603  ----------------KIIDEFLTLLATCHTVIPEFQADGSIKY--QAASPDXXXXXXXX 644
                            K  + FL  LA CH+V+ E   D   K   +A SPD        
Sbjct: 794  KEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTA 853

Query: 645  XXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK------ 698
                Y F+    + + + I +  ++E+Q+LN+ EFNS+RKRMS I + P  + K      
Sbjct: 854  RQLGYSFVGSSKSGLIVEI-QGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKAL 912

Query: 699  LLCKGADSVILERLSETGN--FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKK 756
            L+CKGADSVI  RL  T N    ++ T  HLE+YATEGLRTLCLA +++   EY  W K 
Sbjct: 913  LICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKT 972

Query: 757  YMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLT 816
            Y  AA ++ +R E+LD V + IE  L L+G TAIED+LQ+GVPD+I  L EAGIK+WVLT
Sbjct: 973  YDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLT 1032

Query: 817  GDKQETAINIGMSCRLLSEDMNLLII---SEETKE---------------------ATRR 852
            GDK ETAINIG SC +L+ DM LL++    E+ +E                         
Sbjct: 1033 GDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSG 1092

Query: 853  NMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVS 911
            + EE   A  EH L + +    A++IDG +L  AL  + +   FL + K CKAV+CCRVS
Sbjct: 1093 SEEELKEAKREHGLPQGN---FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVS 1149

Query: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971
            P QKA VVK+VK+  + + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D ++GQF
Sbjct: 1150 PAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1209

Query: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031
            R++ +L+LVHG W Y+R++  I   FYKN    ++ FWY   N F G  + E   ++ YN
Sbjct: 1210 RYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYN 1269

Query: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091
            + FT +P  ++ V DQ V+  +    PQLY++G   + ++ + F  ++++G Y S + F 
Sbjct: 1270 LAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFF 1329

Query: 1092 GTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLF 1151
               L Y     + ++G   DH  + + ++ +++ +      +   Q+ ++  F     LF
Sbjct: 1330 FPYLAYHKNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQY-RWDWFC---GLF 1384

Query: 1152 FWLIFFPIYG--SIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKR 1209
              L     YG   I+  +  S E++      +    +W  L V   F L   F     ++
Sbjct: 1385 ICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRK 1444

Query: 1210 MYAPESYHLIQEM----------QKYNVSD-YRPHVQHFQ 1238
            ++ P+   +++EM          Q Y+ +D  RP +   +
Sbjct: 1445 IFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI 269
           +I++AIK+ +ED +R   D E+NN++  I
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHI 317

>Scas_576.8
          Length = 1591

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1047 (36%), Positives = 582/1047 (55%), Gaps = 97/1047 (9%)

Query: 273  AEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332
            ++  F +  W ++KVGDI+R+++ + IPADII+LS+S+ +G CY+ET NLDGETNLK+++
Sbjct: 405  SDCKFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRE 464

Query: 333  ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILR 386
            +   +  I +SR++   K  + SE P+++LY+Y+G ++   +K       P++   ++LR
Sbjct: 465  SLKCSHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLR 524

Query: 387  GATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISS 446
            G TLRNT W  G+V+FTG +TK+M N+ ATP K++ + + +N+ +   F  L ++  IS+
Sbjct: 525  GCTLRNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISA 584

Query: 447  IGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYY 503
            I N +      +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  
Sbjct: 585  IINGVDYDKHPRSRDFFEF-GTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTA 643

Query: 504  QAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGR 563
            QA  I  D+ LY  + D P   K+ ++ +++GQIEYIFSDKTGTLT+N+MEFK C+I G 
Sbjct: 644  QAAFIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGI 703

Query: 564  CYAEHIPEDKAATFE-DGIEVGYR-------------SFDDLKKQLTTNS----DDC--- 602
             Y     E  A   +  GI+V                +  +  + L+ NS    DD    
Sbjct: 704  SYGRAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFI 763

Query: 603  -----------------KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDXXXXXXX 643
                             K  + F+  LA CH+V+  P       +  +A SPD       
Sbjct: 764  SKEFVNDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCT 823

Query: 644  XXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP----DDSIK- 698
                 + F+ +    + I + +  ++E+Q+LN  EFNSTRKRMS I + P    DD  + 
Sbjct: 824  ARDVGFSFIGKTKTGLIIEV-QGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRA 882

Query: 699  -LLCKGADSVILERLSETGNF----YVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753
             L+CKGADS+I  RL           ++ T  HLE YATEGLRTLC+A +++   EY  W
Sbjct: 883  LLICKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEW 942

Query: 754  NKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIW 813
            NK+Y  AA ++ +R E+L+AV++EIE  LTL+G TAIED+LQ+GVP++I  L +AGIK+W
Sbjct: 943  NKRYDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLW 1002

Query: 814  VLTGDKQETAINIGMSCRLLSEDMNLLII--------------SEETKEATRRNMEEKLA 859
            VLTGDK ETAINIG SC LL+ DM LL++              +E  +    + + EK  
Sbjct: 1003 VLTGDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFG 1062

Query: 860  AL-HEHSLSE----HDM--NTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVS 911
                E  L++    HD      A+VIDG +L  AL  + +   FL + K CKAV+CCRVS
Sbjct: 1063 LTGSEMELADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVS 1122

Query: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971
            P QKA VVK+V    + + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D ++GQF
Sbjct: 1123 PAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1182

Query: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031
            R+L +L+LVHG WSY+R++  I   FYKN    +  FWY   N F G  + E   +  YN
Sbjct: 1183 RYLTRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYN 1242

Query: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091
            + FT LP   +G+ DQ V+  +    PQLY+ G     ++ + F  ++++G Y S + F 
Sbjct: 1243 LAFTSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFF 1302

Query: 1092 GTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGS 1149
                 Y     +  +G   DH  + + +  +S+ +V     ++ +Q  W  F+   I  S
Sbjct: 1303 FPYCLYHKNQIVSNNGLGLDH-RFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLS 1361

Query: 1150 ---LFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKY 1206
               LFFW         ++  +  S+E+F      YG+ +FW    V   + L   F    
Sbjct: 1362 CIILFFWT-------GVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDC 1414

Query: 1207 YKRMYAPESYHLIQEM-QKYNVSDYRP 1232
            +++ + P    +++EM Q+ + S Y P
Sbjct: 1415 FRKFFYPTDVEIVREMWQRGDFSHYPP 1441

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 50/89 (56%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           Y  N I TTKY+   F PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 201 YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLAAVPLIVI 260

Query: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI 269
           +I++AIK+++ED +R   D E+NN++  I
Sbjct: 261 VIITAIKDAIEDSRRTLLDMEVNNTRTHI 289

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  438 bits (1127), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 356/1179 (30%), Positives = 574/1179 (48%), Gaps = 111/1179 (9%)

Query: 78   RINNQPH-LTQIGNKGNVFTRMGRSIKGIFTFQSNSEPQSFEMSNYNTV-----STGEMD 131
            +INN P  L++    G+  +   R++  +  F ++S     + SN +T      +    D
Sbjct: 45   QINNNPEPLSKHNTVGDRESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQD 104

Query: 132  DNFQ----KSRNKFDIKILFNK---YLLRKNTSDGQDSGEP---------REIHISDRES 175
            DNF+     S        +F+K   YL   NT +    G P         REIH      
Sbjct: 105  DNFKFTNIASSPPSSSNNIFSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPV 164

Query: 176  NNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIG 235
             +R  Y+ N +S  KYNA TF+P  L+++F  + NL+FL  +  Q VP +      + I 
Sbjct: 165  YDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIV 224

Query: 236  TLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWI---DIKVGDIIR 292
             L  VL V+  KE+++D++R   D E NN   E+Y        + R I   D+KVGD+I+
Sbjct: 225  PLAFVLTVTMAKEAIDDIQRRRRDRESNN---ELYHV----ITRNRSIPSKDLKVGDLIK 277

Query: 293  VNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGV 352
            V+  + IPAD+++L SSEP G  +I+T  LDGET+ K++ A   T  + ++  +  I   
Sbjct: 278  VHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRIS-- 335

Query: 353  ISSEQPNSSLYTYEGTLEM-NGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMR 411
            I++  P  S++ + G +   + T  PLS +  +     L ++G+    V++TG +T+   
Sbjct: 336  ITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAM 395

Query: 412  NATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKA 471
            N T   +K   +E  IN                 SI  ++ +   A  +  +   G +  
Sbjct: 396  NTTTAKVKTGLLELEIN-----------------SISKILCACVFALSILLVAFAGFHND 438

Query: 472  GLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLV 531
              ++ D L + ILFS ++P+SL V ++L K   A  I  D      +T   T+V+TS++ 
Sbjct: 439  D-WYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------KTIPETIVRTSTIP 491

Query: 532  EELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDL 591
            E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  +   +  +     S ++ 
Sbjct: 492  EDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNS 551

Query: 592  KKQLTTNSDDC--KIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXXXXY 649
            K  L+T   D   ++ D  LTL A CH V P F+ D  + YQAASPD             
Sbjct: 552  KVALSTTRKDMSFRVRDMILTL-AICHNVTPTFE-DDELTYQAASPDEIAIVKFTESVGL 609

Query: 650  KFLIRKPNSVTILINEE-EEREYQLLNICEFNSTRKRMSAIFRFPD-DSIKLLCKGADSV 707
                R  +S+++L     +   Y++L +  FNS  KRM  I R    D    + KGAD+V
Sbjct: 610  SLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTV 669

Query: 708  ILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHR 767
             + ++ E+ ++  + T     + A EGLRTL +  K + +  Y  + K+Y DA+ ++ +R
Sbjct: 670  -MSKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNR 724

Query: 768  AEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
             +++  V  + +E  L L+G T +EDKLQ+ V  +I  L+ AGIKIW+LTGDK ETA  +
Sbjct: 725  DQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCV 784

Query: 827  GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886
             +S +L+S    +  I++ T+     N  E L                 L+IDG SL   
Sbjct: 785  SISAKLISRGQYVHTITKVTRPEGAFNQLEYLKI----------NRNACLLIDGESLGMF 834

Query: 887  LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946
            L+   +++F  +  +   VI CR +P QKA V  ++++ T   +  IGDG NDVSMIQ A
Sbjct: 835  LKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCA 893

Query: 947  HVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMT 1006
             VGVGI G EG QA+ +AD S+ QF  L +LLL HG  SY+R +    +  ++   + + 
Sbjct: 894  DVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAIC 953

Query: 1007 QFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQK 1066
            Q  Y   + F   ++ + W M  Y   +T+ P F +   D  +   L + YP+LYK   +
Sbjct: 954  QAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEESLTKIYPELYKELTE 1012

Query: 1067 GQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAI-YTSSVI 1125
            G+  S   F+ W++   +  +V+     LF +   +L         ++  +AI +T+ V+
Sbjct: 1013 GKSLSYKTFFVWVLLSLFQGSVI----QLFSQAFTSLLD-----TDFTRMVAISFTALVV 1063

Query: 1126 IVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSAT 1185
              L   AL    W K  L     +L F+++  P  G  F        Y   V +  G   
Sbjct: 1064 NELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLG-----YMTTVNYYAG--- 1115

Query: 1186 FWLTLIVLPTFALTRDFIW---KYYKRMYAPESYHLIQE 1221
              L ++++  F      +W     Y+R++ P SY  +QE
Sbjct: 1116 -LLVILLISIFP-----VWTAKAIYRRLHPP-SYAKVQE 1147

>Scas_704.38
          Length = 1161

 Score =  433 bits (1113), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 326/1065 (30%), Positives = 519/1065 (48%), Gaps = 81/1065 (7%)

Query: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225
            REIH S     +R  Y  N IS  KYNA TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 165  REIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPAL 224

Query: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEA-EGDFIQKRWID 284
                  + +  L  VL V+  KE+++D++R   DNE   S +E+Y    +   +  +  D
Sbjct: 225  RIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNE---SNSELYHVLNQSKLVPSK--D 279

Query: 285  IKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344
            +KVGD+I+++  + +PAD+++L SSEP G  +I+T  LDGET+ K++ A   T  + +  
Sbjct: 280  LKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEP- 338

Query: 345  ELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI-PLSPEQMILRGATLRNTGWIFGIVIFT 403
            +L N K  I++  P  +++ + G +    T   PLS +  +     L +TG+  G V++T
Sbjct: 339  DLMN-KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYT 397

Query: 404  GHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYL 463
            G +T+   N T   +K   +E  IN                 SI  ++ ++  A  +  +
Sbjct: 398  GRDTRQAMNTTTATVKTGLLELEIN-----------------SISKILCASVFALSIILV 440

Query: 464  YLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPT 523
               G + +  +  D + + ILFS ++P+SL V ++L K   A  I  D      +T   T
Sbjct: 441  VFAGFHNSDWYL-DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------DTIPET 493

Query: 524  VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583
            +V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y      D  + + D +  
Sbjct: 494  IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL-DIVSDYVDALVN 552

Query: 584  GYRSFDDLKKQL--TTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXX 641
               S +   K +  T+  D    + + +  LA CH V P F+ D  + YQAASPD     
Sbjct: 553  SSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFE-DDELTYQAASPDEIAIV 611

Query: 642  XXXXXXXYKFLIRKPNSVTILINEEEE-REYQLLNICEFNSTRKRMSAIFRFPD-DSIKL 699
                        R  +S+++L         Y++L +  FNS  KRM  I      D    
Sbjct: 612  KFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWF 671

Query: 700  LCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMD 759
            + KGAD+V + R+ E  ++  + T     + A EGLRTL +  K +  + Y+ + K Y D
Sbjct: 672  MQKGADTV-MARIVENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDD 726

Query: 760  AATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGD 818
            A+ ++ +R ++++AV  + +E  L L+G T +EDKLQ  V  +I  L+ AGIKIW+LTGD
Sbjct: 727  ASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGD 786

Query: 819  KQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVI 878
            K ETA  + +S +L+S    + II++ TK     N  E L                 L+I
Sbjct: 787  KVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV----------NKGACLLI 836

Query: 879  DGHSLSFALEADLEDYFLAIGKMC-KAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGA 937
            DG SL   L     ++F  +  +C   V+ CR +P QKA V  +++  T   +  IGDG 
Sbjct: 837  DGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894

Query: 938  NDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSF 997
            NDVSMIQ A VGVGI G EG QA+ +AD S+ +F  L +LLL HG  SY+R +    +  
Sbjct: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954

Query: 998  YKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERY 1057
            ++   + + Q  Y   + F    + + + M  Y   +T+ P F +   D  +   L + Y
Sbjct: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESLTKIY 1013

Query: 1058 PQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGI 1117
            P+LYK   +G+  S   F+ W     +   V+   + +F                ++  +
Sbjct: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSL---------LEVDFTKMV 1064

Query: 1118 AI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGV 1176
            AI +T+ ++  L   AL    W K  +F    +   ++I  P  G  F    +    F  
Sbjct: 1065 AIGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRF-- 1122

Query: 1177 VEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQE 1221
                YG   F L + V P +A       K   R   P SY  +QE
Sbjct: 1123 ----YGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  426 bits (1096), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 327/1087 (30%), Positives = 519/1087 (47%), Gaps = 91/1087 (8%)

Query: 147  FNKYLLRKNTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFS 206
             +KY    ++ +  D    REIH       ++  Y  N IS  KYN  TF+P  L+++F 
Sbjct: 132  LSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFK 191

Query: 207  KYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSK 266
             + NL+FL  +  Q +P +      + I  L  VL+V+  KE+++D++R   D E NN  
Sbjct: 192  FFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNEL 251

Query: 267  AEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGET 326
             E+  +A+   +  +  D+KVGD+I+++    IPAD+++L SSEP G  +I+T  LDGET
Sbjct: 252  YEVLNKAQ--LVPSK--DLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGET 307

Query: 327  NLKIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEM-NGTKIPLSPEQMIL 385
            + K++ A + T  +     L  I   I++  P  S++ + G L   + +   LS +  + 
Sbjct: 308  DWKLRVACSLTQNLSTDDLLNKIS--ITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMW 365

Query: 386  RGATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVIN----MQIIALFTVLVVL 441
                L + G   G V++TG +T+   N T + +K   +E  IN    +    +F + +VL
Sbjct: 366  ANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVL 425

Query: 442  ILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIK 501
            +  +  GN                        ++ D + + ILFS ++P+SL V ++L K
Sbjct: 426  VAFAGFGN----------------------KDWYVDIMRYLILFSTIIPVSLRVNLDLGK 463

Query: 502  YYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIA 561
               A  I  D       T   T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   + 
Sbjct: 464  SVYARQIEHD------ATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517

Query: 562  GRCYAEHIPEDKAATFEDGI-EVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIP 620
               Y      D      D + E+   S      Q T   D    + + +  LA CH V P
Sbjct: 518  TVSYTM----DTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTP 573

Query: 621  EFQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEER-EYQLLNICEF 679
             F+ DG + YQAASPD                 R  +SV++         EY +L +  F
Sbjct: 574  TFE-DGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPF 632

Query: 680  NSTRKRMSAIFRFPDDSIK----LLCKGADSVILERLSETGNFYVDATTRHLEDYATEGL 735
            NS  KRM  I     D +K     + KGAD+V + R+ ++ N ++D     + + A EGL
Sbjct: 633  NSDTKRMGIIVY---DKVKGEHWFMQKGADTV-MARIVQS-NDWLD---EEVGNMAREGL 684

Query: 736  RTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKL 794
            RTL +  K +    Y  + K+Y DA+ ++ +R E + +V ++ +E  L L+G T +EDKL
Sbjct: 685  RTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKL 744

Query: 795  QEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNM 854
            Q  V  +I  L+ AG+KIW+LTGDK ETA  + +S +L+S    +  +++ ++       
Sbjct: 745  QNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP------ 798

Query: 855  EEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQ 914
            E  L AL    +++       L+IDG SL   L    +++F  +  +  AVI CR +P Q
Sbjct: 799  EGALNALEYLKINKSS----CLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQ 853

Query: 915  KALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFL 974
            KA V  +++  T   +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD SV QF  L
Sbjct: 854  KADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHL 913

Query: 975  KKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFF 1034
             KLLL HG  SY+R +    +  ++   + + Q  Y   + F   ++ + W M  Y   +
Sbjct: 914  TKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCY 973

Query: 1035 TVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTI 1094
            T+ P F +   D  ++  L + YP+LYK    G   S   F+ W++   +    +   + 
Sbjct: 974  TMAPVFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQ 1032

Query: 1095 LFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWL 1154
             F           +  D        +T+ VI  L   AL    W K  +     +   ++
Sbjct: 1033 YFTSL--------DEVDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYV 1084

Query: 1155 IFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPE 1214
            +  P     F    +S+  F      Y    F L + V P +A       K   R   P 
Sbjct: 1085 VSVPFLSEYFDLTFVSQLPF------YAKLIFILAVSVFPVWAA------KAIHRKINPP 1132

Query: 1215 SYHLIQE 1221
            +Y  +Q+
Sbjct: 1133 NYAKVQQ 1139

>Kwal_23.5789
          Length = 1133

 Score =  426 bits (1094), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 324/1063 (30%), Positives = 513/1063 (48%), Gaps = 82/1063 (7%)

Query: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225
            REIH S     +R+ Y  N IS  KYN  TF+PK L+++F  + NL+FL  +  Q +P +
Sbjct: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200

Query: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDI 285
                  + I  L  VL V+  KE+++D++R   D E NN   E+   ++   +  +  D+
Sbjct: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVL--SKSQLVPSK--DL 256

Query: 286  KVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE 345
            KVGD+I++      PAD+++L SSEP G  +I+T  LDGET+ K++ A   T  +     
Sbjct: 257  KVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDL 316

Query: 346  LRNIKGVISSEQPNSSLYTYEGTLEMNGTKI-PLSPEQMILRGATLRNTGWIFGIVIFTG 404
            L  I   I++  P  S+  + G L     +  PLS +  +       + G     V++TG
Sbjct: 317  LYRIS--ITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTG 374

Query: 405  HETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464
             +T+   N + + +K   +E  IN    +L  +L   + I S+  V  +           
Sbjct: 375  ADTRQAMNTSMSSVKTGLLELEIN----SLSKILCACVFILSVALVAFA----------- 419

Query: 465  LQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTV 524
              G N    ++ D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 420  --GFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------STIPETI 470

Query: 525  VKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVG 584
            V+TS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y      D      D +   
Sbjct: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTM----DTMDIVTDYVRAM 526

Query: 585  YRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXXX 644
              + +       +  D    + + +  LA CH V P F+ DG + YQAASPD        
Sbjct: 527  SDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFE-DGELTYQAASPDEIAIVKFT 585

Query: 645  XXXXYKFLIRKPNSVTILINEEEER-EYQLLNICEFNSTRKRMS-AIFRFPDDSIKLLCK 702
                     R  +S+T+L ++     EY +L++  FNS  KRM   IF    D    L K
Sbjct: 586  ESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQK 645

Query: 703  GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAAT 762
            GAD V++ ++ +  ++  + T     + A EGLRTL +  K + +     + K Y DA+ 
Sbjct: 646  GAD-VVMSKIVQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700

Query: 763  TLDHRAEKL-DAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQE 821
             + +R   + + +++ +E  L ++G T +EDKLQE V  +I  L+ AGIKIW+LTGDK E
Sbjct: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760

Query: 822  TAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGH 881
            TA  + +S +L+S         +     T+ N  E   AL    L + + N+  L+IDG 
Sbjct: 761  TARCVSISAKLVSR-------GQYVHTVTKVNKPE--GALTHLELLKINTNS-CLLIDGE 810

Query: 882  SLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVS 941
            SL   LE   + +F  +  +  AVI CR +P QKA V   ++  T   +  IGDG NDVS
Sbjct: 811  SLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVS 869

Query: 942  MIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNT 1001
            MIQ+A VGVGI G EG QA+ +AD S+ QF  L KLLL HG  SY+R +    +  ++  
Sbjct: 870  MIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGL 929

Query: 1002 ALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLY 1061
             + + Q  Y  ++ F   ++ + W M  Y   +T+ P F +   D  ++  L + YP+LY
Sbjct: 930  LISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTYPELY 988

Query: 1062 KLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYT 1121
            K    G+  S   F+ W+V   +   V+             L +   + D   +   +  
Sbjct: 989  KELTAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKRLVAL 1037

Query: 1122 SSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIF---FPIYGSIFPYAKISREYFGVVE 1178
            S  +++L +  +V  +   +    +   +  +LIF    P+    F    +SR  +    
Sbjct: 1038 SFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY---- 1093

Query: 1179 HTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQE 1221
              YG     L+L ++P +A       K   R   P SY  +Q+
Sbjct: 1094 --YGKLAIILSLSIIPVWAA------KALHRRLNPPSYAKVQQ 1128

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  426 bits (1096), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 322/1071 (30%), Positives = 541/1071 (50%), Gaps = 96/1071 (8%)

Query: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225
            REIH+      ++  Y  N IS  KYNA TFLP  L+++F  + NL+FL  S  Q +P +
Sbjct: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232

Query: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDI 285
                  + I  L  VL+V+  KE+++D++R   D E NN   E+   ++   +  +  ++
Sbjct: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ--LVPSK--NL 288

Query: 286  KVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE 345
            +VGD+++++ +  IPAD+I+L SSEP G  +++T  LDGET+ K++ A + T  +     
Sbjct: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348

Query: 346  LRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGH 405
            L  +   I++  P  S++ + G L   G+  PLS +  +     L ++G     VI+TG 
Sbjct: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406

Query: 406  ETKLMRNATATPIKRTAVEKVIN----MQIIALFTVLVVLILISSIGNVIMSTADAKHLS 461
            +T+   N + + +K   +E  IN    +  I +FT+ ++L++I  +        D K   
Sbjct: 407  DTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLD-------DDK--- 456

Query: 462  YLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDT 521
                        ++ D + + ILFS ++P+SL V ++L K   A  I SD      ++  
Sbjct: 457  ------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIP 498

Query: 522  PTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPE---DKAATFE 578
             T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y     +   D   T  
Sbjct: 499  DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLT 558

Query: 579  DGIEVGYR--SFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPD 636
                +G    +    +K+++        + + +  LATCH V P F+ D  + YQAASPD
Sbjct: 559  SPANMGAAGVAVTGSRKEVSQR------VRDLVVTLATCHNVTPNFE-DNELAYQAASPD 611

Query: 637  XXXXXXXXXXXXYKFLIRKPNSVTILINEEE--EREYQLLNICEFNSTRKRMSAIFR-FP 693
                             R  +S+T L +E      +Y +L++  F S  KRM  I R   
Sbjct: 612  EIAIVKFTERVGLSLFKRDRHSLT-LFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRT 670

Query: 694  DDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753
             + I  L KGAD+V + ++ ++ ++  +     + + A EGLRTL +A K +    Y  +
Sbjct: 671  KNEIWFLQKGADTV-MSKIVQSNDWLEE----EVSNMAREGLRTLVIARKKLSTRLYEQF 725

Query: 754  NKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKI 812
            +K+Y DA+ ++ +R E ++ V +  +E  L L+G T +EDKLQ+ V  +I  L+ AG+KI
Sbjct: 726  SKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKI 785

Query: 813  WVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMN 872
            W+LTGDK ETA  + +S +L+S    +  I++     TRR+      AL      + + N
Sbjct: 786  WMLTGDKVETARCVCVSAKLISRGQYVHTITK----LTRRD-----GALSRLEYLKANRN 836

Query: 873  TLALVIDGHSLSFALEADLEDYFLAIGKMC-KAVICCRVSPLQKALVVKMVKRKTNSLLL 931
            +  L+IDG SL+  +     ++F  +  +C   VI CR +P QKA V  +++  T   + 
Sbjct: 837  S-CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVC 893

Query: 932  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISV 991
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L KLLL HG  SY+R + 
Sbjct: 894  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAK 953

Query: 992  AILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNS 1051
               +  ++   + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  ++ 
Sbjct: 954  LSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 1012

Query: 1052 RLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETAD 1111
             L + YP+LYK   +G+  S   F+ W++   +  AV+          GF+    G  ++
Sbjct: 1013 SLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVI---------QGFSQLFIGVGSE 1063

Query: 1112 HWSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKIS 1170
             +   +A+ +T+ VI  L   AL    W K    +   +   +++  P+ G         
Sbjct: 1064 VFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLG--------- 1114

Query: 1171 REYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQE 1221
             EYF +      +  F++ L ++ T ++   +  K   R   P S+  +Q+
Sbjct: 1115 -EYFDLTSML--ALPFFIQLTIILTVSIFPVWAAKTIHRRLKPPSHAKVQQ 1162

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  423 bits (1088), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 326/1073 (30%), Positives = 522/1073 (48%), Gaps = 88/1073 (8%)

Query: 161  DSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQ 220
            D    RE+H    +  +R  +  N +S  KYNA TFLP  L+++F  + NL+FL  +  Q
Sbjct: 144  DEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQ 203

Query: 221  QVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQK 280
             +P +      + +  L  VL V+  KE+ +D++R   D E   S  E+Y E  G     
Sbjct: 204  AIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRE---SNMELY-EVLGRPRPV 259

Query: 281  RWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKI 340
               D+KVGD+I+++    +PAD+I+L SSEP G  +I+T  LDGET+ K++ A T T  +
Sbjct: 260  ASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNL 319

Query: 341  MDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIP-LSPEQMILRGATLRNTGWIFGI 399
             +   L  I   I++  P  S++++ G +    T    L+ +  +     L ++G+  G 
Sbjct: 320  NEDDLLEKI--TITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGC 377

Query: 400  VIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKH 459
            VI+TG +T+   N T+  +K   +E  IN     +  +L   + I SI  V+        
Sbjct: 378  VIYTGRDTRQAMNTTSAKVKTGLLELEIN----DISKILCACVFILSILLVVF------- 426

Query: 460  LSYLYLQGTNKAGL----FFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLY 515
                       AGL    ++ D + + ILFS ++P+SL V ++L K   A  I  D    
Sbjct: 427  -----------AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD---- 471

Query: 516  YEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAA 575
              +T   T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 472  --KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSD 529

Query: 576  TFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASP 635
              +  IE    S  +L  + TT  D    + + +T LA CH V P F+ D  + YQAASP
Sbjct: 530  YIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFE-DDELTYQAASP 588

Query: 636  DXXXXXXXXXXXXYKFLIRKPNSVTILINEEEE-REYQLLNICEFNSTRKRMSAI-FRFP 693
            D                 R  +S+++L         Y +L +  FNS  KRM  I +   
Sbjct: 589  DEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQ 648

Query: 694  DDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753
             D    L KGAD+V + R+    ++  + T     + A EGLRTL +  K + +  Y  +
Sbjct: 649  KDQYWFLQKGADTV-MNRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQF 703

Query: 754  NKKYMDAATTLDHRAEKL-DAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKI 812
             K+Y + + ++ +R +++ + +++ +E  L L+G T +EDKLQ+ V  +I  L+ AGIKI
Sbjct: 704  KKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 763

Query: 813  WVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMN 872
            W+LTGDK ETA  + +S +L+S    + ++++ +K     N  E L              
Sbjct: 764  WMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKV----------NK 813

Query: 873  TLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLA 932
               L+IDG SL   L+   +++F  +  +   VI CR +P QKA V  +++  T   +  
Sbjct: 814  NACLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCC 872

Query: 933  IGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVA 992
            IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L +LLL HG  SY+R +  
Sbjct: 873  IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKL 932

Query: 993  ILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSR 1052
              +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  ++  
Sbjct: 933  AQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDES 991

Query: 1053 LLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADH 1112
            L + YP+LYK   +G+  S   F+ W+   FY   V+          GF+          
Sbjct: 992  LTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI---------QGFSQTFTSLAEID 1042

Query: 1113 WSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISR 1171
            ++  +AI +T+ +   L   AL    W K  +     +L  ++   P  G  F    IS 
Sbjct: 1043 FTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYIST 1102

Query: 1172 EYFGVVEHTYGSATFWLTLIVLPTFALTRDFIW---KYYKRMYAPESYHLIQE 1221
              F          T  + ++V+  F      +W     Y+R+  P SY  +QE
Sbjct: 1103 LKF---------ITELILILVVSIFP-----VWLTKAIYRRLNLP-SYAKVQE 1140

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  421 bits (1083), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 322/1034 (31%), Positives = 501/1034 (48%), Gaps = 80/1034 (7%)

Query: 155  NTSDGQ-----DSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYA 209
            N+ DG      D    REIH +     +R  Y  N IS  KYN  TF+P  L+++F  + 
Sbjct: 142  NSVDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFF 201

Query: 210  NLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269
            NL+FL  +  Q +P +      + I  L  VL V+  KE+++D+ R   D E NN   E+
Sbjct: 202  NLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANN---EL 258

Query: 270  YFEAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLK 329
            Y E           D+KVGDII++     +PAD+++L ++EP G  +I+T  LDGET+ K
Sbjct: 259  Y-EVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWK 317

Query: 330  IKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEM-NGTKIPLSPEQMILRGA 388
            ++ A + T  + ++  L NI   I++  P  S++ + G +   + T  PLS +  +    
Sbjct: 318  LRLACSLTQSLTENDLLNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENT 375

Query: 389  TLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIG 448
             L ++      +++TG ET+   N T +  K   +E  IN     L  +L   + + SI 
Sbjct: 376  VLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEIN----GLSKILCACVFLLSIM 431

Query: 449  NVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMI 508
             V  +             G N    ++ D + + ILFS ++P+SL V ++L K   A+ I
Sbjct: 432  LVAFA-------------GFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKI 477

Query: 509  GSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEH 568
              D  +        T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y   
Sbjct: 478  EHDKQI------EDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTN- 530

Query: 569  IPEDKAATFEDGIE-VGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGS 627
               +      D I+ +  R+ +        N  D ++ID  +T LA CH V P F+ DG 
Sbjct: 531  ---ETMDIVTDFIQSMNSRTSNSTPTTTRKNISD-RVID-LVTTLAICHNVTPTFE-DGE 584

Query: 628  IKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEER-EYQLLNICEFNSTRKRM 686
            + YQAASPD                 R  +S+++  +    + EY +  +  FNS  KRM
Sbjct: 585  LTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRM 644

Query: 687  SAIFRFPDDSIK----LLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLAT 742
              I     D +K     L KGAD+V+   +    N +++  T ++   ATEGLRTL +  
Sbjct: 645  GVIIF---DKLKQEYWFLQKGADTVMSSIVVR--NDWLEEETSNM---ATEGLRTLVIGR 696

Query: 743  KDIPEDEYNAWNKKYMDAA-TTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDT 801
            K +  + +  + K+Y +A+ T +D      + V + +E+ L L+G T +EDKLQ+ V  +
Sbjct: 697  KKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSS 756

Query: 802  IRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAAL 861
            I  L+ AGIKIW+LTGDK ETA  + +S +L+S         +     T+ N  E   AL
Sbjct: 757  IELLRNAGIKIWMLTGDKVETARCVSISAKLISR-------GQYVHTVTKVNKPE--GAL 807

Query: 862  HEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKM 921
            H     + + N+  L+IDG SL   L+    D F  I      V+ CR +P QKA V   
Sbjct: 808  HHLEYLQVNQNS-CLLIDGESLGLYLQY-FPDEFFDIVVNLPTVVACRCTPQQKADVAVF 865

Query: 922  VKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVH 981
            +++ T   +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L KLLL H
Sbjct: 866  IRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWH 925

Query: 982  GAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFV 1041
            G  SY+  +    +  ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F 
Sbjct: 926  GRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFS 985

Query: 1042 IGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGF 1101
            +   D  ++  L   YP+LYK    G+  S   F+ W+    +   V+ + +  F     
Sbjct: 986  L-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLN- 1043

Query: 1102 ALRKHGETADHWSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIY 1160
                       ++  +AI +T+ V+  L    L  N W K        +L  +L   P  
Sbjct: 1044 --------DSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFL 1095

Query: 1161 GSIFPYAKISREYF 1174
            G  F  + +S   F
Sbjct: 1096 GEYFDLSYVSTTKF 1109

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  343 bits (879), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 194/521 (37%), Positives = 301/521 (57%), Gaps = 20/521 (3%)

Query: 710  ERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAE 769
            E+L +   F ++ T   +++++TEGLRTL  + K IP +EY AW  KY +A T+L +R+ 
Sbjct: 927  EKLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRST 986

Query: 770  KLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMS 829
            ++  V   IE+ L L+GATAIEDKLQEGVP+ I+ ++ AGIK+W+LTGDK+ETAINIG +
Sbjct: 987  QIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 830  CRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLS-FALE 888
            C+L+ +   ++I+ +        N+  K+ AL E  L    +    LVIDG SL+ F   
Sbjct: 1047 CKLIYDYSTVVILKKNDD-----NLISKMTALGEE-LDTGKIAHCVLVIDGASLAVFENN 1100

Query: 889  ADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDVSMIQAAH 947
              +   F+ +     +VICCR SP QKAL+V  ++ K   L+ LAIGDGAND++MIQ+A 
Sbjct: 1101 PTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSAD 1160

Query: 948  VGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQ 1007
            +GVGI+G EG+QA+RS+D S+ QFR+L KLL VHG ++Y R S  +L +FYK    Y+TQ
Sbjct: 1161 IGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQ 1220

Query: 1008 FWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKG 1067
              Y     FSG S+ E W++S++N  FT LP   IG+F++ +    L   P+LY +GQK 
Sbjct: 1221 MIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKC 1280

Query: 1068 QFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIV 1127
            Q F++ IF  W++     S  V +  + F  +GF  +        +  G+  +TS   ++
Sbjct: 1281 QAFNLKIFLVWMLTAAGIS--VLITFLNFEIWGFTAQSDNSI---YPIGVINFTSICFLI 1335

Query: 1128 LGKAALVTNQ---WTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYG-S 1183
              K   +  +   W  F    I  S   W+++  +   I+    I     G+  H +G  
Sbjct: 1336 NVKCQFIETRNRNWLAFASLLI--SCIGWILWCCLLPGIYGENAIYDVLIGLY-HQFGRD 1392

Query: 1184 ATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQK 1224
             T+W + ++L  F +  D + + ++ M  P    +  E+++
Sbjct: 1393 ITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQ 1433

 Score =  254 bits (650), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 172/518 (33%), Positives = 260/518 (50%), Gaps = 85/518 (16%)

Query: 126 STGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDR------------ 173
           ST  +  N  K R K  ++      +L + T    +SG    I +               
Sbjct: 47  STENLPSNQTKKRKKLSLRTKIMDLILNRTTHLSSESGRVIPICLDKNSVLYQQYARSNL 106

Query: 174 ---ESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNR 230
              E  +R  Y DN I++++Y   +FLP+ L+ +FSK AN +FL  + +Q +P  S T  
Sbjct: 107 LIDERTDR-PYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGT 165

Query: 231 YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI------YFEAEGDFI------ 278
           YTTI  L + L +S  +E+ +D KR   D E NN   ++      + E E D I      
Sbjct: 166 YTTIVPLSIFLSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNV 225

Query: 279 ---------------------------------------------QKRWIDIKVGDIIRV 293
                                                        +K W D+KVG+ + +
Sbjct: 226 SARSTDAILSDFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLL 285

Query: 294 NSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVI 353
           NS++ +PADI++LS+       ++ET  LDGETNLK K    E AK M S    ++    
Sbjct: 286 NSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSAT 345

Query: 354 SS-EQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRN 412
           ++ E PN+ LY +EGT+E++G   PL  + ++ RG+ LRNT  I GIVIFTG ETK+  N
Sbjct: 346 TTLEDPNNDLYNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMN 405

Query: 413 ATATPIKRTAVEKVI-NMQIIALFTVLVV--LILISSIGNVIMST--ADAKHLSYLYLQG 467
           A   P  RT   K+   + +I LF V VV  + + S +G  I+     D     YL+ + 
Sbjct: 406 AIKNP--RTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQED 463

Query: 468 TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKT 527
              A       ++F I+++ L+P+SL+VT E+IK  Q+ ++  D+D+Y+ E+DTP   +T
Sbjct: 464 AGTA----PTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRT 519

Query: 528 SSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCY 565
           ++++EELGQ+ YIFSDKTGTLT N M F+  SI G  +
Sbjct: 520 ATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSW 557

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 63/117 (53%), Gaps = 14/117 (11%)

Query: 608 FLTLLATCHTVIPEFQADG--SIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILI-- 663
           F+  LA CHT +P+   DG  SI YQ++SPD              F++   NS T+ I  
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMG--FVVTNRNSSTLSIAT 729

Query: 664 ------NEEEEREYQLLNICEFNSTRKRMSAIFRFP--DDSIKLLCKGADSVILERL 712
                 ++    +Y++L    F+S RKRMS   + P  DD + L+CKGAD+VILERL
Sbjct: 730 YPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERL 786

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  340 bits (872), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 192/532 (36%), Positives = 303/532 (56%), Gaps = 33/532 (6%)

Query: 703  GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAAT 762
            G+D++I         + ++ T   +E ++TEGLRTL  A K I  +++  W  +Y +A T
Sbjct: 946  GSDALI-----SNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKT 1000

Query: 763  TLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQET 822
            +L  R +K+D V  +IE  L L+GATAIEDKLQEGV + I  ++ AGIK+W+LTGDK+ET
Sbjct: 1001 SLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRET 1060

Query: 823  AINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHS 882
            AINIG SC+L+ +   ++I++      +  N+  K+ A+ +  +   ++    +VIDG +
Sbjct: 1061 AINIGYSCKLIHDYSTVVILT-----TSDENIISKMNAISQE-VDSGNVAHCVIVIDGAT 1114

Query: 883  LS-FALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDV 940
            L+ F     L   F  +     +V+CCR SP QKAL+V  ++    S++ LAIGDGAND+
Sbjct: 1115 LAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDI 1174

Query: 941  SMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKN 1000
            +MIQ+A +GVGI+G EG+QA+RSAD S+GQFRF+ KLLLVHG ++Y R +  IL +FYK 
Sbjct: 1175 AMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKE 1234

Query: 1001 TALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQL 1060
               Y+TQ  Y     FSG S+ E W++S+YN  FT LP   +G+F++ +    L   P+L
Sbjct: 1235 LTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPEL 1294

Query: 1061 YKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGET--ADH--WSWG 1116
            Y +G+  + F+ SIF  W+  G  ++ ++    I+ +         GET  +D+  +  G
Sbjct: 1295 YSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAW---------GETSLSDNTLYPLG 1345

Query: 1117 IAIYTSSVIIVLGKAALV---TNQWTKFTLFAIP-GSLFFWLIFFPIYGSIFPYAKISRE 1172
               ++++V ++  KA  +      W  FT   +  G    W    PI         ++  
Sbjct: 1346 FVNFSATVALINVKAQFIEMRNRNWLAFTSVILSCGGWLVWCCALPILNRSDGIYDVT-- 1403

Query: 1173 YFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQK 1224
             +G+  H     TFW T ++L    +  D ++K +K M AP    +  E+++
Sbjct: 1404 -YGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQ 1454

 Score =  258 bits (659), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 165/479 (34%), Positives = 256/479 (53%), Gaps = 57/479 (11%)

Query: 167 EIHISDRESN---NRFGY--IDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQ 221
           +I+  DR  N    R+GY   +N I++++Y   +F P+ L+ +FSK AN++F   + +Q 
Sbjct: 104 DIYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQM 163

Query: 222 VPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKA---EIYFEAEGD-- 276
           +P  S T  YTTI  L V + +S  +E+ +D +R   D E NN      +I  E E +  
Sbjct: 164 IPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDL 223

Query: 277 ----------------------------------FIQKRWIDIKVGDIIRVNSEEPIPAD 302
                                              ++K+W DI+VGD + +  ++ +PAD
Sbjct: 224 DLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPAD 283

Query: 303 IIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE-LRNIKGVISSEQPNSS 361
           I+IL+S       +IET  LDGETNLK K    E  K+  S   L NI   ++ E PN+ 
Sbjct: 284 ILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNND 343

Query: 362 LYTYEGTLEMNG-----TKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATAT 416
           LY +EG LE+N       K PL P+ +I RG+ +RNT    G+VIFTG E+K+  NA   
Sbjct: 344 LYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRN 403

Query: 417 P-IKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFF 475
           P  K   +++ INM ++ +  V+  + L S +G+ I       +    YL   + AG   
Sbjct: 404 PRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQED-AGTA- 461

Query: 476 KDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELG 535
              ++F I+++ ++P+SL+VT+ELIK  Q+ M+  D+D+Y+ E+DTP  V+T++++EELG
Sbjct: 462 PTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELG 521

Query: 536 QIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPED----KAATFEDGIEVGYRSFDD 590
           Q+ YIFSDKTGTLT N M F+  S  G  +  +  +D    K A   +  ++   S DD
Sbjct: 522 QVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKNDIDVISIDD 580

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 78/162 (48%), Gaps = 27/162 (16%)

Query: 566 AEHIPEDKAATFE--DGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQ 623
           A  IPED  +TFE    I+   +S    K ++            F+  LA CH  +P+  
Sbjct: 646 ASDIPEDIKSTFELIYYIQSNPKSLFAKKAKM------------FILSLAICHICLPKRT 693

Query: 624 ADGS-----IKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEERE------YQ 672
            +G+     I+YQ++SPD            Y    R  N +T+    +   E      ++
Sbjct: 694 EEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKTFPDGFDELPRFENFE 753

Query: 673 LLNICEFNSTRKRMSAIFRFPD--DSIKLLCKGADSVILERL 712
           +L + +FNS RKRMS I R P+  D + L CKGAD+VILERL
Sbjct: 754 ILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERL 795

>Kwal_23.3556
          Length = 1597

 Score =  337 bits (864), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 198/523 (37%), Positives = 298/523 (56%), Gaps = 24/523 (4%)

Query: 710  ERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAE 769
            E L +   F ++ T + +ED++T GLRTL  + K IP ++Y  W+KKY  A T+L++R E
Sbjct: 947  EDLIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKE 1006

Query: 770  KLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMS 829
            K+ +V E +E+ L L+GATAIEDKLQEGV D I  ++ AGIK+W+LTGDK+ETAINIG S
Sbjct: 1007 KMHSVGELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYS 1066

Query: 830  CRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLS-FALE 888
            C L+ +   ++I+S     A   N+  KL A+ +  +   ++    +VIDG +L+ F   
Sbjct: 1067 CNLIHDYSTVVILS-----AKDENISSKLTAVSQE-IERGNIAHCVVVIDGSTLTTFESN 1120

Query: 889  ADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDVSMIQAAH 947
              L   F+ +     +VICCR SP QKAL+V  ++     L+ LAIGDGAND++MIQ+A 
Sbjct: 1121 PTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSAD 1180

Query: 948  VGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQ 1007
            +GVGI+G EG+QA+RS+D S+ QFRFL KLLLVHG ++Y R +  +L +FYK    Y+TQ
Sbjct: 1181 IGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQ 1240

Query: 1008 FWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKG 1067
              Y     FSG S+ E W++S++N  FT LP   IG+F++ +    L   P+LY +G+  
Sbjct: 1241 MIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLS 1300

Query: 1068 QFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIV 1127
            Q F++ +F  W+     +S ++   T L ++          T   +  G+  +T+ + +V
Sbjct: 1301 QSFNLRVFLYWMFLAALNSLII---TFLNWKIWAVSSLSDNTV--YPIGVINFTAIITLV 1355

Query: 1128 LGKAALV----TNQWTKFTLFAIPGSLFFWLIFFP-IYGSIFPYAKISREYFGVVEHTYG 1182
              K  L+     N     +L    G    W    P IY     Y  ++  YF      +G
Sbjct: 1356 NVKCQLLETHNRNVLAICSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYF-----QFG 1410

Query: 1183 S-ATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQK 1224
            +  TFW   +VL    L  D ++K  K M  P    +  E+++
Sbjct: 1411 NDITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELEQ 1453

 Score =  255 bits (651), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/449 (33%), Positives = 247/449 (55%), Gaps = 68/449 (15%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           YI N I++++Y   TFLP+ L+ +FS+ AN +F   + +Q +P  S T  YTTI  L++ 
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 241 LIVSAIKESVEDLKR----------------------------------------ASSDN 260
           + +S  +E+ +D +R                                        A+S +
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 261 ELNNSKAEIYFEAEG------------------DFIQKRWIDIKVGDIIRVNSEEPIPAD 302
            L N   E   EA                    + ++K+W DIKVGD + +  +E +PAD
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 303 IIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE-LRNIKGVISSEQPNSS 361
           +++L+ S+ +  C++ET  LDGETNLK KQ  TE +++M +   L   K  ++ E PN  
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNID 347

Query: 362 LYTYEGTLEMNG--TKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATP-I 418
           L+ +EG LE+ G   K+ + P+ +I RG+ +RNT    G+V+FTG ETK+  NA   P I
Sbjct: 348 LHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRI 407

Query: 419 KRTAVEKVINMQIIALFTVLVVLILISSIGNVIMST--ADAKHLSYLYLQGTNKAGLFFK 476
           K   +++ IN+ ++ +  V+  + L S +G  I+     D     YL+    + AGL   
Sbjct: 408 KAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLF---NSDAGLA-P 463

Query: 477 DFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQ 536
             ++F I+++ L+P+SL+VT+E+IK  Q+ ++  D+D+Y+ ET+TP   +T++++EELGQ
Sbjct: 464 TVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQ 523

Query: 537 IEYIFSDKTGTLTRNIMEFKSCSIAGRCY 565
           + YIFSDKTGTLT N M F++ S+ G  +
Sbjct: 524 VSYIFSDKTGTLTDNKMVFRALSVCGSSW 552

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 84/169 (49%), Gaps = 17/169 (10%)

Query: 559 SIAGR-CYAEHIPEDKAATFEDGIEVGYRSFDDLKK--QLTTNSDDCKIIDEFLTLLATC 615
           S+A R C  +  P  K    E   + G RS  +L +  Q   N+   K +  F+  LA C
Sbjct: 618 SMASRICEEDKNP--KKIEPEKSSKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALC 675

Query: 616 HTVIPE----FQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTI------LINE 665
           H  +P+     + +  ++YQA+SPD            Y  + R  + +TI         E
Sbjct: 676 HACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAE 735

Query: 666 EEEREYQLLNICEFNSTRKRMSAIFRFP--DDSIKLLCKGADSVILERL 712
               +Y++LN  EF+S RKRMS + R P  ++ I L+CKGAD+VILERL
Sbjct: 736 PHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVILERL 784

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  331 bits (849), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 194/540 (35%), Positives = 299/540 (55%), Gaps = 29/540 (5%)

Query: 703  GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAAT 762
            G+D +IL        + ++ T + +++++TEGLRTL  A K I   +Y  WNK+Y  A T
Sbjct: 1006 GSDELILNE-----EYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKT 1060

Query: 763  TLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQET 822
            +L  R  K+D    EIE GL L+G TAIEDKLQ+GV + I  ++ AGIK+W+LTGDK+ET
Sbjct: 1061 SLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRET 1120

Query: 823  AINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHS 882
            AINIG SC L+ +   ++I++      T  N+  K+ A+ +  +   ++    +VIDG +
Sbjct: 1121 AINIGYSCMLIKDYSTVVILT-----TTDENIISKMNAVSQE-VDSGNIAHCVVVIDGAT 1174

Query: 883  LS-FALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDV 940
            ++ F         F+ +     +VICCR SP QKAL+V  ++    +L+ LAIGDGAND+
Sbjct: 1175 MAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDI 1234

Query: 941  SMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKN 1000
            +MIQ+A +GVGI+G EG+QA+R +D S+GQFRFL KLL VHG ++Y R S  +L +FYK 
Sbjct: 1235 AMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKE 1294

Query: 1001 TALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQL 1060
               Y TQ  Y     FSG S+ E W++S++N  FT LP   IG+F++ +    L   P+L
Sbjct: 1295 ITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPEL 1354

Query: 1061 YKLGQKGQFFSVSIFWGWIVNGFYHSAVV-FVGTILFYRYGFALRKHGETADHWSWGIAI 1119
            Y  G+  Q F+  IF  W++    +S ++ F+  +++     +          +  G+  
Sbjct: 1355 YSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLS------DNTMYPLGLIN 1408

Query: 1120 YTSSVIIVLGKAALV---TNQWTKFTLFAIP-GSLFFWLIFFPIYGSIFPYAKISREYFG 1175
            +T+ V ++  K+  V      W  FT   +  G    W    PI  +     +I    +G
Sbjct: 1409 FTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNT---DQIYDVAYG 1465

Query: 1176 VVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQ 1235
               H     TFW T +VL    +T D ++K +K M  P    +  E+++   SD R  ++
Sbjct: 1466 FYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQK--SDIRKKLE 1523

 Score =  254 bits (648), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/489 (32%), Positives = 251/489 (51%), Gaps = 76/489 (15%)

Query: 151 LLRKNTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYAN 210
           +L  N  + + +   R+ H+ D   N    Y DN I++++Y   +FLP+ L+ +FSK AN
Sbjct: 110 ILDHNAIEYKQAATKRDGHLIDERFNK--PYCDNRITSSRYTFYSFLPRQLYAQFSKLAN 167

Query: 211 LFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELN------- 263
            +F   + +Q +P  S T  YTTI  L V + +S  +E+ +D +R   D E N       
Sbjct: 168 TYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVL 227

Query: 264 -----NSKAEIYF-----------------------------EAEGDFI----------- 278
                N   E+Y                               ++G F+           
Sbjct: 228 VKDGNNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLK 287

Query: 279 --------QKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKI 330
                   QK+W  ++VGD + +  ++ +PAD+++L+       C++ET  LDGETNLK 
Sbjct: 288 NKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKS 347

Query: 331 KQARTETAKIMDSRE-LRNIKGVISSEQPNSSLYTYEGTLEMNG------TKIPLSPEQM 383
           KQ   E  K+  +   L NI   ++ E PN  LY +EG LE+         K PL P+ +
Sbjct: 348 KQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNV 407

Query: 384 ILRGATLRNTGWIFGIVIFTGHETKLMRNATATP-IKRTAVEKVINMQIIALFTVLVVLI 442
           I RG+ LRNT  + G+VIF+G ETK+  NA   P  K   +++ INM I+ +  V+  + 
Sbjct: 408 IYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATIS 467

Query: 443 LISSIGNVIMSTA--DAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELI 500
           L S +G+V+      D     YL+      A       ++F I+++ ++P+SL+VT+E+I
Sbjct: 468 LFSYLGHVLHKKKYIDQNKAWYLFQADAGVA----PTIMSFIIMYNTVIPLSLYVTMEII 523

Query: 501 KYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSI 560
           K  Q+ M+  D+D+Y+ ET+TP   +T++++EELGQ+ YIFSDKTGTLT N M F+  S+
Sbjct: 524 KVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSL 583

Query: 561 AGRCYAEHI 569
            G  +  ++
Sbjct: 584 CGSSWLHNV 592

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 75/155 (48%), Gaps = 26/155 (16%)

Query: 608 FLTLLATCHTVIP-----EFQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTI- 661
           F   LA CH+ +P     E   + SI+YQ++SPD            Y  L R    +TI 
Sbjct: 731 FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIK 790

Query: 662 -----LINEEEEREYQLLNICEFNSTRKRMSAIFRFPD--DSIKLLCKGADSVILERLSE 714
                   E +   Y++LN  +FNS RKRMS + R P+  + + L+CKGAD+VI+ERL  
Sbjct: 791 TFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL-- 848

Query: 715 TGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDE 749
                      H  + A + +  +C +TK+  + E
Sbjct: 849 -----------HDRELAAKKMADICTSTKERKDAE 872

>Scas_669.3
          Length = 1638

 Score =  315 bits (807), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 198/594 (33%), Positives = 316/594 (53%), Gaps = 51/594 (8%)

Query: 703  GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAAT 762
            G+D ++L        + ++ T + +++++TEGLRTL  + K +   EY  W  +Y DA  
Sbjct: 980  GSDDLLL-----NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKI 1034

Query: 763  TLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQET 822
            +L +R  K+  V EEIE  L L+GATAIEDKLQEGV + I  ++ AGIKIW+LTGDK+ET
Sbjct: 1035 SLTNRKSKIAEVGEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRET 1094

Query: 823  AINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHS 882
            AINIG SC+L+ +   ++I+++  +     N+  K+ A+ +  +   ++    ++IDG +
Sbjct: 1095 AINIGYSCKLIYDYSTVVILAKGDE-----NIISKMNAISQE-VDSGNVAHCVIIIDGST 1148

Query: 883  LS-FALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDV 940
            L+ F     L   F+ +     +VICCR SP QK+L+V  ++    +L+ LAIGDGAND+
Sbjct: 1149 LAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDI 1208

Query: 941  SMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKN 1000
            +MIQ+A +G+GI G EG+QA+R+AD S+ QFRF+ KLLLVHG ++Y R +  IL +F+K 
Sbjct: 1209 AMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKE 1268

Query: 1001 TALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQL 1060
               Y+TQ  +     FSG S+ E W++S++N  FT LP   IG+F++ +    L   P+L
Sbjct: 1269 ITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPEL 1328

Query: 1061 YKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETA--DH--WSWG 1116
            Y +G+  Q F++ IF  W++    ++ ++    I+ +         GETA  DH  +  G
Sbjct: 1329 YSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNIIIW---------GETALSDHTMYPLG 1379

Query: 1117 IAIYTSSVIIVLGKAALV---TNQWTKFTLFAIP-GSLFFWLIFFPIYGSIFPYAKISRE 1172
            +  +T+ V +V  K   +      W  FT   +  G    W    PI         +   
Sbjct: 1380 VINFTAIVALVNVKCQFIEMNNRNWVVFTSVILSCGGWLVWCCALPILNRSDVIYDVP-- 1437

Query: 1173 YFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQ------------ 1220
             +G   H     T+W +  VL    +T D +++ +K M  P    +              
Sbjct: 1438 -YGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQKSEIRKKL 1496

Query: 1221 EMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAE------EGQEKI 1268
            EM  YN        +H  NA ++ ++       R  +++  E      EG  K+
Sbjct: 1497 EMGAYNEMKQGWTWEHDPNAFKRYKEKILTAHSRSGSYTDEEMEIGTREGNPKV 1550

 Score =  253 bits (647), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/439 (34%), Positives = 239/439 (54%), Gaps = 58/439 (13%)

Query: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240
           Y +N+I++++Y   +F PK L+ +FSK AN++F   + +Q +P  S T  YTTI  L + 
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI------------------------------- 269
           + +S  +E+ +D +R   D E NN    I                               
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 270 -YFEAEGD---FIQKR---------WIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCY 316
            Y   + +   F+++R         W ++ VGD + +  +  +PADI++L+S      C+
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 317 IETANLDGETNLKIKQARTETAKIMDSRE-LRNIKGVISSEQPNSSLYTYEGTLEMNGT- 374
           +ET  LDGETNLK+KQ   E  K+  S   L NI  +I+ E PNS LY +EG LE+    
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 375 -----KIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATP-IKRTAVEKVIN 428
                K P+ P+ +  RG+ +RNT  + G+VI+TG ETK+  NA   P  K   ++K IN
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN 439

Query: 429 MQIIALFTVLVVLILISSIGNVIMSTA--DAKHLSYLYLQGTNKAGLFFKDFLTFWILFS 486
           + I  +  V+ V+ L S +G+V+ +    D     YL  +    A       ++F I+++
Sbjct: 440 IIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAA----PTIMSFIIMYN 495

Query: 487 NLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTG 546
            ++P+SL+VT+E+IK  Q+ M+  D+D+Y+ ET+TP   +T++++EELGQ+ Y+FSDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 547 TLTRNIMEFKSCSIAGRCY 565
           TLT N M F+  SI G  +
Sbjct: 556 TLTDNKMIFRKFSICGSSW 574

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 13/120 (10%)

Query: 608 FLTLLATCHTVIPE---FQADGS--IKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTIL 662
           F+  LA CHT +P+   F   G   I+YQ++SPD            Y  L +  + +TI 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 663 I------NEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK--LLCKGADSVILERLSE 714
                  NE    +YQ+LN  +FNS RKRMS + + PD+  K  L+CKGAD++ILERL +
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILERLQD 821

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  313 bits (801), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 288/516 (55%), Gaps = 26/516 (5%)

Query: 718  FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE 777
            + ++ T + ++ + TEGLRTL  + K I   EY  WN +Y  A   L +R E++D V E 
Sbjct: 936  YVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEI 995

Query: 778  IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDM 837
            IE  LTL+G   IEDKLQEGVPD I  L+ AGIK+W+LTGDK+ETAINIG SCRL+ +  
Sbjct: 996  IERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYS 1055

Query: 838  NLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLS-FALEADLEDYFL 896
             ++I++   +     NM  K+  + +  +   ++    +VIDG +L+ F     L   F+
Sbjct: 1056 TVIILAPNDE-----NMASKITTITQE-IEAGNVAHCVVVIDGATLTIFEGNLTLMTLFI 1109

Query: 897  AIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL-LAIGDGANDVSMIQAAHVGVGISGM 955
             +     +VICCR SP QKAL+V  +++    L+ LAIGDGAND++MIQ+A +GV I+G 
Sbjct: 1110 ELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGK 1169

Query: 956  EGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANA 1015
            EG+QA+RS+D S+ QFR+L KLLLVHG ++Y R S  +L +FYK    Y+TQ  +     
Sbjct: 1170 EGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTM 1229

Query: 1016 FSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIF 1075
            FSG S  E W ++++N  FT LP   IG+F++ + S  L   P+LY  G++ Q F++ IF
Sbjct: 1230 FSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIF 1289

Query: 1076 WGWIVNGFYHSAVVFVGTILFYRY-GFALRKHGETADHWSWGIAIYTSSVIIVLGKAALV 1134
              W+      S +     I F  +  ++L    +    +  G+  YT+ V++V  K  L+
Sbjct: 1290 LRWMAIAALSSVI-----ICFTNWQCWSLTAQSDNT-LYPIGLINYTAVVVLVNVKCQLL 1343

Query: 1135 ---TNQWTKFTLF--AIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYG-SATFWL 1188
                  W  F  F  ++ G L + L+   IY     Y      Y     H +G   TFW 
Sbjct: 1344 EMANRNWLAFASFFISVCGWLCWCLLLPAIYKETLVYDVREGLY-----HQFGPDITFWA 1398

Query: 1189 TLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQK 1224
            T +VL    +  D ++K  K +  P    +  E+++
Sbjct: 1399 TNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQ 1434

 Score =  235 bits (600), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/492 (32%), Positives = 254/492 (51%), Gaps = 49/492 (9%)

Query: 172 DRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRY 231
           DR S     YI N I++++Y+  +FLP+ L  +FSK  N +F   + +Q VP+ S T +Y
Sbjct: 103 DRRSG--LPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQY 160

Query: 232 TTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAE----GD----------- 276
           TTI  L + + +S  +E  ED +R   D E NN   ++  +A     GD           
Sbjct: 161 TTIVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAA 220

Query: 277 ---------------FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETAN 321
                           ++K+W D++VG+ + +N ++ +PAD+ +L++      CY+ET  
Sbjct: 221 SFTDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMA 280

Query: 322 LDGETNLKIKQARTETA-KIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNG-----TK 375
           LDGETNLK K    + A +   +  L   +G+ + E PN  LY +EG +E+         
Sbjct: 281 LDGETNLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQA 340

Query: 376 IPLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATP-IKRTAVEKVINMQIIAL 434
             +  + ++ RG+ +RNT  + G+V+FTG ETK+  NA   P IK   ++  IN+  I L
Sbjct: 341 YSIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINL--IVL 398

Query: 435 FTVLVVLIL-ISSIG-NVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPIS 492
           F +LVV I    S G        +       YL   + AGL     ++F I+++ L+P+S
Sbjct: 399 FMILVVAIFSFLSFGLQRFFKNREVDSDRAWYLMKVD-AGLA-PTIMSFIIMYNTLIPLS 456

Query: 493 LFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNI 552
           L+VT+E+IK  Q+ ++  D+D+Y+ ET+T    +T++++EELGQ+ YIFSDKTGTLT N 
Sbjct: 457 LYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNR 516

Query: 553 MEFKSCSIAGRCYAEHIP----EDKAATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEF 608
           M F+  S  G  +   +     E   +  +  +EV     +   K    NS D +   E+
Sbjct: 517 MIFRKFSFCGTAWEHDVARKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEY 576

Query: 609 LTLLATCHTVIP 620
             L +  +T  P
Sbjct: 577 KGLASATYTGRP 588

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 29/174 (16%)

Query: 608 FLTLLATCHTVIPEFQ--ADG----SIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTI 661
           F+  LA CHT +P+ +  AD     S++YQ++SPD            Y  L R  + +TI
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 662 LINEEE------EREYQLLNICEFNSTRKRMSAIFRFPD--DSIKLLCKGADSVILERLS 713
               +         +Y++LN  +F+S RKRMS + R     + + L+CKGAD+VILERL 
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNVILERL- 771

Query: 714 ETGNFYVDATTRHLEDYATEGLRTL--CLATKDIPEDEYNAWNKKYMDAATTLD 765
                       H  D A + L  +      + I E E    ++K ++ A T D
Sbjct: 772 ------------HNSDLAQQKLNEINTSAGQRKIEEAELVLQHRKSLEQAITRD 813

>Scas_89.1
          Length = 271

 Score =  159 bits (401), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 152/269 (56%), Gaps = 12/269 (4%)

Query: 750  YNAWNKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEA 808
            Y+ + K+Y DA+ ++ +  E + +V ++ +E  L L+G T +EDKLQ  V  +I  L+ A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 809  GIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSE 868
            G+KIW+LTGDK ETA  + +S +L+S    +  +++ ++       E  L AL    +++
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP------EGALNALEYLKINK 115

Query: 869  HDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNS 928
                   L+IDG SL   L    +++F  +  +  AVI CR +P QKA V  +++  T  
Sbjct: 116  SS----CLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGK 170

Query: 929  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQR 988
             +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD SV QF  L KLLL HG  SY+R
Sbjct: 171  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKR 230

Query: 989  ISVAILYSFYKNTALYMTQFWYVFANAFS 1017
             +    +  ++   + + Q  Y   +  S
Sbjct: 231  SAKLAQFVIHRGLIISVCQAVYSVCSKLS 259

>Scas_665.30
          Length = 1439

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 104/383 (27%), Positives = 169/383 (44%), Gaps = 65/383 (16%)

Query: 678  EFNSTRKRMSAIFRFPDDSIK-LLCKGADSVILE---RLSETGNFYVDATTRHLEDYATE 733
            EF S  +RMS I +  ++ +     KGA  VI +   + +   NF        L  Y  +
Sbjct: 709  EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANF-----EEMLNYYTHK 763

Query: 734  GLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDK 793
            G R +  A + +P    N W              ++K+    EE+ES +  +G    E+K
Sbjct: 764  GYRVIACAGRVLPR---NTW------------LYSQKVSR--EEVESNMEFLGFIIFENK 806

Query: 794  LQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRR- 852
            L++    T++TLQEA I+  + TGD   TAI++G  C L+ +   + + S E  ++T + 
Sbjct: 807  LKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPSLEEIDSTGQT 865

Query: 853  --------NMEEKLAA--LHEHSLSEHDMNTLALVIDGHSLSFALEAD--LEDYFLAIGK 900
                    NM++ L +  L   + S     TLA+  D   + F  E +   EDY   +  
Sbjct: 866  SIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTV-- 923

Query: 901  MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 960
            + K  I  R+SP +K  +++ ++R  N  +   GDGAND   ++AA VG+ +S  E   A
Sbjct: 924  LLKGTIYARMSPDEKHELMEQLQR-LNYTVGFCGDGANDCGALKAADVGISLSEAEASVA 982

Query: 961  A----RSADIS-------------VGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTAL 1003
            A    +  DIS             V  F   + + L       Q I++ +LYS   N   
Sbjct: 983  APFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAI---QFITITVLYSRGSNLGD 1039

Query: 1004 YMTQFWYVFANAFSGQSIMESWT 1026
            +  QF Y+        +I  SW+
Sbjct: 1040 F--QFLYIDLLLIVPIAIFMSWS 1060

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 151/741 (20%), Positives = 277/741 (37%), Gaps = 155/741 (20%)

Query: 284 DIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDS 343
           D+ VGD++ + + + +P D I++     EG C  + + + GE++   K +   + ++  +
Sbjct: 200 DLLVGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGESDTIKKVSLAMSLQVYRT 254

Query: 344 RELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFT 403
                    ++++ P++ + + +     NG    L P+ M++ G+ L  +G    +V   
Sbjct: 255 ---------VAADNPSADIGSSD-----NGHS--LVPDPMLISGSKLL-SGIGHAVVTAV 297

Query: 404 GHET---KLMRNATATPIKRTAVEKVINMQI--------IALFTVLVVLILISSIGNVIM 452
           G  +   K+M    + P + T +++ +N           +A F + VVL L         
Sbjct: 298 GPHSVHGKMMLALKSEP-ETTPLQERLNTLADDISIYGSVAAFLLFVVLFL--------- 347

Query: 453 STADAKHLSYLY-------LQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQA 505
                + LSYL        L    K   F   F+T   +    VP  L + V L   +  
Sbjct: 348 -----RFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFAT 402

Query: 506 FMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCY 565
             +  D +L          V+     E +G    + SDKTGTLT+N M        G  +
Sbjct: 403 TRMTKDGNL----------VRVLRACETMGSATTVCSDKTGTLTQNKMVVVK-GFLGSSH 451

Query: 566 AEHIPEDKAATFEDGI--EVGYRSFDDLKKQLTTNS---DDCKIIDEFLT---------- 610
            + I ED      D +  ++   + +D+   +  NS   ++ ++ D  +T          
Sbjct: 452 FDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRS 511

Query: 611 LLATCHTVIPEFQADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEERE 670
           L        P++ A      Q+A                K  +   +   +  +      
Sbjct: 512 LFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGI 571

Query: 671 YQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERL----SETGNFYVDATTRH 726
             ++ +  F S+RK    + R  D + +   KGA   I +      S   +    +  +H
Sbjct: 572 ASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKH 631

Query: 727 LE------DYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKL--------- 771
            E      + A++ LRT+ LA KD    + ++W    +  A+     +  L         
Sbjct: 632 GEIFGLINNLASDALRTISLAHKDF--TDISSWPPAELRDASDPSTASPDLLLGDEYVPT 689

Query: 772 ----DAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIG 827
                ++     SGL L G   I D L+ GV ++++  Q++G+ + ++TGD   T   I 
Sbjct: 690 ATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIA 749

Query: 828 MSCRLLSE----DMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSL 883
            +C +LSE    D    +     ++ +RR M +    L                      
Sbjct: 750 RACGILSESEYADHECAMEGPVFRKLSRRQMMDAAPKLK--------------------- 788

Query: 884 SFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMI 943
                                 +  R SP  K + V ++K K N ++   GDG ND   +
Sbjct: 789 ----------------------VLARSSPEDKRIFVDILK-KMNEVVAVTGDGTNDAPAL 825

Query: 944 QAAHVGVGISGMEGMQAARSA 964
             A VG  + G+ G   AR A
Sbjct: 826 TLADVGFSM-GISGTGVAREA 845

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 164/769 (21%), Positives = 300/769 (39%), Gaps = 128/769 (16%)

Query: 231  YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDI 290
            Y   G + ++ ++S I   +E  K +    ++++   E+    +  + Q    D+  GD+
Sbjct: 502  YYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDL 561

Query: 291  IRVNSEEPI--PADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRN 348
              ++    +  P D +++S     G C +  + L GE+    K A TE       ++ ++
Sbjct: 562  FEISDPSLVVLPCDAVLIS-----GDCIVNESMLTGESVPVSKYAATEATMAQLLQDFKS 616

Query: 349  IKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETK 408
             +  +SS    S L+        NGTKI        +R       G    +VI TG  T 
Sbjct: 617  SQ--VSSFVSKSFLF--------NGTKI--------IRVRNQPGQGMALALVIRTGFST- 657

Query: 409  LMRNATATPIKRTAVEKVINMQIIA-LFTVLVVLILISSIGNVIMSTADAKHLSYLYLQG 467
                   + ++     K +  +     F  +  + LI+  G  I        + ++ L G
Sbjct: 658  ----TKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISC------IQFIRL-G 706

Query: 468  TNKAGLFFKDFLTFWILFSNLVPISLFVTVEL----IKYYQAFMIGSDLDLYYEETDTPT 523
                 +  +      I+    +P +L +        +K    F I            +PT
Sbjct: 707  LEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCI------------SPT 754

Query: 524  VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583
             V         G+++ +  DKTGTLT   ++     + G  +A+  PE  +   +  +  
Sbjct: 755  RVNVG------GKVDMMCFDKTGTLTEEGLD-----VLGIHFAK--PEGSSTILQ--LSD 799

Query: 584  GYRSFDDLKKQLTTNSDDCKIIDEF-----LTLLATCHTVIPEFQADGSIKYQAASPDXX 638
                 D++ ++ T +  DC   +EF     L  L TCH++      DG +          
Sbjct: 800  LITDCDEVLQKHTLS--DCNSAEEFKAKNFLVSLLTCHSLK---HIDGELLGDPLDLKMF 854

Query: 639  XXXXXXXXXXY---KF-----------LIRKPNSVTILINEEEEREYQLLNICEFNSTRK 684
                      Y   KF            +  P S    I  + +    ++   EF S  +
Sbjct: 855  EFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELR 914

Query: 685  RMSAIFR-FPDDSIKLLCKGADSVILERLSETGNFYVDATTRH--LEDYATEGLRTLCLA 741
            RMS I + F +++     KGA  VI    ++  N        H  L  Y   G R +  A
Sbjct: 915  RMSVIVKGFKENTYWSFTKGAPEVI----ADICNPATIPKDFHELLHHYTHNGFRIIACA 970

Query: 742  TKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDT 801
             K +P+  +  +++K                   EE+E  L  +G    E+KL+      
Sbjct: 971  GKTLPKSSW-LYSQK----------------VSREEVEDNLEFLGFIVFENKLKSRTKAA 1013

Query: 802  IRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATR-----RNMEE 856
            ++ LQ A I+  + TGD   TA+++G    L+S +   +    +  E +R     R+++E
Sbjct: 1014 LKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDE 1073

Query: 857  KLAALHEHSLS----EHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSP 912
            + + L   +L          TLA+  D   + F  +  L D +++   M K  I  R+SP
Sbjct: 1074 EGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM-KGSIYARMSP 1132

Query: 913  LQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 961
             +K  +V+ +++   ++    GDGAND   ++AA++G+ +S  E   AA
Sbjct: 1133 DEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSEAEASVAA 1180

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 148/328 (45%), Gaps = 54/328 (16%)

Query: 650  KFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK-LLCKGADSVI 708
            KF+   PN++  +I     R +      EF S  +RMS I +  ++++     KGA  VI
Sbjct: 904  KFVQNDPNNILGII-----RSF------EFLSELRRMSVIVKPNNENVYWAYTKGAPEVI 952

Query: 709  LERLSET--GNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766
            ++  +     + Y D     L  Y   G R +  A K +P+   N W             
Sbjct: 953  IDICNPATLPSDYDDI----LNFYTHSGYRVIACAGKTLPK---NTW---------LYSQ 996

Query: 767  RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
            +  +     EE+ES +  +G    ++KL++    T+  L+ A I+  + TGD   TAI++
Sbjct: 997  KVRR-----EEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISV 1051

Query: 827  GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLAL-VIDGHSLSF 885
            G  C+L++ED  + + +    + T     + +   +E S +EH ++T  L  ID +S  +
Sbjct: 1052 GKECQLITED-RVYVPTVAYSDMTV----QPVIHWNEISNAEHILDTFTLQPIDDYSGPY 1106

Query: 886  ALEADLEDYFLAIGK------------MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAI 933
             L    E + +                + K  I  R+SP +K  +V+ +++   ++    
Sbjct: 1107 TLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFC- 1165

Query: 934  GDGANDVSMIQAAHVGVGISGMEGMQAA 961
            GDGAND   ++AA VG+ +S  E   AA
Sbjct: 1166 GDGANDCGALKAADVGISLSEAEASVAA 1193

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 535 GQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQ 594
           G+I+ +  DKTGTLT + ++     ++  C A        A+F D I   +  F     +
Sbjct: 761 GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATR----NKASFSDLISDTHDIFPKFSLK 814

Query: 595 LTTNSDDCKIIDEFLTLLATCHTV 618
             +N DD K  + FL  L TCH++
Sbjct: 815 DCSNPDDYKRRN-FLISLLTCHSL 837

>Scas_583.14*
          Length = 875

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 130/289 (44%), Gaps = 34/289 (11%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           + Q+L   +F+S  KR S++     D +    KGA   I ERL+     Y +      + 
Sbjct: 227 KLQILRRFQFSSALKRSSSVASH-KDKLFTAVKGAPETIRERLAVVPKNYDEI----YKS 281

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATA 789
           +   G R L LA+K +P    N  +K+  D    LD          +EIE+GLT  G   
Sbjct: 282 FTRSGSRVLALASKSLP----NLSSKQLDD----LDR---------DEIETGLTFNGFLV 324

Query: 790 IEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEA 849
               L+    +TI+ L E+  +  ++TGD   TA+++     +++ +  +L  SE   + 
Sbjct: 325 FHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDG 384

Query: 850 TRR--NMEEKLAALHEHSLSEHDMNTL----ALVIDGHSLSFALEADLEDYFLAIGKMCK 903
                N+EE +    + +  + D   L     + + G++L+      LED+      +  
Sbjct: 385 KLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNL-----LEDHSQLKDLIRH 439

Query: 904 AVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952
             +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 440 TWVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVAL 487

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 167/773 (21%), Positives = 280/773 (36%), Gaps = 139/773 (17%)

Query: 237  LMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVN-- 294
            + ++ ++S I   VE  + +   +EL+    ++    +G + Q    D+  GDI  +   
Sbjct: 509  IFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDP 568

Query: 295  SEEPIPADIIILSSSEPEGLCYIETANLDGETNL--KIKQARTETAKIMDSRELRNIKGV 352
            S   +P D I++S     G C +  + L GE+    K+   R    +++D      +   
Sbjct: 569  SLSLLPCDSILIS-----GDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623

Query: 353  ISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET---KL 409
            +S             +   NGTK+        +R           G+V  TG  T    L
Sbjct: 624  VSK------------SFLFNGTKL--------IRVRATAGQSIALGMVARTGFSTTKGSL 663

Query: 410  MRN-----ATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464
            +R+      T       + + +  + IIALF   V  I                   +L 
Sbjct: 664  VRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFI------------------QFLR 705

Query: 465  LQGTNKAGLFFKDFLTFWILFSNLVPISLFV----TVELIKYYQAFMIGSDLDLYYEETD 520
            L G +K  +  +      ++    +P SL +     +  +K    F I            
Sbjct: 706  L-GLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCI------------ 752

Query: 521  TPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDG 580
            +PT V         G+I+ +  DKTGTLT + ++     +      E          +D 
Sbjct: 753  SPTRVNVG------GKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDL 806

Query: 581  IEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHT---VIPEFQAD------------ 625
            ++        L      ++ D K    FL  L TCH+   V  E   D            
Sbjct: 807  LQ-------SLSLSDCVSTRDMKA-KNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKW 858

Query: 626  ------GSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEF 679
                  G+ K  +   +            +   I  P+     I  E      ++   EF
Sbjct: 859  SDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEF 918

Query: 680  NSTRKRMSAIFR-FPDDSIKLLCKGADSVILERLS-ETGNFYVDATTRHLEDYATEGLRT 737
             S  +RMS I + F ++      KGA  VI E  S +T     +A   H   Y   G R 
Sbjct: 919  LSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHH---YTHNGYRV 975

Query: 738  LCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEG 797
            +  A K +    +  +++K                   EEIES L  +G    E+KL+  
Sbjct: 976  IACAGKKLTRQSW-LYSQK----------------VSREEIESNLEFLGFIIFENKLKGT 1018

Query: 798  VPDTIRTLQEAGIKIWVLTGDKQETAINIGM------SCRLLSEDMNLLIISEETKEATR 851
              +T+ +L  A I+  + TGD   TAI++G       S R+    +N +  S+E    T 
Sbjct: 1019 TKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITW 1078

Query: 852  RNMEEKLAALHEHSLS--EHDMNTLALVIDGHSLSFALEADLEDYFLAIGK-MCKAVICC 908
            +N+      L   +L     D +   L + G       + D       I   + K  I  
Sbjct: 1079 QNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYA 1138

Query: 909  RVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 961
            R+SP +K  +V+ ++     +    GDGAND   ++AA +G+ +S  E   AA
Sbjct: 1139 RMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAEASVAA 1190

>Kwal_26.9207
          Length = 1469

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 195/489 (39%), Gaps = 99/489 (20%)

Query: 522  PTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGI 581
            PT V  S      G+I+ +  DKTGTLT + ++     +A     ++       T   G+
Sbjct: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGL 825

Query: 582  EVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHT---VIPEFQADG------------ 626
               Y S +D    +   S +      FL  L TCH+   V  E   D             
Sbjct: 826  FNKY-SLNDCGSPIDFKSRN------FLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWS 878

Query: 627  ------SIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNIC--- 677
                    K+ + + +                +  PN+ +      E   + LL +    
Sbjct: 879  YAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSF 938

Query: 678  EFNSTRKRMSAIFR-FPDDSIKLLCKGADSVILERLSET---GNFYVDATTRHLEDYATE 733
            EF S  +RMS I + + ++      KGA  VI E  +++    N+      + L+ Y   
Sbjct: 939  EFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANY-----EQILQQYTHN 993

Query: 734  GLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDK 793
            G R +  A K +P+     W              A+K+    EE+ES +  +G    E+K
Sbjct: 994  GYRVIACAGKTLPK---RTW------------RFAQKVSR--EEVESNMEFLGFVVFENK 1036

Query: 794  LQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRN 853
            L+     T+ +LQ+AGI+  + TGD   TAI++G    L++E       S         N
Sbjct: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITE-------SHVFVPQINDN 1089

Query: 854  MEEKLAALHEHSLSEHDMNTLALVIDGHSL---------SFALEADL------------E 892
            M+      +E  +   D++   L++DG +L         + A+  D+            E
Sbjct: 1090 MDP-----NEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPE 1144

Query: 893  DYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952
             Y   +  + K+ I  R+SP +K  +V  ++   + ++   GDGAND   ++AA VGV +
Sbjct: 1145 SYINMV--LLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVGVSL 1201

Query: 953  SGMEGMQAA 961
            S  E   AA
Sbjct: 1202 SEAEASVAA 1210

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 152/711 (21%), Positives = 278/711 (39%), Gaps = 141/711 (19%)

Query: 277 FIQKRWIDIKVG--------DIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNL 328
           F   +W++++           I R   +  IP D++++     +G C +  A L GE+  
Sbjct: 258 FRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLI-----DGSCIVNEAMLSGESTP 312

Query: 329 KIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGA 388
            +K    E+ K+  + +   + GV      N+ L+     L++       +PE     G 
Sbjct: 313 LLK----ESIKLRPANDQLQLDGV----DKNAVLHGGTKALQVT------APENRT--GV 356

Query: 389 TLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIG 448
                G    +V  TG ET      +   +   + E+V      AL+ +L +LI      
Sbjct: 357 ITPPDGGALAVVTKTGFETS---QGSLVRVMIFSAERVDVGNKEALYFILFLLIF----- 408

Query: 449 NVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMI 508
             I+++       Y++ +GT    +  K  L   ++ +++VP  L   +EL     + + 
Sbjct: 409 -AIVASW------YVWKEGTRMGRIQSKLILDCILIITSVVPPEL--PMELTMAVNSSL- 458

Query: 509 GSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEH 568
            + L  +Y     P  +  +      G+I+    DKTGTLT                AE 
Sbjct: 459 -AALSKFYVYCTEPFRIPYA------GRIDVCCFDKTGTLT----------------AED 495

Query: 569 IPEDKAATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSI 628
           +  +  A   DG ++         + L + +D  +   E L+ +   H ++     DG I
Sbjct: 496 LVFEGLAGLHDGSDI---------RTLKSANDASQ---EVLSAIGAAHALVK--LDDGEI 541

Query: 629 KYQAASP-DXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMS 687
                 P +            +K ++++  +  I I     R +Q      F+S+ KR +
Sbjct: 542 ---VGDPMEKATLKASSWTVDFKDVVKRAGADNIRI----LRRFQ------FSSSLKRSA 588

Query: 688 AIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPE 747
           +I     +      KGA   I ERL+   + Y D      + +   G R L LA KD+P+
Sbjct: 589 SIAS-QSNRFFAAVKGAPETIRERLNSVPSDYDDI----YKSFTRSGSRVLALAYKDLPK 643

Query: 748 DEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQE 807
                            + + + +D   +EIE+GLT          L++   +TI+ L E
Sbjct: 644 MS---------------NSQIDNIDR--DEIETGLTFGAFLVFHCPLKDDAIETIKMLNE 686

Query: 808 AGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATR----RNMEEKLAALHE 863
           +  +  ++TGD   TA+++     ++  D   LI+ E    ++     R++ E +     
Sbjct: 687 SSHRSIMITGDNPLTAVHVAKEVGIV--DRETLILDEPIDGSSHALVMRDVNETIVKPFN 744

Query: 864 HSLSEHDMNTL----ALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVV 919
                 D   +     L + GH+L       L+ +      +    I  RVSP QK  ++
Sbjct: 745 PDADTFDEKEIFQKYDLAVTGHALKL-----LQGHKQLRDVIRHTWIYARVSPSQKEFIL 799

Query: 920 KMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAARSAD 965
             +K      L+  GDG NDV  ++ AHVG+ +       ++ +Q  R  D
Sbjct: 800 ITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEDSLKKLQEQRKID 849

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 137/305 (44%), Gaps = 45/305 (14%)

Query: 678  EFNSTRKRMSAIFRFPDDSIKL-LCKGADSVILERLSETGNFYVDATTRHLEDYATEGLR 736
            EF S  +RMS I +  +D +     KGA  VI E +        D     L  Y   G R
Sbjct: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISE-ICNKSTLPADFE-EVLRCYTHNGYR 990

Query: 737  TLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQE 796
             +  A K +P+  +  +++K                   EE+ES L  +G    ++KL++
Sbjct: 991  VIACAGKTLPKRTW-LYSQK----------------VSREEVESNLEFLGFIIFQNKLKK 1033

Query: 797  GVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLS---------EDMNL----LIIS 843
               +T+++LQ+A I+  + TGD   TAI++G    L+           D  L    +I+ 
Sbjct: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093

Query: 844  EETKEA-----TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADL-EDYFLA 897
             +  E      T+     KL      SL E +  TLA+  D   L F  E ++ E+Y   
Sbjct: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECNY-TLAVSGDVFRLLFRDENEIPEEYLNE 1152

Query: 898  IGKMCKAVICCRVSPLQK-ALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGME 956
            I  +  + I  R+SP +K  L++++  +K +  +   GDGAND   ++AA VG+ +S  E
Sbjct: 1153 I--LLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208

Query: 957  GMQAA 961
               AA
Sbjct: 1209 ASVAA 1213

>Kwal_47.17547
          Length = 1240

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 127/317 (40%), Gaps = 69/317 (21%)

Query: 672 QLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILER----------LSETGNFYVD 721
           +++ I  F S+RK    + ++ +   +   KGA  ++L R          L+       D
Sbjct: 585 KIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFD 644

Query: 722 ATTRHLEDYATEGLRTLCLATKDIP--------------EDEYNAWNKKYMDAATTLDHR 767
             ++ + + A E LR + LA +D P              E E  + +  + D  +    R
Sbjct: 645 EESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVS----R 700

Query: 768 AEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIG 827
           ++ +   A+E+ S + L G   I+D L++GV  ++   Q+AG+ + ++TGD   TA  I 
Sbjct: 701 SDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIA 760

Query: 828 MSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFAL 887
             C +LSE+                N E  +       LS  +                 
Sbjct: 761 KKCSILSEEQ-------------AENPESSMEGPRFRKLSNKER---------------- 791

Query: 888 EADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAH 947
                     +  +    +  R SP  K ++V+ +K K   ++   GDG ND   ++ A 
Sbjct: 792 ----------VRILPNLRVLARSSPEDKRILVETLK-KMGDVVAVTGDGTNDAPALKLAD 840

Query: 948 VGVGISGMEGMQAARSA 964
           VG  + G+ G + AR A
Sbjct: 841 VGFSM-GIAGTEVAREA 856

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 81/376 (21%), Positives = 147/376 (39%), Gaps = 56/376 (14%)

Query: 237 LMVVLIVSAIKESVEDLKRASSDNELNNSK--AEIYFEAEGDFIQKRWIDIKVGDIIRVN 294
           +M+ ++V  +  S  D ++    ++LN+ K   E+     GD       DI VGDI+ + 
Sbjct: 154 IMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDILSLQ 213

Query: 295 SEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVIS 354
           + + +PAD I++     +G C  + + L GE+   IK+A  +                  
Sbjct: 214 TGDVVPADCILV-----KGSCECDESALTGES-ATIKKAAIDVCY--------------- 252

Query: 355 SEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTG----HETKLM 410
             +    L   +  +++        P+ M++ G+ L  +G    +V   G    H   LM
Sbjct: 253 --EKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLL-SGLGRAVVTSVGVNSMHGRTLM 309

Query: 411 R---NATATPIKR--TAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY- 464
                A  TP++    ++   I++   A   +L  ++ +  + N+       K    L+ 
Sbjct: 310 ALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANL-------KKGGELHD 362

Query: 465 LQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTV 524
           L    K   F   F+    +    VP  L + V L   +    +  D +L          
Sbjct: 363 LTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNL---------- 412

Query: 525 VKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCY--AEHIPEDKAATFEDGIE 582
           V+     E +G    + SDKTGTLT N M      +    +  AE +    + T  D + 
Sbjct: 413 VRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVD-LA 471

Query: 583 VGYRSFDDLKKQLTTN 598
           +     ++LKK + TN
Sbjct: 472 IANECSEELKKDVLTN 487

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 150/687 (21%), Positives = 263/687 (38%), Gaps = 131/687 (19%)

Query: 281 RWIDIK--------VGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332
           +W++++        V  ++R   +  +P D+I++     +G C +  A L GE+   +K 
Sbjct: 261 KWVEMQTNELLPMDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPLLK- 314

Query: 333 ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRN 392
              E+ ++    E   I+G       +      + T      K+P  P+           
Sbjct: 315 ---ESIRLRPGNEELQIEGTDKISVLHGGTKVLQVTTPEKTGKVPSPPD----------- 360

Query: 393 TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452
            G    IV  TG ET      +   +   + E+V      AL+ +L +LI       V+ 
Sbjct: 361 -GGAIAIVTKTGFETS---QGSLVRVMIYSSERVGVDNKEALYFILFLLIFA-----VVA 411

Query: 453 STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDL 512
           S        Y++++GT    +  K  L   ++ +++VP  L   +EL     + +  S L
Sbjct: 412 SW-------YVWVEGTKMGRVQSKLILDCILIITSVVPPEL--PMELTMAVNSSL--SAL 460

Query: 513 DLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPED 572
             +Y     P  +  +      G+I+    DKTGTLT   + F+     G       P+D
Sbjct: 461 SKFYVYCTEPFRIPFA------GRIDVCCFDKTGTLTGEDLVFE-----GLAGLSSDPKD 509

Query: 573 KAATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQA 632
               +                    ++ DC   +    ++   H ++     DG I    
Sbjct: 510 IRHLY--------------------SATDCP--NSTSLVVGAAHALVR--LEDGEIVGDP 545

Query: 633 ASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRF 692
                            K    K   VTIL      R +Q      F+S  KR S++   
Sbjct: 546 MEKATLKALKWTVEKGDKVFNEKNGQVTIL------RRFQ------FSSALKRSSSVATH 593

Query: 693 PDDSIKLLCKGADSVILERLSETGNFYVDATTRHL-EDYATEGLRTLCLATKDIPEDEYN 751
            D  +    KGA   I ERL     F + A    + + +   G R L LA+K + +    
Sbjct: 594 -DGKLYSAVKGAPETIRERL-----FTIPANYDEIYKSFTRSGSRVLALASKKLEKMS-- 645

Query: 752 AWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIK 811
                          +++  DA  E  E  L   G       L+    +TI+ L E+  +
Sbjct: 646 ---------------QSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHR 690

Query: 812 IWVLTGDKQETAINIGMSCRLLSEDMNL--LIISEETKEATRRNMEEKLA---ALHEHSL 866
             ++TGD   TA+++     ++  +  +  ++ +    +   RN+EE L+    + + S 
Sbjct: 691 CVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSF 750

Query: 867 SEHDM-NTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRK 925
            ++ + +   L + GH    ALEA L+ +      +  A I  RVSP QK  ++  +K  
Sbjct: 751 EKYGIFDKYDLAVTGH----ALEA-LKGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDM 805

Query: 926 TNSLLLAIGDGANDVSMIQAAHVGVGI 952
               L+  GDG NDV  ++ AHVGV +
Sbjct: 806 GYQTLMC-GDGTNDVGALKQAHVGVAL 831

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 126/308 (40%), Gaps = 60/308 (19%)

Query: 672 QLLNICEFNSTRKRMSAIFRFPDD-SIKLLCKGADSVILERLSETGNF----------YV 720
           +++ +  F S+RK  +   +  D+   +   KGA  ++L+  S   N             
Sbjct: 631 KVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLY 690

Query: 721 DATTRHLEDYATEGLRTLCLATKDI----PEDEYNAWNKKYMDAATTLDHRAEKLDAVAE 776
           D + + ++D A+  LRT+ L  +D     P++  ++ +         + H  +  +  +E
Sbjct: 691 DESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSE 750

Query: 777 EIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSED 836
               G+TL     ++D L+EGV +++   Q AG+ + ++TGD   TA  I  +C +LSE+
Sbjct: 751 ----GMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEE 806

Query: 837 MNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFL 896
                              +   A+   +  +     +  VI                  
Sbjct: 807 ----------------GYNDPECAMEGPTFRKLPYKKMLRVIP----------------- 833

Query: 897 AIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGME 956
                 K  +  R SP  K ++V+ +K K   ++   GDG ND   ++ A VG  + G+ 
Sbjct: 834 ------KLRVLARSSPEDKRILVETLK-KMGEVVAVTGDGTNDAPALKLADVGFSM-GIS 885

Query: 957 GMQAARSA 964
           G + AR A
Sbjct: 886 GTEVAREA 893

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 111/277 (40%), Gaps = 44/277 (15%)

Query: 284 DIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDS 343
           D+ VGD+I + + + +PAD +++S     G C  + + L GE++  IK+   + A     
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESD-TIKKVALKPA----- 304

Query: 344 RELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFT 403
             L   K +   + P   + ++ G     G K+   P+ +++ G+ L  +G    ++   
Sbjct: 305 --LEKYKQIFEKD-PTIDIGSH-GV----GEKV---PDPLLISGSKLL-SGIGNAVITSV 352

Query: 404 GHET-------KLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTAD 456
           G  +        L   + +TP++        N+ I      LV+ I++     +   T  
Sbjct: 353 GENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILF----IRFLTYL 408

Query: 457 AKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYY 516
                Y  L    K   F   F+T   +    VP  L + V L   +    +  D +L  
Sbjct: 409 PNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL-- 466

Query: 517 EETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
                   V+     E +G    I SDKTGTLT N M
Sbjct: 467 --------VRVLRACETMGSATAICSDKTGTLTENRM 495

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 104/451 (23%), Positives = 176/451 (39%), Gaps = 87/451 (19%)

Query: 679  FNSTRKRMSAIFRFPD-DSIKLLCKGADSVILE-------RLSETGNFYVDATT----RH 726
            F+ST KRMS+++   D  + ++  KGA   +L        R   T     DA       +
Sbjct: 532  FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKEN 591

Query: 727  LEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE---IESGLT 783
            ++  ++EGLR L  A K  P+ + N                 EKL  + +E    E+GLT
Sbjct: 592  IDSMSSEGLRVLAFANKSYPKSDVNE----------------EKLQKILKERDYAETGLT 635

Query: 784  LIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIIS 843
             +G   I D  +E     ++   +AGI + +LTGD   TA  I     +L    NL   S
Sbjct: 636  FLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP--TNLYHYS 693

Query: 844  EETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCK 903
            +E  +         +      +LSE +++ L ++                          
Sbjct: 694  KEVVDIM------VMTGKQFDNLSEDEIDNLPVL-------------------------- 721

Query: 904  AVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 963
             ++  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 722  PLVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKD 779

Query: 964  A-DISVGQFRFLKKLLLV-HGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSI 1021
            A DI +    F   L  V  G      I   +L    +N A      + +   AF  +  
Sbjct: 780  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLIVGLAFQDKEG 836

Query: 1022 MESWTMSLYNVFFTVL-----PPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFW 1076
               + ++   V + ++     P   +G+  +     L++R P   K G     F+  I  
Sbjct: 837  KSVFPLAPVEVLWIIVVTSCFPAMGLGL--EKAAHDLMDRPPNDSKAG----IFTWEIIV 890

Query: 1077 GWIVNGFYHSAVVFVGTILFYRYGFALRKHG 1107
               V G + +A   + T +   YG   R HG
Sbjct: 891  DMFVYGVWMAASC-MATFVTIIYG---RDHG 917

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 126/279 (45%), Gaps = 30/279 (10%)

Query: 678 EFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRT 737
           +F+S  KR ++I    +D++    KGA   I ERLS+    Y +      + +   G R 
Sbjct: 581 QFSSALKRSASIASH-NDALFAAVKGAPETIRERLSDIPKNYDEI----YKSFTRSGSRV 635

Query: 738 LCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEG 797
           L LA+K +P+      ++  +D            D   +++ES LT  G       L++ 
Sbjct: 636 LALASKSLPK-----MSQSKID------------DLNRDDVESELTFNGFLIFHCPLKDD 678

Query: 798 VPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETK----EATRRN 853
             +TI+ L E+  +  ++TGD   TA+++     ++  +   LI+    K    +   R+
Sbjct: 679 AIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGET--LILDRAGKSDDNQLLFRD 736

Query: 854 MEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPL 913
           +EE ++   + S    D + L    D     +AL A LE +      +    +  RVSP 
Sbjct: 737 VEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNA-LEGHSQLRDLLRHTWVYARVSPS 795

Query: 914 QKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952
           QK  ++  +K      L+  GDG NDV  ++ AHVG+ +
Sbjct: 796 QKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVGIAL 833

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 115/291 (39%), Gaps = 54/291 (18%)

Query: 277 FIQKRWIDIKVGDII--------RVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNL 328
           F  K+W+ ++  +++        R   E  IP D+I+L     +G   +  A L GE+  
Sbjct: 259 FRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILL-----DGSAIVNEAMLSGESTP 313

Query: 329 KIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGA 388
            +K    E+ K+  S +   + GV      +      + T   + + IP  P+       
Sbjct: 314 LLK----ESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIPPPPD------- 362

Query: 389 TLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIG 448
                G    IV  TG ET      +   +   + E+V      AL  +L +LI      
Sbjct: 363 -----GGALAIVTKTGFETS---QGSLVRVMIYSAERVSVDNKEALMFILFLLIF----- 409

Query: 449 NVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMI 508
            VI S        Y++++GT    +  K  L   ++ +++VP  L   +EL     + + 
Sbjct: 410 AVIASW-------YVWVEGTKMGRIQSKLILDCILIITSVVPPEL--PMELTMAVNSSL- 459

Query: 509 GSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCS 559
            + L  +Y     P  +  +      G+I+    DKTGTLT   + F+  +
Sbjct: 460 -AALAKFYVYCTEPFRIPFA------GRIDVCCFDKTGTLTGEDLVFEGLA 503

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 134/318 (42%), Gaps = 53/318 (16%)

Query: 663 INEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDA 722
           ++ E+  +  +L   +F+S  KR S I          + KGA   I ERLS+    Y   
Sbjct: 567 LSNEKVGDISILRRFQFSSALKRSSTIAVHNKQHYSAV-KGAPETIRERLSQVPTDY--- 622

Query: 723 TTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGL 782
             +  + +   G R L LA+K +P                    + EKL+   E +ES L
Sbjct: 623 -DQVYKSFTRAGSRVLALASKKLPSMSIK---------------QIEKLER--EAVESDL 664

Query: 783 TLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLII 842
              G       L++   +TI+ L E+  +  ++TGD   TA+++     ++  +   LI+
Sbjct: 665 EFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERET--LIL 722

Query: 843 SEETKEATR----RNMEEKLAA-------LHEHS--LSEHDMNTLALVIDGHSLSFALEA 889
            E    ++     RN+EE +           EHS   +++D     + + GH+L      
Sbjct: 723 DEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFAKYD-----IAVTGHALQL---- 773

Query: 890 DLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVG 949
            L  +      +    +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG
Sbjct: 774 -LSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVG 831

Query: 950 VGI-----SGMEGMQAAR 962
           + +      G++ +Q  R
Sbjct: 832 IALLNGTEEGLKKLQEQR 849

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 113/280 (40%), Gaps = 56/280 (20%)

Query: 290 IIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNI 349
           + R + +  +  D+I++     +G C +  A L GE+   +K    E+ K+  S E   +
Sbjct: 280 VTRTDEDSALSCDMILV-----DGTCIVNEAMLSGESTPLLK----ESVKLRSSEEKLQV 330

Query: 350 KGVISSEQPNSSLYTYEGTLEMNG-----TKIPLSPEQMILRGATLRNTGWIFGIVIFTG 404
           +G+      NS L+     L++       + IP  P+            G    +V  TG
Sbjct: 331 EGL----DKNSVLHGGTKVLQVTAPEKGSSSIPAPPD------------GGALAVVSKTG 374

Query: 405 HETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464
            ET          +   + E+V      AL+ +L +LI   +               Y++
Sbjct: 375 FETS---QGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAAS------------WYVW 419

Query: 465 LQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTV 524
           ++GT    +  K  L   ++ +++VP  L + + +     +  + S   +Y  E   P  
Sbjct: 420 VEGTRMGRVQSKLILDCILIITSVVPSELPMELTM-AVNNSLAVLSKFYVYCTE---PFR 475

Query: 525 VKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCS-IAGR 563
           +  +      G+I+    DKTGTLT   + F+  + +AG+
Sbjct: 476 IPLA------GRIDVCCFDKTGTLTGEDLVFEGLAGLAGK 509

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 129/301 (42%), Gaps = 65/301 (21%)

Query: 679 FNSTRKRMSAIFRFPDDSI----KLLCKGADSVILE-----------RLSETGNFYVDAT 723
           F+S+ KRMSAI++  +D      ++  KGA   +L+           + S      ++  
Sbjct: 524 FDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETI 583

Query: 724 TRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLT 783
            ++++  ++EGLR L  A K   E E+NA NK             +KL    + +E  LT
Sbjct: 584 QKNVDTLSSEGLRVLAFAKKSFNESEFNA-NK-------------DKLLKERDFVECKLT 629

Query: 784 LIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIIS 843
            +G   I D  ++     ++   +AGI + +LTGD   TA +I     +L  ++      
Sbjct: 630 FLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNL-----Y 684

Query: 844 EETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCK 903
              KE     +   +AA    +LS+ +++ L ++                          
Sbjct: 685 HYPKEVVNFMV---MAATDFDALSDQEIDDLRVL-------------------------- 715

Query: 904 AVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 963
            ++  R +P  K  +++ + R++    +  GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 716 PLVIARCAPQTKVRMIEALHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKD 773

Query: 964 A 964
           A
Sbjct: 774 A 774

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 124/309 (40%), Gaps = 61/309 (19%)

Query: 673 LLNICEFNSTRKRMSAIFRFPDDS------IKLLCKGADSVIL----------ERLSETG 716
           ++ I  F S+RK  + + +   +        +L  KGA  ++           E +SE  
Sbjct: 560 IVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEID 619

Query: 717 NFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYM-DAATTLDHRAEKLDAVA 775
               D     +   A + LR + LA  D    + N W  K + D   + +  A KL    
Sbjct: 620 QKSKDDIEEQIFSLAKDALRAISLAHMDF---DVNEWPPKELADPENSHEALAVKLIDPK 676

Query: 776 EEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSE 835
           +    GLTL     I+D L+E V +++   Q+AG+ + ++TGD   TA  I  +C +LS 
Sbjct: 677 KPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS 736

Query: 836 DMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYF 895
                                              +N  A  ++G +  F   +D E   
Sbjct: 737 ---------------------------------KSLNDSACAMEGPA--FRKLSDSERKR 761

Query: 896 LAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGM 955
           +    + K  +  R SP  K ++V+ +K +   ++   GDG ND   ++ A VG  + G+
Sbjct: 762 I----LPKLRVLARSSPEDKKILVRALK-EMGEVVAVTGDGTNDAPALKLADVGFSM-GI 815

Query: 956 EGMQAARSA 964
            G + AR A
Sbjct: 816 TGTEVAREA 824

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 113/288 (39%), Gaps = 61/288 (21%)

Query: 284 DIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDS 343
           ++ VGD++++ + + +PAD +++      G C  + + L GE+N   K    +  +   +
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVLV-----RGECETDESALTGESNTIKKLPLADALEYHSA 228

Query: 344 RELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFT 403
              R+I    +S    ++  +               P+ M++ G+ +  +G    IV   
Sbjct: 229 HGGRDIGDTSASGASGAADDSR-------------CPDCMLISGSRVL-SGLASAIVTNV 274

Query: 404 GHET-------KLMRNATATPIKRTAVEKVINMQI---IALFTVLVVLILISSIGNVIMS 453
           G  +        L  ++  TP++    +   N+ +   +A  T+ VVL            
Sbjct: 275 GVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLF----------- 323

Query: 454 TADAKHLSYLYLQG--------TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQA 505
              A++LSY+   G          K   F   F+T   +    VP  L + V L   +  
Sbjct: 324 ---ARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFAT 380

Query: 506 FMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
             +  D +L          V+     E +G    + SDKTGTLT NIM
Sbjct: 381 TRMTKDGNL----------VRVLRSCETMGSATAVCSDKTGTLTENIM 418

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 106/459 (23%), Positives = 171/459 (37%), Gaps = 135/459 (29%)

Query: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583
           +V+    VE LG +  I +DKTGTLT N M          C       D + T+E+ I  
Sbjct: 359 IVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLF----CL------DSSGTYENAISP 408

Query: 584 GYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXXX 643
              S      +   + +D K   E LT+   C+            KY             
Sbjct: 409 EEDS------EFDVHDNDVK---ETLTIANICNNA----------KYS------------ 437

Query: 644 XXXXXYKFLIRKPNSVTIL-----INEEEERE-YQLLNICEFNSTRKRMSAIFRFPDDSI 697
                +   I  P  V ++         ++R+ ++ +    FNS RK M+          
Sbjct: 438 ---EEHNLYIGNPTDVALIEVLTKFGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEH 494

Query: 698 KLLCKGADSVILERLSETGNFYVD--ATTRHLEDY------------ATEGLRTLCLATK 743
            L  KGA     ER+ +  ++Y+D     R  +++            A++GLRT+  A K
Sbjct: 495 VLYIKGA----FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFK 550

Query: 744 DIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIR 803
             P D  N                      ++E+  +GLT  G   + D  +  V  +I 
Sbjct: 551 --PTDSDNV---------------------ISEDDINGLTFTGLFGLADPPRPNVKASIE 587

Query: 804 TLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHE 863
            L   G+ I ++TGD   TA++I       +E + L +   E+   T     +K++ L E
Sbjct: 588 KLHRGGVHIIMITGDSVNTAVSI-------AEKIGLSVQDRESSVMTG----DKVSELTE 636

Query: 864 HSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVK 923
             LS+        VID                       K  I  R +P  K  +VK + 
Sbjct: 637 DELSK--------VID-----------------------KVNIFARATPENKLNIVKAL- 664

Query: 924 RKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 962
           RK   ++   GDG ND   ++ A +G+ + G+ G   A+
Sbjct: 665 RKRGDIVAMTGDGVNDAPALKLADIGIAM-GISGTDVAK 702

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (42%), Gaps = 46/242 (19%)

Query: 723 TTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGL 782
           T   +++ A++ LR + +A KD  E   ++W  + +    + +  A  LD +    + GL
Sbjct: 674 TDDEIKNLASDALRAISVAHKDFCE--CDSWPPEQLRDKDSPNIAA--LDLLFNS-QKGL 728

Query: 783 TLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLII 842
            L G   I+D L+ GV ++++  Q AG+ + ++TGD   TA  I  +C +LS D     I
Sbjct: 729 ILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTD-----I 783

Query: 843 SEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMC 902
           S E   A       KL   +E      ++  LA                           
Sbjct: 784 SSEAYSAMEGTEFRKLTK-NERIRILPNLRVLA--------------------------- 815

Query: 903 KAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 962
                 R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR
Sbjct: 816 ------RSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAR 867

Query: 963 SA 964
            A
Sbjct: 868 EA 869

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 134/324 (41%), Gaps = 39/324 (12%)

Query: 237 LMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSE 296
           + VV++VSA  +  ++L+ A  + +  N K  +    +   I      + VGD+I + + 
Sbjct: 164 VFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIH--HVLVGDVISLQTG 221

Query: 297 EPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSE 356
           + +PAD +++S     G C  + +++ GE+N           K      LR+ K   S +
Sbjct: 222 DVVPADCVMIS-----GKCEADESSITGESN--------TIQKFPVDNSLRDFKKFNSID 268

Query: 357 QPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHE-------TKL 409
             N S     G +  +G KI    + M++ G+ +  +G   G++   G         T L
Sbjct: 269 SHNHSKPLDIGDVNEDGNKIA---DCMLISGSRIL-SGLGRGVITSVGINSVYGQTMTSL 324

Query: 410 MRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQGTN 469
                +TP++    +   N+ +    + +++ +++ +     +   D +   +  L    
Sbjct: 325 NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGR---FHDLDPAQ 381

Query: 470 KAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSS 529
           K   F   F+T   +    VP  L + V L   +    +  D +L          V+   
Sbjct: 382 KGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNL----------VRVLR 431

Query: 530 LVEELGQIEYIFSDKTGTLTRNIM 553
             E +G    + SDKTGTLT N+M
Sbjct: 432 SCETMGSATAVCSDKTGTLTENVM 455

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 123/553 (22%), Positives = 204/553 (36%), Gaps = 120/553 (21%)

Query: 524  VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583
            +V+    VE LG +  I SDKTGTLT N M          C      ++   + E     
Sbjct: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKI----WCLGSMANKNNVLSLEAKSSG 413

Query: 584  GYRS-FDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXXXXX 642
            G      +LK  L   SDD K     L + + C+     F  +   KY     D      
Sbjct: 414  GLPGKLPNLKNYL---SDDVKAT---LRIGSICNNA--SFSHEHG-KYLGNPTDIALLEV 464

Query: 643  XXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK--LL 700
                   KF +      T  ++E             FNS RK M+     P +S K  + 
Sbjct: 465  LQ-----KFDLVDERPTTTRVDE-----------LTFNSKRKYMAVKVDSPANSGKHIIY 508

Query: 701  CKGADSVILER-------------LSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPE 747
             KGA   ILER             LS++    ++   + L   A+EGLRTL  A      
Sbjct: 509  VKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFA------ 559

Query: 748  DEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQE 807
             +      K M+ +T                   LT +G   ++D  +  V   I  L +
Sbjct: 560  -QLECSTNKPMNDSTI----------------QNLTFVGLIGMKDPPRSTVRPAIEELLQ 602

Query: 808  AGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLS 867
             G+ + ++TGD + TA+NI       +  + + +I+ E            ++ L    L 
Sbjct: 603  GGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGDRLD 643

Query: 868  EHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTN 927
            +   + LA VID H   FA                      R +P  K  +V+ ++++ +
Sbjct: 644  QMTDDQLAGVID-HVNIFA----------------------RATPEHKLNIVRALQKRGD 680

Query: 928  SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLV-HGAWSY 986
             ++   GDG ND   ++ A +GV +  M    A  ++D+ +    F   L  +  G   +
Sbjct: 681  -IVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 739

Query: 987  QRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFD 1046
              I   + +    + A          A AF  Q+ + +  +   N+     P   +GV  
Sbjct: 740  NNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV-- 794

Query: 1047 QFVNSRLLERYPQ 1059
            + V+  ++ + P+
Sbjct: 795  EPVDHEVMRKPPR 807

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 157/715 (21%), Positives = 257/715 (35%), Gaps = 216/715 (30%)

Query: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
           GD++     + IPADI I+ + +      I+ +NL GE     K ++T            
Sbjct: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGENEPVHKTSQT------------ 215

Query: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
            I+    ++QPNS               +P+S    I    TL   G   GIV+ TG  T
Sbjct: 216 -IEKSSFNDQPNSI--------------VPISERSCIAYMGTLVKEGHGKGIVVGTGTNT 260

Query: 408 ------KLMRN--ATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKH 459
                 ++M N     TP++ T  +   ++ +++     +V+ +I  +G           
Sbjct: 261 SFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSF----IVIGMICLVG----------- 305

Query: 460 LSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDL-YYEE 518
                +QG +            W+    +  IS+ + V  I      ++   L L     
Sbjct: 306 ----IIQGRS------------WL---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346

Query: 519 TDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGRCYAEHIPEDKA 574
                +V+    VE LG +  I SDKTGTLT N M      C  S++ +     + ++K 
Sbjct: 347 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406

Query: 575 ATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAAS 634
               +G         +LK  LT +      + E LT+   C+     F  + +I      
Sbjct: 407 TKNSNG---------NLKNYLTED------VRETLTIGNLCNNA--SFSQEHAI------ 443

Query: 635 PDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNI---------CEFNSTRKR 685
                             +  P  V +L   E+   +++ +I           FNS RK 
Sbjct: 444 -----------------FLGNPTDVALL---EQLANFEMPDIRNTVQKVQELPFNSKRKL 483

Query: 686 MSAIFRFP-DDSIKLLCKGADSVILERLSETGNFYVDATTRHLE---------------D 729
           M+     P D+   +  KGA     ER+ E    Y+ +  +  E                
Sbjct: 484 MATKILNPVDNKCTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATINECANS 539

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATA 789
            A+EGLR    A   +             D++T L           E++   LT  G   
Sbjct: 540 MASEGLRVFGFAKLTLS------------DSSTPL----------TEDLIKDLTFTGLIG 577

Query: 790 IEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEA 849
           + D  +  V   I  L + G+ I ++TGD + TA+NI                    K+ 
Sbjct: 578 MNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIA-------------------KQI 618

Query: 850 TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCR 909
               ++ KL+ L    L E   + LA VID H   FA                      R
Sbjct: 619 GIPVIDPKLSVLSGDKLDEMSDDQLANVID-HVNIFA----------------------R 655

Query: 910 VSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
            +P  K  +V+ + RK   ++   GDG ND   ++ + +GV + G  G   A+ A
Sbjct: 656 ATPEHKLNIVRAL-RKRGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 114/465 (24%), Positives = 176/465 (37%), Gaps = 139/465 (29%)

Query: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGRCYAEHIPEDKAATFED 579
           +V+    VE LG +  I SDKTGTLT N M      C  S+A +     + ++K      
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG---- 415

Query: 580 GIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDXXX 639
                     +LK  LT   DD K      TLL             G++   A+      
Sbjct: 416 ----------NLKNYLT---DDVKT-----TLLC------------GNLCNNAS------ 439

Query: 640 XXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNI---------CEFNSTRKRMSAIF 690
                     K+L   P  V +L   E+ ++++L ++           FNS RK M+   
Sbjct: 440 ----YSQEHAKYL-GNPTDVALL---EQLQKFELADVRSEYTKVKELSFNSKRKMMATKI 491

Query: 691 RFPDDSIKLLCKGADSVILER----LSETGNFYVDATTRHLED-------YATEGLRTLC 739
           +  +    L  KGA   IL++    L+E G      T  H E         A+EGLR L 
Sbjct: 492 QDNEKKTTLFIKGAFERILDKSSSYLTEKGKIE-KLTAGHRETIIDCANTLASEGLRVLA 550

Query: 740 LATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVP 799
            A             +   D+++ L           E+  S L   G   + D  +  V 
Sbjct: 551 FA------------KRAMTDSSSKL----------VEDDISDLVFTGLIGMNDPPRSSVK 588

Query: 800 DTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLA 859
             I    + GI I ++TGD + TA+NI       +  + + +I            + KL+
Sbjct: 589 FAIDQFLQGGIHIIMITGDSENTAVNI-------ARQIGIPVI------------DPKLS 629

Query: 860 ALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVV 919
            L    L+E   + LA VID H   FA                      R +P  K  +V
Sbjct: 630 VLSGDKLNEMTDDQLANVID-HVNIFA----------------------RATPEHKLNIV 666

Query: 920 KMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
           + ++R+ + + +  GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 667 RALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 31/120 (25%)

Query: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
           GD++R    + IPADI I+  ++      I+ +NL GET+   K  +        SR+  
Sbjct: 180 GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETDPVHKSYKAL------SRDSY 229

Query: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
           N       +QPNS               +P++    I    TL   G   GIV+ TG ET
Sbjct: 230 N-------DQPNSI--------------VPVAERTNIAYMGTLVKEGNGRGIVVGTGRET 268

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 127/318 (39%), Gaps = 69/318 (21%)

Query: 664 NEEEEREYQLLNICEF--NSTRKRMSAIF------------RFPDDSIKLLCK---GADS 706
           + E+    Q  +I EF  +ST KRMS+++            +   +SI   C    G D 
Sbjct: 520 HNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDG 579

Query: 707 VILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766
           V +  L++     V+   +++   + EGLR L  A+K   +D+ N             D 
Sbjct: 580 VKITPLTDCD---VETIRKNVYSLSNEGLRVLGFASKSFTKDQVN-------------DD 623

Query: 767 RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
           + + + +     ES L  +G   I D  +      ++   +AGI + +LTGD   TA  I
Sbjct: 624 QLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAI 683

Query: 827 GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886
                +L    NL   S+E  ++        +       LSE +++ L ++         
Sbjct: 684 AQEVGILP--TNLYHYSQEIVDSM------VMTGSQFDGLSEEEVDDLPVL--------- 726

Query: 887 LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946
                             ++  R SP  K  +++ + R+     +  GDG ND   ++ A
Sbjct: 727 -----------------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMA 768

Query: 947 HVGVGISGMEGMQAARSA 964
           +VG+ + G+ G   ++ A
Sbjct: 769 NVGIAM-GINGSDVSKEA 785

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 126/342 (36%), Gaps = 72/342 (21%)

Query: 231 YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNN---SKAEIYFEAEGDFIQKRWIDIKV 287
           + T G +  V+ V+ +   V++ K   + N L N     A +    + + I  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 288 GDIIRVNSEEPIPADIIILSSSE---PEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344
           GDI  V   + IPAD+ ++ +      E L   E+  +  + NL     + E   + D  
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206

Query: 345 ELR---------NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRG---ATLRN 392
            L            KG++     NS +     +L+ +   I   P +  L+    +T + 
Sbjct: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKV 266

Query: 393 TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452
           TG   G  + T    KL + A            V+   I  LF ++V+      +   + 
Sbjct: 267 TGAFLGTNVGTPLHRKLSKLA------------VLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 453 STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL-IKYYQAFMIGSD 511
             A    LS                          ++P SL V + + +    A M+  +
Sbjct: 315 IYAICVALS--------------------------MIPSSLVVVLTITMSVGAAVMVSRN 348

Query: 512 LDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
           +           +V+    +E LG +  I SDKTGTLT+  M
Sbjct: 349 V-----------IVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 127/318 (39%), Gaps = 69/318 (21%)

Query: 664 NEEEEREYQLLNICEF--NSTRKRMSAIF------------RFPDDSIKLLCK---GADS 706
           + E+    Q  +I EF  +ST KRMS+++            +   +SI   C    G D 
Sbjct: 520 HNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDG 579

Query: 707 VILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766
           V +  L++     V+   +++   + EGLR L  A+K   +D+ N             D 
Sbjct: 580 VKITPLTDCD---VETIRKNVYSLSNEGLRVLGFASKSFTKDQVN-------------DD 623

Query: 767 RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
           + + + +     ES L  +G   I D  +      ++   +AGI + +LTGD   TA  I
Sbjct: 624 QLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAI 683

Query: 827 GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886
                +L    NL   S+E  ++        +       LSE +++ L ++         
Sbjct: 684 AQEVGILP--TNLYHYSQEIVDSM------VMTGSQFDGLSEEEVDDLPVL--------- 726

Query: 887 LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946
                             ++  R SP  K  +++ + R+     +  GDG ND   ++ A
Sbjct: 727 -----------------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMA 768

Query: 947 HVGVGISGMEGMQAARSA 964
           +VG+ + G+ G   ++ A
Sbjct: 769 NVGIAM-GINGSDVSKEA 785

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 126/342 (36%), Gaps = 72/342 (21%)

Query: 231 YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNN---SKAEIYFEAEGDFIQKRWIDIKV 287
           + T G +  V+ V+ +   V++ K   + N L N     A +    + + I  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 288 GDIIRVNSEEPIPADIIILSSSE---PEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344
           GDI  V   + IPAD+ ++ +      E L   E+  +  + NL     + E   + D  
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206

Query: 345 ELR---------NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRG---ATLRN 392
            L            KG++     NS +     +L+ +   I   P +  L+    +T + 
Sbjct: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKV 266

Query: 393 TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452
           TG   G  + T    KL + A            V+   I  LF ++V+      +   + 
Sbjct: 267 TGAFLGTNVGTPLHRKLSKLA------------VLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 453 STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL-IKYYQAFMIGSD 511
             A    LS                          ++P SL V + + +    A M+  +
Sbjct: 315 IYAICVALS--------------------------MIPSSLVVVLTITMSVGAAVMVSRN 348

Query: 512 LDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
           +           +V+    +E LG +  I SDKTGTLT+  M
Sbjct: 349 V-----------IVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 127/318 (39%), Gaps = 69/318 (21%)

Query: 664 NEEEEREYQLLNICEF--NSTRKRMSAIF------------RFPDDSIKLLCK---GADS 706
           + E+    Q  +I EF  +ST KRMS+++            +   +SI   C    G D 
Sbjct: 520 HNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDG 579

Query: 707 VILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766
           V +  L++     V+   +++   + EGLR L  A+K   +D+ N             D 
Sbjct: 580 VKITPLTDCD---VETIRKNVYSLSNEGLRVLGFASKSFTKDQVN-------------DD 623

Query: 767 RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826
           + + + +     ES L  +G   I D  +      ++   +AGI + +LTGD   TA  I
Sbjct: 624 QLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAI 683

Query: 827 GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886
                +L    NL   S+E  ++        +       LSE +++ L ++         
Sbjct: 684 AQEVGILP--TNLYHYSQEIVDSM------VMTGSQFDGLSEEEVDDLPVL--------- 726

Query: 887 LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946
                             ++  R SP  K  +++ + R+     +  GDG ND   ++ A
Sbjct: 727 -----------------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMA 768

Query: 947 HVGVGISGMEGMQAARSA 964
           +VG+ + G+ G   ++ A
Sbjct: 769 NVGIAM-GINGSDVSKEA 785

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 126/342 (36%), Gaps = 72/342 (21%)

Query: 231 YTTIGTLMVVLIVSAIKESVEDLKRASSDNELNN---SKAEIYFEAEGDFIQKRWIDIKV 287
           + T G +  V+ V+ +   V++ K   + N L N     A +    + + I  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 288 GDIIRVNSEEPIPADIIILSSSE---PEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344
           GDI  V   + IPAD+ ++ +      E L   E+  +  + NL     + E   + D  
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206

Query: 345 ELR---------NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRG---ATLRN 392
            L            KG++     NS +     +L+ +   I   P +  L+    +T + 
Sbjct: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKV 266

Query: 393 TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452
           TG   G  + T    KL + A            V+   I  LF ++V+      +   + 
Sbjct: 267 TGAFLGTNVGTPLHRKLSKLA------------VLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 453 STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVEL-IKYYQAFMIGSD 511
             A    LS                          ++P SL V + + +    A M+  +
Sbjct: 315 IYAICVALS--------------------------MIPSSLVVVLTITMSVGAAVMVSRN 348

Query: 512 LDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
           +           +V+    +E LG +  I SDKTGTLT+  M
Sbjct: 349 V-----------IVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

>Scas_707.48*
          Length = 741

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 160/703 (22%), Positives = 253/703 (35%), Gaps = 199/703 (28%)

Query: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
           GD++     + IPAD+ I+ + +      I+ +NL GE N  + ++  E  K  DS    
Sbjct: 172 GDLVHFKIGDRIPADLRIIEAVD----LSIDESNLTGE-NEPVHKSAKEVNK--DS---- 220

Query: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
                  ++QPNS               IP+S    +    TL   G   GIV+  G  T
Sbjct: 221 ------FNDQPNSI--------------IPISDRTCVAYMGTLVKEGHGKGIVVGIGKNT 260

Query: 408 ------KLMRN--ATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKH 459
                 +++ N     TP++  A++K+   + ++LF+  +V+ LI  +G           
Sbjct: 261 SFGAIFEMLSNIEKPKTPLQ-NAMDKL--GKDLSLFS-FIVIGLICLVG----------- 305

Query: 460 LSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEET 519
                LQG +   +F              +PI + VT+ L     A              
Sbjct: 306 ----ILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA-------------- 347

Query: 520 DTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGRC----------- 564
               +V+    VE LG +  I SDKTGTLT N M      C  S+A +            
Sbjct: 348 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSG 407

Query: 565 -YAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQ 623
               ++ ED  +T   G      SF     +   N  D  ++++          + P F+
Sbjct: 408 SLKNYLTEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKF--DLSDIRPTFK 465

Query: 624 ADGSIKYQAASPDXXXXXXXXXXXXYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTR 683
               I + +                 KF+  K      ++N   E +Y L   C   +  
Sbjct: 466 KVQEIPFNS---------------KRKFMAVK------IVN--SEGKYSL---CVKGAFE 499

Query: 684 KRMSAIFRFPDDSIKL--LCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLA 741
           K +S    + +   K   L +G   VI+    ET N             A+EGLR L  A
Sbjct: 500 KVLSQCSHYLNQKGKTEKLTQGQRDVII----ETAN-----------SLASEGLRMLAFA 544

Query: 742 TKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDT 801
              +P            D+ T L           EE    L   G   + D  +  V   
Sbjct: 545 KTTLP------------DSPTLL----------TEESVGDLIFTGLIGMNDPPRPTVKPA 582

Query: 802 IRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAAL 861
           I  L + G+ I ++TGD + TA+NI                    ++     ++ KL+ L
Sbjct: 583 IEQLLQGGVHIIMITGDSENTAVNIA-------------------RQIGIPVLDPKLSVL 623

Query: 862 HEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKM 921
               L+E   + LA VID H   FA                      R +P  K  +V+ 
Sbjct: 624 SGDKLNEMSDDQLANVID-HVNIFA----------------------RATPEHKLNIVRA 660

Query: 922 VKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
           + RK   ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 661 L-RKRGDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 701

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 125/305 (40%), Gaps = 73/305 (23%)

Query: 679 FNSTRKRMSAIFRF---PDDSI-KLLCKGADSVILERLSETGNFY--------------- 719
           F+S+ KRMSAI++    P   I ++  KGA     ER+ +  N +               
Sbjct: 524 FDSSVKRMSAIYKNVEEPKAPIYEVFTKGA----FERVLQCCNSWYTTPDGSPQPLTEED 579

Query: 720 VDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIE 779
           ++   ++++  ++EGLR L  A K   E ++   NK             +KL    + +E
Sbjct: 580 LETVQKNVDTLSSEGLRVLAFAKKTFNESQFTI-NK-------------DKLLKERDFVE 625

Query: 780 SGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNL 839
           + LT +G   I D  +      ++    AGI + +LTGD   TA +I     +L  ++  
Sbjct: 626 NNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNL-- 683

Query: 840 LIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIG 899
                  KE     +   + A    +LS+ +++ L ++                      
Sbjct: 684 ---YHYPKEVVNFMV---MTATDFDALSDKEIDELPVL---------------------- 715

Query: 900 KMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQ 959
                ++  R +P  K  +++ + R+ N      GDG ND   ++ A+VG+ + G+ G  
Sbjct: 716 ----PLVIARCAPQTKVRMIEALHRR-NRFCAMTGDGVNDSPSLKIANVGIAM-GINGSD 769

Query: 960 AARSA 964
            A+ A
Sbjct: 770 VAKDA 774

>Kwal_14.1498
          Length = 939

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 123/310 (39%), Gaps = 75/310 (24%)

Query: 665 EEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERL-----SETGNFY 719
           E+E  +    +   FNS RK M+   +  +    +  KGA   ILE+      +E     
Sbjct: 453 EDERPQVTRSDEISFNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVK 512

Query: 720 VDATTRHL-----EDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAV 774
           +D+  R       +  A++GLRTL  A  ++     N  +KK                 +
Sbjct: 513 LDSNLRQAITDSADALASDGLRTLAFAQLELS----NGNSKK-----------------L 551

Query: 775 AEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLS 834
            E+  +GLT  G   + D  +  V   +  L E  + I ++TGD + TA++I       +
Sbjct: 552 TEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSI-------A 604

Query: 835 EDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDY 894
             + + +++ ET            A L    L     + LA +ID H   FA        
Sbjct: 605 RQIGIPVVNPET------------AVLTGDKLDHMSEDQLASIID-HVNIFA-------- 643

Query: 895 FLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISG 954
                         R +P  K  +V+ ++++ + ++   GDG ND   ++ A +GV +  
Sbjct: 644 --------------RATPEHKLNIVRALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGK 688

Query: 955 MEGMQAARSA 964
           M G   A+ A
Sbjct: 689 M-GTDVAKEA 697

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 99/274 (36%), Gaps = 72/274 (26%)

Query: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347
           GD++R    + IPAD+ I+ + +      IE +NL GE     +     TA +       
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVD----LSIEESNLTGEN----EPVHKSTATV------- 211

Query: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
                      N   Y      E  G+ +P+S    I    TL   G   GIVI T   T
Sbjct: 212 -----------NKEFYK-----ENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNT 255

Query: 408 KL-----MRNATATPIK--RTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHL 460
                  M NA   P    +TA++K+        F V+ ++ LI  I             
Sbjct: 256 AFGKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGIICLIGVI------------- 302

Query: 461 SYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDL-YYEET 519
                QG +            W+    +  IS+ + V  I      ++   L L      
Sbjct: 303 -----QGRS------------WL---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 342

Query: 520 DTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
               +++    VE LG +  I SDKTGTLT N M
Sbjct: 343 KRRAIIRRLPSVETLGSVNVICSDKTGTLTANHM 376

>Kwal_23.3160
          Length = 1100

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 125/312 (40%), Gaps = 65/312 (20%)

Query: 668 EREYQLLNICEFNSTRKRMSAIFRF--PDDSIKLLCKGADSVILERLSE---TGNFYVDA 722
           E  Y+ +    F+S+ KRMSA++     D++ ++  KGA   +L+  ++    G    DA
Sbjct: 530 EPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDA 589

Query: 723 TT----------RHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLD 772
                       +++E  ++EGLR L  ATK   E +                  +E L 
Sbjct: 590 KPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQAL--------------KVSEDLR 635

Query: 773 AVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRL 832
              + +ES L   G   I D  ++     ++   +AGI + +LTGD   TA  I     +
Sbjct: 636 KNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGI 695

Query: 833 LSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLE 892
           L    NL    +E  ++        + A     L++ +++ L L+               
Sbjct: 696 LPR--NLYHYPKEVVDSMV------MTAAQFDQLTDEEIDNLLLL--------------- 732

Query: 893 DYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952
                       ++  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ +
Sbjct: 733 -----------PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM 780

Query: 953 SGMEGMQAARSA 964
            G+ G   A+ A
Sbjct: 781 -GINGSDVAKDA 791

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 121/300 (40%), Gaps = 64/300 (21%)

Query: 679 FNSTRKRMSAIF-RFPDDSIK-LLCKGADSVILERLSE------TGNFY------VDATT 724
           F+S+ KRMSA++    D + + +  KGA   +L+  +       TG  +      ++   
Sbjct: 531 FDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQ 590

Query: 725 RHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTL 784
           ++++  + EGLR L  ATK IP +E  +                E+L    + +ES L  
Sbjct: 591 KNVDTLSNEGLRVLAFATKTIPAEEAESL--------------GERLTKDRDFVESDLIF 636

Query: 785 IGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISE 844
            G   I D  +      ++    AGI + +LTGD   TA  I     +L    NL    +
Sbjct: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYPK 694

Query: 845 ETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKA 904
           E  +         + A    SL++ +++ L ++                           
Sbjct: 695 EVVDIM------VMTATQFDSLTDEELDQLPVL--------------------------P 722

Query: 905 VICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
           ++  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 723 LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780

>Kwal_56.23467
          Length = 280

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 70/157 (44%), Gaps = 11/157 (7%)

Query: 1070 FSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLG 1129
            ++++ FW ++V+G Y S + F    L Y     +  +G   DH  W + I   S+  V  
Sbjct: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63

Query: 1130 KAALVTNQ--WTKFTLFAIPGSLFFWLIFFPIYG--SIFPYAKISREYFGVVEHTYGSAT 1185
               ++ +Q  W  F+      +LF  L    +YG   I+     S E++    H YGS  
Sbjct: 64   NLYILIHQFRWDWFS------TLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPI 117

Query: 1186 FWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEM 1222
            +W    V   F L   F +  +++M+ P+   +I+E 
Sbjct: 118  YWAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREF 154

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 119/305 (39%), Gaps = 82/305 (26%)

Query: 674 LNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYV--DATTRHLED-- 729
           +N   FNS RK M+      +D + +  KGA     E++ E    Y+  D     L+   
Sbjct: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGA----FEKIVEKSINYIGRDGKVHKLKPND 515

Query: 730 ----------YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIE 779
                      A+EGLRTL  A  ++              +AT  D          E++ 
Sbjct: 516 KAIINDAAVALASEGLRTLAFAELEV--------------SATHGDKEFN------EDMV 555

Query: 780 SGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNL 839
            GLT  G  A+ D  +  V   I  L +  + + ++TGD + TA++I       +  + +
Sbjct: 556 EGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGI 608

Query: 840 LIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIG 899
            +I+ E             + L    L +   + LA VID H   FA             
Sbjct: 609 PVINPE------------YSVLSGDKLDQMTDDQLASVID-HVNVFA------------- 642

Query: 900 KMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQ 959
                    R +P  K  +V+ ++++ + ++   GDG ND   ++ A +GV +  M G  
Sbjct: 643 ---------RATPEHKLNIVRALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGKM-GTD 691

Query: 960 AARSA 964
            A+ A
Sbjct: 692 VAKEA 696

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
           +V+    VE LG +  I SDKTGTLT N M
Sbjct: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 62/159 (38%), Gaps = 32/159 (20%)

Query: 250 VEDLKRASSDNELNN-SKAEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSS 308
           V++ K   S   LN    AE +    G        ++  GD++R    + IPAD+ I+ S
Sbjct: 128 VQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVES 187

Query: 309 SEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGT 368
            +   LC ++ +NL GE      +   +++  +D +   +I G I               
Sbjct: 188 ID---LC-VDESNLTGE-----NEPVHKSSGAVDPKNYSHIPGSI--------------- 223

Query: 369 LEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407
                  IP+     I    TL   G   GIVI TG  T
Sbjct: 224 -------IPVGDRNCIGFMGTLVREGHGKGIVIATGKHT 255

>Kwal_47.17522
          Length = 899

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 114/317 (35%), Gaps = 85/317 (26%)

Query: 650 KFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVIL 709
           K LI+ P +   L       +Y++L+   F+   K+++A+   P+    +  KGA   +L
Sbjct: 409 KSLIQYPRAKNAL------TKYKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVL 462

Query: 710 ERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAE 769
           + + E                              IPED +  +  K  + A+    R  
Sbjct: 463 KTVEED---------------------------HPIPEDVHENYENKVAELAS----RGF 491

Query: 770 KLDAVAEEIESG-LTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM 828
           +   VA +   G   ++G     D  ++    T+   +  G+++ +LTGD    A+ I  
Sbjct: 492 RALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGD----AVGIAK 547

Query: 829 -SCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFAL 887
            +CR L    N+                 +LA   E++             DG +  F  
Sbjct: 548 ETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENA-------------DGFAEVF-- 592

Query: 888 EADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAH 947
                                   P  K  VV++++++   L+   GDG ND   ++ A 
Sbjct: 593 ------------------------PQHKYSVVEILQQR-GYLVAMTGDGVNDAPSLKKAD 627

Query: 948 VGVGISGMEGMQAARSA 964
            G+ + G     AARSA
Sbjct: 628 TGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 90/223 (40%), Gaps = 35/223 (15%)

Query: 671 YQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDY 730
           ++++++CE         AI  + D  +        S+    LS          + ++ D 
Sbjct: 647 WKMISLCESIGEHPVAKAIVNYADSHVN-----KSSIFDLDLSNEEVLIGKGISCNITDK 701

Query: 731 ATEGLRTLCLATKDIPEDEYNAWNKKYMD-AATTLDHRAEKLDAVAEEIESGLTLIGATA 789
            T  + T+ +  K +  DE         D A++TL      +D          +L+G   
Sbjct: 702 NTSKIHTITIGNKKLFPDE------SLSDIASSTLTESYVSIDG---------SLVGKFE 746

Query: 790 IEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEA 849
           I D+++E     +  LQ  GIK  ++TGD  ++A+ +     + + D    + SE T E 
Sbjct: 747 ISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND----VFSEVTPEQ 802

Query: 850 TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFAL-EADL 891
            R  + +         L  +    +A V DG + S AL EADL
Sbjct: 803 KRDIVIQ---------LQNNGTERVAFVGDGINDSPALVEADL 836

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 107/296 (36%), Gaps = 77/296 (26%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y++L    F+   K+++AI   P+    +  KGA   +L+ + E           HL  
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTVEEN----------HL-- 470

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATA 789
                          IPED    +  K  + A+   +RA  L    +  E    ++G   
Sbjct: 471 ---------------IPEDVKENYENKVAELASR-GYRA--LGVARKRGEGHWEILGVMP 512

Query: 790 IEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM-SCRLLSEDMNLLIISEETKE 848
             D  ++    T+   +  G+++ +LTGD    A+ I   +CR L    N+         
Sbjct: 513 CMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNIYNAERLGLG 568

Query: 849 ATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICC 908
                   +LA   E++             DG +  F                       
Sbjct: 569 GGGDMPGSELADFVENA-------------DGFAEVF----------------------- 592

Query: 909 RVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
              P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 593 ---PQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 61/297 (20%), Positives = 105/297 (35%), Gaps = 79/297 (26%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y+LL    F+   K+++AI   P+    +  KGA   +L+ + E               
Sbjct: 423 KYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEE-------------- 468

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESG-LTLIGAT 788
                          IPED    +  K  + A+    R  +   VA +   G   ++G  
Sbjct: 469 -------------HPIPEDVRENYENKVAELAS----RGFRALGVARKRGEGHWEILGVM 511

Query: 789 AIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM-SCRLLSEDMNLLIISEETK 847
              D  ++    T+   +  G+++ +LTGD    A+ I   +CR L    N+        
Sbjct: 512 PCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNIYNAERLGL 567

Query: 848 EATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVIC 907
                    +LA   E++             DG +  F                      
Sbjct: 568 GGGGDMPGSELADFVENA-------------DGFAEVF---------------------- 592

Query: 908 CRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
               P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 593 ----PQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 61/297 (20%), Positives = 105/297 (35%), Gaps = 79/297 (26%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y++L    F+   K+++A+   P+    +  KGA   +L+ + E               
Sbjct: 471 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-------------- 516

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESG-LTLIGAT 788
                          IPED +  +  K  + A+    R  +   VA +   G   ++G  
Sbjct: 517 -------------HPIPEDVHENYENKVAELAS----RGFRALGVARKRGEGHWEILGVM 559

Query: 789 AIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM-SCRLLSEDMNLLIISEETK 847
              D  ++    TI   +  G++I +LTGD    A+ I   +CR L    N+        
Sbjct: 560 PCMDPPRDDTAQTINEARNLGLRIKMLTGD----AVGIAKETCRQLGLGTNIYNAERLGL 615

Query: 848 EATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVIC 907
                    +LA   E++             DG +  F                      
Sbjct: 616 GGGGDMPGSELADFVENA-------------DGFAEVF---------------------- 640

Query: 908 CRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
               P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 641 ----PQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 690

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 387 AIVQKLSAIESLAGVEILCSDKTGTLTKN 415

>Scas_297.1
          Length = 800

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 906 ICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
           +  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 51  VMARSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 107

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 20/108 (18%)

Query: 284 DIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETA-KIMD 342
           ++ VGDII + + + IPAD +++     EG C ++ +++ GE++  IK+ +   A K  D
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVKVFNALKTFD 668

Query: 343 SRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATL 390
                    VI+  + N  +    G    NG KI   P+ M++ G+ L
Sbjct: 669 ---------VINEGKSNDQILDI-GFKTPNGDKI---PDCMLISGSKL 703

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 105/297 (35%), Gaps = 79/297 (26%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y++L    F+   K+++A+   P+    +  KGA   +L+ + E               
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-------------- 487

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESG-LTLIGAT 788
                          IPED +  +  K  + A+    R  +   VA +   G   ++G  
Sbjct: 488 -------------HPIPEDVHENYENKVAELAS----RGFRALGVARKRGEGHWEILGVM 530

Query: 789 AIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM-SCRLLSEDMNLLIISEETK 847
              D  ++    T+   +  G+++ +LTGD    A+ I   +CR L    N+        
Sbjct: 531 PCMDPPRDDTAQTVSEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNIYNAERLGL 586

Query: 848 EATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVIC 907
                    +LA   E++             DG +  F                      
Sbjct: 587 GGGGDMPGSELADFVENA-------------DGFAEVF---------------------- 611

Query: 908 CRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
               P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 612 ----PQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 661

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRN 551
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 359 IVQKLSAIESLAGVEILCSDKTGTLTKN 386

>Kwal_26.8333
          Length = 422

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 35/85 (41%)

Query: 1003 LYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYK 1062
            +Y T   + F N  SG S+   +   +  +  +V  P  +G   Q V  + +      +K
Sbjct: 169  MYTTSSAFHFGNPASGSSVSHLYANVMKQIGLSVFVPLFVGQILQNVFPKQVSWCLSTFK 228

Query: 1063 LGQKGQFFSVSIFWGWIVNGFYHSA 1087
            LG+ G F  + I W      FY  A
Sbjct: 229  LGKVGSFCLILIMWSSFSTAFYQKA 253

>Scas_569.0d
          Length = 468

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 905 VICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964
           ++  R SP  K  +++ + R+ +      GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 103 LVIARCSPQTKVRMIEALHRR-DKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKDA 160

>Scas_710.41
          Length = 904

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 62/304 (20%), Positives = 114/304 (37%), Gaps = 93/304 (30%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y++L    F+   K+++A+ + P+       KGA   +L+ + E               
Sbjct: 429 KYKILEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVEED-------------- 474

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGL-TLIGAT 788
                          +PED +  +  K  + A+    R  +   VA +   G   ++G  
Sbjct: 475 -------------HPVPEDVHENYENKVAELAS----RGFRSLGVARKRGEGYWEILGVM 517

Query: 789 AIEDKLQEGVPDTIRTLQEA---GIKIWVLTGDK----QETAINIGMSCRLLSEDMNLLI 841
              D  ++   DT RT+ EA   G+++ +LTGD     +ET+  +G+   + +       
Sbjct: 518 PCMDPPRD---DTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYN------- 567

Query: 842 ISEETKEATRRNME-EKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGK 900
            +E+       +M   +LA   E++             DG +  F               
Sbjct: 568 -AEKLGLGGGGDMPGSELADFVENA-------------DGFAEVF--------------- 598

Query: 901 MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 960
                      P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     A
Sbjct: 599 -----------PQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDA 644

Query: 961 ARSA 964
           ARSA
Sbjct: 645 ARSA 648

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRN 551
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 346 IVQKLSAIESLAGVEILCSDKTGTLTKN 373

>CAGL0I07909g 763900..773010 similar to sp|P19158 Saccharomyces
            cerevisiae YOL081w IRA2 GTPase-activating protein for RAS
            proteins, hypothetical start
          Length = 3036

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 29/66 (43%), Gaps = 9/66 (13%)

Query: 682  TRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLA 741
            T   MS     PDD+   LC     VI E LS+         TR+L DY  +GL T  L 
Sbjct: 2312 THFHMSPEIYVPDDTTTFLC-----VISESLSQNS----PELTRYLWDYILDGLETCLLP 2362

Query: 742  TKDIPE 747
               IP+
Sbjct: 2363 HNMIPQ 2368

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 16/141 (11%)

Query: 910  VSPLQKALVVKMVKRKT-NSLLLAIGDGANDVSMIQAAHVGVGIS-GMEGMQAARSADIS 967
            VSP  K  +VK ++ K  N+ +  +GDG ND   +  + +G+ IS G E   A  +ADI 
Sbjct: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE--IAIEAADIV 869

Query: 968  VGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTM 1027
            +     L          S + ++ AI  S      + +  FW +  N F     M    M
Sbjct: 870  ILCGNDLN-------TNSLRGLANAIDISLKTFKRIKLNLFWALCYNIF-----MIPIAM 917

Query: 1028 SLYNVFFTVLPPFVIGVFDQF 1048
             +   +   LPP + G+   F
Sbjct: 918  GVLIPWGITLPPMLAGLAMAF 938

>Scas_615.9
          Length = 942

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 783 TLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIG 827
           TL+G   I D ++E V D I+ LQ     I+++TGD    A+ + 
Sbjct: 693 TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVA 737

>Scas_688.1
          Length = 913

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 353 AIVQKLSAIESLAGVEILCSDKTGTLTKN 381

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 789  AIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKE 848
            A +D+++    D I+ L+ +GI+ W+++GD + TA  +     +  +++   ++ EE   
Sbjct: 926  AAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDI--DNVIAEVLPEEKAA 983

Query: 849  ATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVIC 907
              +      + A   H +       +A+V DG + + AL A      LA G       C
Sbjct: 984  KVKWIQHNNIGANGHHKV-------VAMVGDGINDAPALAAADVGIALASGSELAMTSC 1035

>Scas_630.14
          Length = 701

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 494 FVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNI 552
           +V V+L+++Y   M  S+ D   E T   T+V TS ++     I YI+ DK   +  N+
Sbjct: 282 YVQVQLLRWYSLTMYPSNTDTLEEITIVNTLVSTSLMLGLHQDINYIYMDKLPNIIPNL 340

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 523 TVVKTSSLVEELGQIEYIFSDKTGTLTRN 551
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 342 AIVQKLSAIESLAGVEILCSDKTGTLTKN 370

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 53/287 (18%), Positives = 101/287 (35%), Gaps = 77/287 (26%)

Query: 670 EYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLED 729
           +Y+++    F+   K+++A+   P+    +  KGA   +L+ + E               
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-------------- 471

Query: 730 YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESG-LTLIGAT 788
                          IPED +  +  K  + A+    R  +   VA +   G   ++G  
Sbjct: 472 -------------HPIPEDVHENYENKVAELAS----RGFRALGVARKRGEGHWEILGVM 514

Query: 789 AIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGM-SCRLLSEDMNLLIISEETK 847
              D  ++   +T+   +  G+++ +LTGD    A+ I   +CR L    N+        
Sbjct: 515 PCMDPPRDDTAETVNEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNIYNAERLGL 570

Query: 848 EATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVIC 907
                    +LA   E++             DG +  F                      
Sbjct: 571 GGGGDMPGSELADFVENA-------------DGFAEVF---------------------- 595

Query: 908 CRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISG 954
               P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G
Sbjct: 596 ----PQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG 637

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 107/278 (38%), Gaps = 79/278 (28%)

Query: 285 IKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344
           ++VGDI  V     IP+D I+      +G+  ++ + + GETNL +K+  +         
Sbjct: 432 LEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMTGETNLVVKEIGS--------- 477

Query: 345 ELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTG 404
                                                  ++ G T+  +G I+  V   G
Sbjct: 478 ---------------------------------------VVTGGTINGSGLIYFEVTSVG 498

Query: 405 HETKL------MRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTA--- 455
            +TKL      M+NA    +K+ ++++  +     + ++ V  +LI S+   I+ T+   
Sbjct: 499 DDTKLANIIKVMKNAQ---LKKASIQRYTDY----VASIFVPTVLILSLLTFIVWTSLTR 551

Query: 456 DAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLY 515
             K +S L + G      F+        +     P +L +         A M+G+ +   
Sbjct: 552 SEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATP-----TAIMVGTGV--- 603

Query: 516 YEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553
              ++   ++K   ++E+  ++     DKTGTLT   M
Sbjct: 604 --ASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHM 639

>Scas_634.2
          Length = 424

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 41/99 (41%), Gaps = 13/99 (13%)

Query: 984  WSYQRISVAILYSFYKNTALYMTQ-------FWYVFANAFSGQSIMESWTMSLYNVFFTV 1036
            WS + I   IL SFY N AL +           Y+F+N F   S  ++   S +  +   
Sbjct: 31   WSIKNIKTNILRSFYSNVALRIVSILSVFIFILYIFSNLFYPNSNNKNLFSSEHGYYLNE 90

Query: 1037 LPPFVIGVFDQFVNSRLLER------YPQLYKLGQKGQF 1069
            LP     +F    +S +L+       Y Q Y++    +F
Sbjct: 91   LPASSRLIFPHVEHSPVLKEIGINALYIQRYEMDGTRKF 129

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 42,500,876
Number of extensions: 1917624
Number of successful extensions: 6325
Number of sequences better than 10.0: 99
Number of HSP's gapped: 6280
Number of HSP's successfully gapped: 178
Length of query: 1308
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1194
Effective length of database: 12,649,657
Effective search space: 15103690458
Effective search space used: 15103690458
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)