Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06248g29729311611e-161
KLLA0A04037g3023038371e-112
ADR349W3202988241e-110
Scas_663.23042408111e-108
Kwal_26.70822993047971e-106
YAL025C (MAK16)3062447941e-105
CAGL0F00715g3102046063e-77
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06248g
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   451   e-161
KLLA0A04037g complement(359981..360889) some similarities with s...   327   e-112
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   322   e-110
Scas_663.2                                                            317   e-108
Kwal_26.7082                                                          311   e-106
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   310   e-105
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   238   3e-77

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  451 bits (1161), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 226/293 (77%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERRLAMREMERHYVGVAP                  IEKSIEKELLDRLKSGAYGDKPM
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEKIWKKVMGHLK                                  FVDMEDLEQWL
Sbjct: 181 NVDEKIWKKVMGHLKDENDQEEEEDWESEEEEESDEGEVEYVEDDGEAEFVDMEDLEQWL 240

Query: 241 GDGNGDHXXXXXXXXXXXXXXXNTPKRKKAKLSRRPKIEIEYEEERAHQELPQ 293
           GDGNGDH               NTPKRKKAKLSRRPKIEIEYEEERAHQELPQ
Sbjct: 241 GDGNGDHSDSDDSDEESSDDDENTPKRKKAKLSRRPKIEIEYEEERAHQELPQ 293

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  327 bits (837), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 197/303 (65%), Gaps = 11/303 (3%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEI+WQVINQ FCAYKVKTDKGQ FCRNEYNVTGLCSRQ+CPLANSKYATVK+ +G L
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLY++T ERAHTPAK WE+++LSKNY+KAL QID+HLLYWNKF IHKCKQR TKLTQV I
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERRLA+RE ERHYVG+AP                  IEK+IEKELL+RLKSG YGDKP+
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEKIWKKVMG ++                                   VDMEDLE+WL
Sbjct: 181 NVDEKIWKKVMGRVE-DEDLDEEENDWDEEEESDEGEVEFVEDEDAEDEMVDMEDLEKWL 239

Query: 241 GD-----GNGDHXXXXXXXXXXXXXXXNTPKRKKAKLS---RRPKIEIEYEEE--RAHQE 290
           G       + D                N  KR+K       R PK+EIEYE+E     QE
Sbjct: 240 GGSDTSDYSSDEDSDEDSSDEDSDEEENPSKRQKKSTQTRKRHPKVEIEYEQELNSNQQE 299

Query: 291 LPQ 293
           L Q
Sbjct: 300 LAQ 302

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  322 bits (824), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 195/298 (65%), Gaps = 13/298 (4%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEI+WQVINQ FCAYK+KTDKGQ FCRNEYNVTG C+R SCPLAN+KYATVK  +G+L
Sbjct: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLY++TVERAHTPAK WE+IRLSKNYS ALKQID+HLL+WNKF IHKCKQR TKLTQV I
Sbjct: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERR+A+RE ERHYVGVAP                  IEK+IEKELLDRLKSGAYGDKP+
Sbjct: 142 TERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 201

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEKIWK+VMGH++                                   V++EDL++WL
Sbjct: 202 NVDEKIWKRVMGHVE----QEQEQDEDYDEDEESDLGEVEYVEDDGEDDLVEVEDLQRWL 257

Query: 241 -------GDGNGDHXXXXXXXXXXXXXXXNTPKRKKAKLS--RRPKIEIEYEEERAHQ 289
                     + D                   K  +  LS  RRP++EIEYEEE  H+
Sbjct: 258 DDSDASDASEDSDDSDSEASDSEASDTEDRDSKAARGPLSKKRRPRVEIEYEEESRHE 315

>Scas_663.2
          Length = 304

 Score =  317 bits (811), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 176/240 (73%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEIVWQVINQ FC++++K+  GQTFCR+ YNVTGLC+RQSCPLANSKYATV+++ GR+
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLY++T ERAHTPAK WE+I+LSKNYSKALKQID+HLL+W  F IHKCKQRFTKLTQVAI
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERRLAMRE ERHYVGVAP                  IEK+IEKELLDRLKSGAYGDKP+
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEKIWKKV+GHL                                   +VD++DLE+WL
Sbjct: 181 NVDEKIWKKVLGHLDEEQEEEEEEDWDEEEEEESDEGEVEYVADDAEGEYVDVDDLEKWL 240

>Kwal_26.7082
          Length = 299

 Score =  311 bits (797), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 203/304 (66%), Gaps = 16/304 (5%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEI+WQVINQQFCAYK+KTDKGQ FCRNEYNVTGLC+RQSCPLAN+KYATVK+ +GRL
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLY++T ERAHTPAK WE+IRLSKNY+KAL Q+DDHLLYWNKF IHKCKQR T+LTQ+A+
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERR+ +RE ERHYVGVAP                  IEK+IEKELL+RLKSGAYGDKP+
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEKIWKKV+GH++                                   VD+ED+E+WL
Sbjct: 181 NVDEKIWKKVLGHVE-----DEQEEDYDEEEEEESDAEIEYVEDDGDEDLVDVEDIERWL 235

Query: 241 GDGNG-------DHXXXXXXXXXXXXXXXNTPKRKKAKLSR--RPKIEIEYEEER--AHQ 289
            D          D                +  ++K+A  +R  RP++EIEYEEE     Q
Sbjct: 236 DDPEASDSESSEDEDSEEDSEDDSEKSSKSDKRKKQAPAARKKRPRVEIEYEEETHPVQQ 295

Query: 290 ELPQ 293
           EL Q
Sbjct: 296 ELAQ 299

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  310 bits (794), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/244 (60%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60
           MSDEIVWQVINQ FC++++K   GQ FCRNEYNVTGLC+RQSCPLANSKYATVK +NG+L
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120
           YLY++T ERAHTPAK WE+I+LSKNY+KAL+QID+HLL+W+KF  HKCKQRFTKLTQV I
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 121 TERRLAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAYGDKPM 180
           TERRLA+RE ERHYVGVAP                  IEK+IEKEL+DRLKSGAYGDKP+
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMGHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDMEDLEQWL 240
           NVDEK+WKK+MG ++                                  +VD++DLE+WL
Sbjct: 181 NVDEKVWKKIMGQME--EENSQDEEEDWDEEEESDDGEVEYVADDGEGEYVDVDDLEKWL 238

Query: 241 GDGN 244
            D +
Sbjct: 239 ADSD 242

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  238 bits (606), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 116/204 (56%), Positives = 145/204 (71%), Gaps = 10/204 (4%)

Query: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVK--SENG 58
           +SD+++W +IN  FCA K+KT  GQTF R+ YNVTGL +RQSCPLANSKYATV+   + G
Sbjct: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62

Query: 59  RLYLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQV 118
           RLYL I+T ERAHTPAK W++IRLS NYSKALKQID+HL+YWNKF +H+CKQR+ KL+Q+
Sbjct: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122

Query: 119 AITERR---LAMREMERHYVGVAPXXXXXXXXXXXXXXXXXXIEKSIEKELLDRLKSGAY 175
            + ERR   L M   ++  VG+AP                  IE+SI KELL+RLKSGAY
Sbjct: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182

Query: 176 GDK-----PMNVDEKIWKKVMGHL 194
            +      P+NVDE IW K+MG L
Sbjct: 183 SNADKTLTPLNVDENIWNKIMGKL 206

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,646,428
Number of extensions: 250186
Number of successful extensions: 629
Number of sequences better than 10.0: 9
Number of HSP's gapped: 612
Number of HSP's successfully gapped: 13
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)