Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06226g1318129866220.0
Scas_505.31364138222950.0
YAL024C (LTE1)1435145021930.0
KLLA0A04059g1366141417490.0
ACR292W143962810361e-118
Kwal_26.7083140045510111e-115
Kwal_14.231315171601985e-15
CAGL0E03476g15641511889e-14
YLR310C (CDC25)15891511862e-13
Sklu_2189.415261341807e-13
Scas_621.1*13231471799e-13
YLL016W (SDC25)10481651743e-12
ADL038W15091601646e-11
Scas_604.1516761401592e-10
KLLA0D09306g15371171512e-09
CAGL0D06512g13082381243e-06
Kwal_33.1359814121391128e-05
CAGL0B01287g12471141092e-04
KLLA0C03410g13601911054e-04
AFR630C1436117860.084
Scas_721.51179113760.41
Scas_476.21330144800.42
YNL166C (BNI5)44851751.1
Sklu_2387.9100675732.2
YLR087C (CSF1)295896698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06226g
         (1298 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...  2555   0.0  
Scas_505.3                                                            888   0.0  
YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...   849   0.0  
KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...   678   0.0  
ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...   403   e-118
Kwal_26.7083                                                          394   e-115
Kwal_14.2313                                                           81   5e-15
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    77   9e-14
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    76   2e-13
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           74   7e-13
Scas_621.1*                                                            74   9e-13
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    72   3e-12
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    68   6e-11
Scas_604.15                                                            66   2e-10
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    63   2e-09
CAGL0D06512g complement(617453..621379) some similarities with s...    52   3e-06
Kwal_33.13598                                                          48   8e-05
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    47   2e-04
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    45   4e-04
AFR630C [3822] [Homologous to ScYCR038C (BUD5) - SH] (1582542..1...    38   0.084
Scas_721.51                                                            34   0.41 
Scas_476.2                                                             35   0.42 
YNL166C (BNI5) [4430] chr14 complement(322219..323565) Protein p...    33   1.1  
Sklu_2387.9 YLR389C, Contig c2387 10351-13371                          33   2.2  
YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein r...    31   8.1  

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score = 2555 bits (6622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1260/1298 (97%), Positives = 1260/1298 (97%)

Query: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60
            MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF
Sbjct: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60

Query: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120
            FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL
Sbjct: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120

Query: 121  NHFADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEPA 180
            NHFADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEPA
Sbjct: 121  NHFADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEPA 180

Query: 181  FSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDNFDHMVQ 240
            FSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDNFDHMVQ
Sbjct: 181  FSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDNFDHMVQ 240

Query: 241  SNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRKDVMSNV 300
            SNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRKDVMSNV
Sbjct: 241  SNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRKDVMSNV 300

Query: 301  TRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDTSSTQ 360
            TRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDTSSTQ
Sbjct: 301  TRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDTSSTQ 360

Query: 361  KSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKYVISISSLTNKEEDLK 420
            KSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKYVISISSLTNKEEDLK
Sbjct: 361  KSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKYVISISSLTNKEEDLK 420

Query: 421  RLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLSNDEFNDVNVPNNID 480
            RLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLSNDEFNDVNVPNNID
Sbjct: 421  RLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLSNDEFNDVNVPNNID 480

Query: 481  SKQISAMDNLDLFRTVNGVARSVISLTNSVNKLNNLSDHSVLDRRRVKSSMPNFYNRERS 540
            SKQISAMDNLDLFRTVNGVARSVISLTNSVNKLNNLSDHSVLDRRRVKSSMPNFYNRERS
Sbjct: 481  SKQISAMDNLDLFRTVNGVARSVISLTNSVNKLNNLSDHSVLDRRRVKSSMPNFYNRERS 540

Query: 541  LSGLSNYAGLQFYDASSEMSAEDDKPQKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKK 600
            LSGLSNYAGLQFYDASSEMSAEDDKPQKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKK
Sbjct: 541  LSGLSNYAGLQFYDASSEMSAEDDKPQKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKK 600

Query: 601  VLPNLFEHPSVDSLASGDACSYVTYDSQLSQMGTVKKSMKDETSRYSNYEGPVLKKKVAY 660
            VLPNLFEHPSVDSLASGDACSYVTYDSQLSQMGTVKKSMKDETSRYSNYEGPVLKKKVAY
Sbjct: 601  VLPNLFEHPSVDSLASGDACSYVTYDSQLSQMGTVKKSMKDETSRYSNYEGPVLKKKVAY 660

Query: 661  DNLREFTFEDSKEIIKNDTSSLIDILNSPVTPDLSILPQTPTGKGSVQHXXXXXXXXXXX 720
            DNLREFTFEDSKEIIKNDTSSLIDILNSPVTPDLSILPQTPTGKGSVQH           
Sbjct: 661  DNLREFTFEDSKEIIKNDTSSLIDILNSPVTPDLSILPQTPTGKGSVQHKKKEKSESIIS 720

Query: 721  PASGRISIAKSHHMSLSPNLTKLKEDDEYVKGDNSLGQAEDELIRLEKNLRDSKLENYNT 780
            PASGRISIAKSHHMSLSPNLTKLKEDDEYVKGDNSLGQAEDELIRLEKNLRDSKLENYNT
Sbjct: 721  PASGRISIAKSHHMSLSPNLTKLKEDDEYVKGDNSLGQAEDELIRLEKNLRDSKLENYNT 780

Query: 781  VVAGNLGAGSGSSTPLGDSPTNVFELPSSINMVESDMDTESFESSFEQRQPTNLREQYFK 840
            VVAGNLGAGSGSSTPLGDSPTNVFELPSSINMVESDMDTESFESSFEQRQPTNLREQYFK
Sbjct: 781  VVAGNLGAGSGSSTPLGDSPTNVFELPSSINMVESDMDTESFESSFEQRQPTNLREQYFK 840

Query: 841  SIGSPETASPRKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFL 900
            SIGSPETASPRKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFL
Sbjct: 841  SIGSPETASPRKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFL 900

Query: 901  KXXXXXXXXXXXXXXXNTSVTATPKNNDMFGSDFDKNGLKNIMTASEEKLSKDPVELAMM 960
            K               NTSVTATPKNNDMFGSDFDKNGLKNIMTASEEKLSKDPVELAMM
Sbjct: 901  KGNNQSASSSQIGASINTSVTATPKNNDMFGSDFDKNGLKNIMTASEEKLSKDPVELAMM 960

Query: 961  KLEGTFKKNKSGNNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIG 1020
            KLEGTFKKNKSGNNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIG
Sbjct: 961  KLEGTFKKNKSGNNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIG 1020

Query: 1021 PSIYPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQ 1080
            PSIYPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQ
Sbjct: 1021 PSIYPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQ 1080

Query: 1081 FTLIEREILSEXXXXXXXXXXXXYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAI 1140
            FTLIEREILSE            YKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAI
Sbjct: 1081 FTLIEREILSEIDWKDLLDIKLLYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAI 1140

Query: 1141 SEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPG 1200
            SEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPG
Sbjct: 1141 SEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPG 1200

Query: 1201 DMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRV 1260
            DMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRV
Sbjct: 1201 DMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRV 1260

Query: 1261 VNYSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKC 1298
            VNYSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKC
Sbjct: 1261 VNYSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKC 1298

>Scas_505.3
          Length = 1364

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1382 (41%), Positives = 807/1382 (58%), Gaps = 127/1382 (9%)

Query: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60
            + IFS  DYYP+PS  VI Y      K  K  V +ADI ++I +LSSP+D VDY  FSDF
Sbjct: 8    LGIFSADDYYPVPSTSVITYNESRTNKIRKT-VSKADIIALITYLSSPIDPVDYTIFSDF 66

Query: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120
            FL YR+FL+P EL++ LILRF+WC+ EI   +++     + ++G+VALIRTFVLLRH IL
Sbjct: 67   FLIYRDFLSPNELHELLILRFRWCILEI--LENKNVDVEKQKVGEVALIRTFVLLRHSIL 124

Query: 121  NHFADDFLLNENLRLRLISFFNEDI-KSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEP 179
            N+F  DFL + +LR  L++F N+++ ++  +++   +++LK+AW+H+ K  W+N+ FNEP
Sbjct: 125  NYFVQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPFNEP 184

Query: 180  AFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKS-DNFD-- 236
            +   + +W+ ++IKDV Q++   KR SR S + IQ  S+PD RNRS+LS+Y S DNF   
Sbjct: 185  SSVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLP 244

Query: 237  HMVQSNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRKDV 296
              +  NSN+  +  T S +L+  D+SN     +    KG +   I L N   +++ +   
Sbjct: 245  ESLDFNSNRTKQ--TASMMLYPNDNSNIPKIPI---PKGKEPLKITLINDNKNDIRKISH 299

Query: 297  MSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDT 356
            +S +  MS +I+D     S  +N+IIP TPAKKVE ILN++Y P+    E I++  N   
Sbjct: 300  LSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPED-NDETIED--NPRV 356

Query: 357  SST----QKSF-PKGIMSLLARWKKNH---------KIADPKIRKPVGFTNKREAELDNF 402
             ST    Q S   +G + LLARWK+NH         K     +  P+      + ++DNF
Sbjct: 357  KSTPPPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPIS-----KPDMDNF 411

Query: 403  VKYVISISSLTN-KEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKT 461
            VKYVISI+SL N K      +N+ + SKFDILSARTIDEVEYL  LE++L  ++    + 
Sbjct: 412  VKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKV----RG 467

Query: 462  TRTLSNDEFNDVNVPNNI------DSKQISAMDNLDLFRTVNGVARSVISLTNSVNK--- 512
               L+N+    + + N +      D+   SAMDNLDL++TV+ +A+SVISL+N++NK   
Sbjct: 468  QANLNNNNLKSIGLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTK 527

Query: 513  --LNNLSDHSVLDRRRVKSSMPNFYNRERSLS--GLSNYAGLQFYDASSEMSAEDDKPQK 568
              + N    S L+RR V SS P    +  S S  G+ +   +      +   A++D PQ+
Sbjct: 528  LKIVNSPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINI----TPPRAKNDGPQR 583

Query: 569  LVFHDGVDELKNHLTQTFTKPGSISN---SSPLKKVLPNLFEHPSVDSLASGDA--CSYV 623
            LVFHD    L   L QT TK    SN   SSPLK VLPNL E    DS+ S D    S +
Sbjct: 584  LVFHDDGSTLS--LPQTPTKSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTI 641

Query: 624  TYDSQLSQMGTVKKSMKDETSRYSNYEGPV--------LKKKVAYDNLREFTFEDSKEII 675
            +YDS LS      KS +    R + Y  P+        LKKK A  NLREFTFE SK  +
Sbjct: 642  SYDSLLSSKSFKHKSSR----RSNLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSL 697

Query: 676  KNDTSSLIDILNSP----------VTPDLSILPQTPTGKGSVQHXX---XXXXXXXXXPA 722
             + T S      SP          +TP +S+ P  P    +  H              PA
Sbjct: 698  PSPTKSQ----GSPKATHIRQQHHLTPPVSLSPTDPLKMEAEDHLSPLNKLTPQTAIRPA 753

Query: 723  SGRISIAKS--------HHMSLSPNLTKLKEDDEYVKGDNSLGQAEDELIRLEKNLRDSK 774
            SGRISI +          +    P    L  D +++K + SL ++E +L  L+ +L + +
Sbjct: 754  SGRISILRKSLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHQLQELQDDLLE-R 812

Query: 775  LENYNTVVAGNLGAGSGSSTPLGDSPTNVFELPSSINMVESDMDTESFESSFEQRQPTNL 834
                ++V   NL   S  ++P   +  N   L ++ ++     D+     +     P   
Sbjct: 813  TSLQSSVATDNL-FNSRKNSPKKVTAENKVRLSTTPSIYSILDDSSLSSGNTSYNDPARD 871

Query: 835  REQYF--KSIGSPET---ASPRKVNSNNAYSQVSSQMSP-------SLANKYLFSPDNES 882
              Q+   K I   E     S + V SN+  S   S +S         ++NKYLFSP+ ++
Sbjct: 872  SMQFTNDKRIDLREVFHNGSVQNVISNDLSSDAISGLSELKDNGINGVSNKYLFSPEEDN 931

Query: 883  LDIASPVKNVEDLKSRFLKXXXXXXXXXXXXXXXNTSVTATPKNNDMFGSDFDKNGLKNI 942
             D+ SP K+VE LK++FLK                  +        M   D DK  LK+I
Sbjct: 932  TDLISPGKDVEVLKNKFLKNETFEEESESIID----GIQEASDEGAMPNVDLDKEKLKDI 987

Query: 943  MTASEEKLSKDPVELAMMKLEGTFKKNKSGNNTGYSS----DLEKEVDILNIANLPEMNA 998
                ++  S DP+ +AMMKLEGT+K N   N T   S    DL KEV++LN+  LP    
Sbjct: 988  ADIPDDTGSGDPISIAMMKLEGTYKTNDDDNKTHEDSSSVQDLIKEVEMLNLKKLPTFPK 1047

Query: 999  NPSDKRKSLMLDRRRQTMFNIGPSIYPSNTNDEGY--DEESITDDKIWSLIAQYHIDDEN 1056
            +P +KRKSLM++RRRQT+ NI     P N+ +EG   +++ ++  ++ +L+  Y + D +
Sbjct: 1048 SPLEKRKSLMIERRRQTIMNI--PFTPQNS-EEGLAIEDKCVSPLQVQTLVMNYEVQDSS 1104

Query: 1057 LLAKNHANHVPFILMYESKDVAQQFTLIEREILSEXXXXXXXXXXXXYKGPNLTSWLQLL 1116
            L   N+ +H+PFILMY+SK +A+Q TLIE+E+LSE            YKG  +TSWLQLL
Sbjct: 1105 LQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLL 1164

Query: 1117 IQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMM 1176
            IQN+  +G+DLA+ARFNLTVDW +SEI LT D+KMRRNTI+RFIHVA++CR+ QN+NT+M
Sbjct: 1165 IQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLM 1224

Query: 1177 QIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIP 1236
            +IILAL+S+VVQKFT+AWRLIEPGDMLLWE+L+ IP+LD NY  +R ++ ++DP KGCIP
Sbjct: 1225 EIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIP 1284

Query: 1237 FIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLS 1296
            FIVVYLSDL++NSEK  WIV+++VVNY KF T VQIVKNFIQ+VQW+ FY+I    ELLS
Sbjct: 1285 FIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEVDHELLS 1344

Query: 1297 KC 1298
            KC
Sbjct: 1345 KC 1346

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1450 (39%), Positives = 812/1450 (56%), Gaps = 183/1450 (12%)

Query: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60
            M+IFSQ+DYYP PS +VI Y+     K     V  AD+P++IVHLSSP++ VDY   +DF
Sbjct: 1    MEIFSQKDYYPTPSSNVISYESDCVSK----PVNSADLPALIVHLSSPLEGVDYNASADF 56

Query: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120
            FL YRNF+TP +L+D LI RF+WC+REI +     +   + RIG+VAL+RTFVLLRH IL
Sbjct: 57   FLIYRNFITPQDLHDLLIYRFRWCIREITT---NAAKAKRRRIGEVALVRTFVLLRHSIL 113

Query: 121  NHFADDFLLNENLRLRLISFFNED-IKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEP 179
            N+F  DFL N  LRLRLI F N+  I+   K+I SC+I+LKK W+H  KL W+N+  NEP
Sbjct: 114  NYFVQDFLPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEP 173

Query: 180  AFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYK-SDNF--- 235
                +  W+ Y +KD +QL+   KR SR S +  QS ++PD RN+S+LS+YK SD F   
Sbjct: 174  DKLDFDAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLP 233

Query: 236  DHMVQSNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRK- 294
            + +  SNS+K    R+PS LLF  ++SN     VYS  + A++ ++   +   S+  +K 
Sbjct: 234  EKLQSSNSSK--NQRSPSMLLFPDNTSN-----VYSKHRIAKEPSVDNESEDMSDSKQKI 286

Query: 295  DVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQ 354
              +S VT +S +++      S  V+KI+P TPAKKVE ILN++Y P+ L   N Q    Q
Sbjct: 287  SHLSKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDL---NEQSGTLQ 343

Query: 355  DTSSTQKS-----------------FPKGIMSLLARWKKNHKIADP----KIRKPVGFTN 393
             TS+T                      +  + LLA+W KNH   D     K    +   N
Sbjct: 344  GTSTTSSLDNNSNSNSRSNTSSMSVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPAN 403

Query: 394  KREAELDNFVKYVISISSLTNKEEDLKR---LNENLDSKFDILSARTIDEVEYLFRLESK 450
            ++  E+D FVKYV+SISSL  K    +    LN +  SKFDILSARTIDEVE L  L+++
Sbjct: 404  QK-PEMDAFVKYVVSISSLNRKSSKEEEEEFLNSD-SSKFDILSARTIDEVESLLHLQNQ 461

Query: 451  LLAQLSTMQKTTRTLS-------NDEFNDVNV-------PNNIDSKQISAMDNLDLFRTV 496
            L+ ++ T     R  +        +  +D+ +       P+N      SAMDNLDL++TV
Sbjct: 462  LIEKVQTHSNNNRGPTVNVDCERREHIHDIKILQQNSFKPSN---DNFSAMDNLDLYQTV 518

Query: 497  NGVARSVISLTNSVNKL--NNLSD------HSVLDRRRVKSSMPNFYNRERSLSGLSNYA 548
            + +A+SVISLTN++NK   NN S+      +  L RR+VKS    +YN+   + G  +  
Sbjct: 519  SSIAQSVISLTNTLNKQLQNNESNMQPSPSYDALQRRKVKSLTTAYYNK---MHGSYSAE 575

Query: 549  GLQFYDASSEMSAEDDK-PQKLVFHDGVDELKNHLTQTFTKPGSISNS------SPLKKV 601
             ++ +D  +  S  D+  PQ+L+FH+        +T    +  + S S      SPLK V
Sbjct: 576  SMRLFDKDNSSSRTDENGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNV 635

Query: 602  LPNLFEH-PSVDSLASGDACSYVTYDSQLSQM---GTVKKSMKDETSRYSNYEGPVLKKK 657
            LP+L E  P  DS    ++ +Y       S      TV K  +   +  +N + P LK K
Sbjct: 636  LPDLKESSPLNDSREDTESITYSYDSELSSSSPPRDTVTKKSRKVRNIVNNTDSPTLKTK 695

Query: 658  VAYDNLREFTFEDSKEIIKNDTSSLIDILN--------------SPVTPDLSILPQTP-- 701
              + NLREFTFED+K +  ++  S ID L               S    D S+   +   
Sbjct: 696  TGFLNLREFTFEDTKSL--DEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEAN 753

Query: 702  ----TGKGSVQHXXXXXXXXXXXPASGRISIAKSHHMSLSPNLTKLKEDDEYVKGDNSLG 757
                T +                PASGRISI++   ++++P       D E  K ++ + 
Sbjct: 754  NYDITTRKKHSSCNHKIKQAVVRPASGRISISRVQSIAITPTKELSIVDPEQNKSNSVIE 813

Query: 758  Q-AEDELIRLEKNLRDSKLENYNTVVAGNLGAG---SGSSTPLGDSPTNVFELPS----- 808
            + +E E + LE N + +   + ++ V     +    S  ++PL  +     E P+     
Sbjct: 814  EISEIEPLNLEYNKKSALYSDTSSTVISISTSKLFESAQNSPLKQTQNPQREFPNGTSVS 873

Query: 809  -----------SINMVESDMDT-------ESFESSFEQRQP----TNLREQYFKSIGSPE 846
                       +I  V SD+++       E+FE+S +   P     NLRE+Y +  G+ +
Sbjct: 874  ETNRIRLSIAPTIESVVSDLNSITTGSTVETFETSRDLPVPHQRIINLREEYQR--GNQD 931

Query: 847  TASP-------RKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRF 899
              S        + ++ +++ + + S  + +  NKY FSPD+ S+D+ASP+KNVE+LKS+F
Sbjct: 932  IISNTSSLHELKTIDLSDSNNDLESPSTHAKNNKYFFSPDDGSIDVASPMKNVEELKSKF 991

Query: 900  LKXXXXXXXXXXXXXXXNTSV----TATPKNN------DMFGSDFDKNGLKNIMTASEEK 949
            LK                  +    T++ +N         F    +K  L  I    ++ 
Sbjct: 992  LKNESETNSNISGSVLTMDDIDINDTSSARNTRRANSESAFTGSLNKKNLNEIANMLDDS 1051

Query: 950  LSKDPVELAMMKLEGTFKK-------NKSGNNTGY-SSDLEKEVDILNIANLPEMNANPS 1001
            ++ DP+ +A+MKLEGT++K        KS +  G  +S L  EV++LN+ NLP    +P+
Sbjct: 1052 INDDPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPA 1111

Query: 1002 DKRKSLMLDRRRQTMFNIGPSIYPSNTNDEGYDEES-------------ITDDKIWSLIA 1048
            +KRKSL+++RRRQT+ NI     P  +  EG+   S             +   +I  LI 
Sbjct: 1112 EKRKSLLIERRRQTIMNIP--FTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIG 1169

Query: 1049 QYHIDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREILSEXXXXXXXXXXXXYKGPN 1108
            QY I D  L+  N+ +HVPFILMY+S  VAQQ TLIE+EIL E            ++GP 
Sbjct: 1170 QYRIHDSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQ 1229

Query: 1109 LTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRK 1168
            + SWLQLL++N+  +GIDLA++RFNLTVDW ISEI+LT   KM+RN I+RFIHVA+HCR 
Sbjct: 1230 VISWLQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRT 1289

Query: 1169 LQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTV 1228
             QNFNT+M+IILAL+S VVQKFT+AWRLIEPGD+L WE+L+KIP+LD NY  +R ++ +V
Sbjct: 1290 FQNFNTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSV 1349

Query: 1229 DPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCVQIVKNFIQKVQWSSFYDI 1288
            +PL GC+PFIVVYLSDL+ N+EK  WI+E +VVNY+KF T VQIVKNFIQ+VQWS FY  
Sbjct: 1350 NPLVGCVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTF 1409

Query: 1289 IPIQELLSKC 1298
                ELLSKC
Sbjct: 1410 KVNHELLSKC 1419

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1414 (35%), Positives = 748/1414 (52%), Gaps = 200/1414 (14%)

Query: 3    IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62
            +FS+ + YP+PS+ V+     V  +     +++  +P+++V LSSP+D VDY   +DFFL
Sbjct: 15   LFSRPELYPVPSESVL----TVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFL 70

Query: 63   FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGILNH 122
             YRNF++  +L D +  RF+W    I+  Q   S   ++   +V L+R FVL+RH + N+
Sbjct: 71   VYRNFMSSQKLLDLIQERFQWA---IDLRQSDPSSQEKI-TSEVILVRMFVLVRHWLSNY 126

Query: 123  FADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLKKAWLHAMKLNWDNV--LFNEPA 180
            FA DF+++ +LR + + F N     D + + + +ISLKK W+  +++ W+++  L  E  
Sbjct: 127  FAQDFVVDTSLRRQFLQFINGYSPVD-RFLDNIIISLKKLWVQNVQIMWEDLENLIVENN 185

Query: 181  FSAYTDWIDYKIKDV-----SQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDN- 234
              +  DW+ ++I+DV     S+      +  R S+  +Q+I+NP +RN S+LS+  +   
Sbjct: 186  VVSRDDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLLHTREK 245

Query: 235  --FDHMVQSNSNKIS---RNRTPSTLLFQKDSSNS-------EMATVYSNRKGAQKKTIA 282
                   +  S K S   + RT S LLF +++SN          + V       Q++ I 
Sbjct: 246  IPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREIT 305

Query: 283  LPNILTSELDRKDVM---SNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIY- 338
             P    +  D K ++   S VT +S++++D +   +  V+  +P TPAK +E IL T Y 
Sbjct: 306  DPK---NSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYM 362

Query: 339  SPDCLESENIQESLNQDTSSTQKSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAE 398
              D  E  N  +S N    +      KGI+ LL++WK NH+      RKP     +    
Sbjct: 363  ETDLPEQSNGSDSTNTVNGNNTNH--KGILGLLSKWKLNHQ------RKPTVNPVQNPPR 414

Query: 399  LDNFVKYVISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTM 458
            ++N +KYV SISSL N    L    ++L S FDILSARTIDEVEYL  +ES LLA+L   
Sbjct: 415  VENLIKYVFSISSLDNHANPLP---DSLSSMFDILSARTIDEVEYLVSVESDLLAKLEA- 470

Query: 459  QKTTRTLSNDEFNDVNVPNNIDSKQISAMDNLDLFRTVNGVARSVISLTNSVN-KLNNLS 517
            +K T  +S  E N+       +S+  S +DNL+L++TV+ +A SVISL+ ++N + N  +
Sbjct: 471  KKLTTEISKLETNED------ESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKST 524

Query: 518  DH------SVLDRRRVKSSMPNFYNRERSLSGLSN-YAGLQFYDASSEMSAEDDKPQKLV 570
             H      S L+R+ +++S P  Y+   S   ++N   GL   + +S        P++LV
Sbjct: 525  THLLSPSTSALERKNIRNSAPMLYSYNNSRYSITNALMGLPNTNDNS-------SPKRLV 577

Query: 571  FHDGVDELKNHLTQTFTKPGSISNSSPLKK-VLPNLFEHPSVDSLASGDACSYVTYDSQL 629
            FHD                   + +SP KK +L N   +    +       S VTYDS  
Sbjct: 578  FHDP------------------TRNSPTKKAILANNLNNIGEYNGERDSITSIVTYDSAF 619

Query: 630  SQM---GTVKKSMKDETSRYSNYEGPVLKKKVAYDNLREFTFEDS------------KEI 674
            S +   G +    K  ++ +     P LK+K+  ++LR F FE S            +E 
Sbjct: 620  SDISSSGNILSQHKGSSNIFME-SAPTLKRKLNVNDLRRFNFEKSDSTDDRSCSPQNREA 678

Query: 675  IKNDTSSLIDILNSPV--------TPDLSILPQTPTGKGSVQHXXXXXXXXXXXPASGRI 726
             +   +S+    N             D++ L        S              P SGRI
Sbjct: 679  TETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRPTSGRI 738

Query: 727  SIAKSHHMSLSPNLTK--------LKEDDEYVKGDNSLGQAEDELIRLEK------NLRD 772
            SI +++ ++ SPN  +        +  ++ +++ D +L   +D +  LE+      N  D
Sbjct: 739  SITRNYSVA-SPNSLRSILPKSPLILGNEVFIERDKALAANQDIISELEETTSLLLNDND 797

Query: 773  SKL---------ENYNTVVAGNLGAGSGSSTPLG----------------DSPTNVF--- 804
             K          ++ +  ++ NL   S  ++P                  D PT V    
Sbjct: 798  RKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQ 857

Query: 805  ------ELPS--SINMVESD--MDTESFESSFEQRQPTNLREQYFKSIGSPETASPRKVN 854
                  E PS  SI   +S+   D  S  S   + Q T LRE+Y             K  
Sbjct: 858  PISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREKYHL----------EKQA 907

Query: 855  SNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFLKXXXXXXXXXXXXX 914
            +N+ + +    ++P   NKYLFSPD +S+D ASP KN++DLK +F+              
Sbjct: 908  TNDIFEEDVENLNPE-NNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSL---- 962

Query: 915  XXNTSVTATPKNNDMFGSDFDKNGLKNIMTASEEKL--SKDPVELAMMKLEGTFKKNKS- 971
              +    AT ++N+      DK  L++IM   ++    S DPV LA+MKLEGT+ K +  
Sbjct: 963  --DEEEIAT-QDNENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDKGEKE 1019

Query: 972  --GNNTGYSSDLEKEVD---ILNIANLPEMNANPSDKRKSLMLDRRRQTM--FNIGPSIY 1024
                +   +S+L +EV+   I+  A LPE     + KR+S+ + RRR TM  F++  S+ 
Sbjct: 1020 IDDKSPSINSELAREVENFQIVQTAALPE----SARKRQSMFIQRRRNTMIDFSVRDSLI 1075

Query: 1025 PSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTLI 1084
              +++    +    TD++I +L+ QY + D  L   N   H+PFILMY+SK VA Q TLI
Sbjct: 1076 DKDSSCTRLEN---TDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLI 1132

Query: 1085 EREILSEXXXXXXXXXXXXYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIV 1144
            E+EILSE             + P  TSWLQLL+QN+  +GIDLA+ARFNLTVDW ISEIV
Sbjct: 1133 EKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIV 1192

Query: 1145 LTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLL 1204
            +T D+++RRNTI+RFIH+AEHC++LQN+NT+M+IILALNS+VVQKFTE WRL+EPGD+L 
Sbjct: 1193 MTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLT 1252

Query: 1205 WEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYS 1264
            WE L+ IP+L+ NY  +R ++  V+PL GCIPFIVVYLSDL++N EK TWIV   V+NY+
Sbjct: 1253 WETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYN 1312

Query: 1265 KFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKC 1298
            KF T VQIVKNF+QK+QWS FY+I    ELLSKC
Sbjct: 1313 KFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSKC 1346

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score =  403 bits (1036), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 258/628 (41%), Positives = 357/628 (56%), Gaps = 64/628 (10%)

Query: 721  PASGRISIAKSHHMSLSPNLTK---------LKEDDEYVKGDNSLGQAEDEL--IRLEKN 769
            PASGRISI K      SP             +++ D + K + SL   E++L  I +   
Sbjct: 809  PASGRISIIKKSGNRTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNALENDLQAILITTG 868

Query: 770  LRDSKLENYNT--VVAGNLGAGSGSSTPLGDSP--TNVFELPSSINMVESDMDTESFE-S 824
             R S      T   +A N+   S  ++P  ++   TN+ E  S+     S+ DT+  E S
Sbjct: 869  RRSSTFSKSGTDSTIATNVLLESIQTSPQKNTHLMTNISEDDSA-----SNTDTKPMEFS 923

Query: 825  SFEQRQPTNLREQYFKSIGSPETASPRKVNSNNAYS-------------QVSSQMSPSLA 871
            S       +    +  ++  P     R   S+N YS             + +SQ    L 
Sbjct: 924  SVGIESSASNSSSFADALCEPAN---RSSPSHNPYSGQCTTIEDRYRRSRFASQPDSLLG 980

Query: 872  ------NKYLFSPDNESLDIASPVKNVEDLKSRFLKXXXXXXXXXXXXXXXNTSVTATPK 925
                  NKY+FSP  E+ + ASP K++E LK++F+                   ++   +
Sbjct: 981  YINENGNKYIFSP-GETAEDASPKKDMETLKTKFMTTKEPPVCPSGNDADLALIISKLKE 1039

Query: 926  NN------DMFGSDFDKNGLKNIMTASEEKLSK-DPVELAMMKLEGTFKKNKSGNNTG-- 976
             N      +    + D N L    T+S    +  DPV +A+MKLEGTF K    +NT   
Sbjct: 1040 TNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAKPAKEDNTASK 1099

Query: 977  ----YSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIGPSIYPSNTNDEG 1032
                 SS L KEV+ L+       ++   +KR+S+ ++RRR TM +I    + S T D  
Sbjct: 1100 LNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR-TMTDI----FSSATEDTS 1154

Query: 1033 YDEES--ITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREILS 1090
             +E+S  ++D +I  L+  Y + D  L  KN  +HVPFILMY+S  +A+Q TLIERE+++
Sbjct: 1155 SEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQMTLIEREVMN 1214

Query: 1091 EXXXXXXXXXXXXYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLK 1150
            E               P +TSWLQLL+ N+E +GIDLA+ARFNLTVDW ISE+V+TTD+K
Sbjct: 1215 EIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISELVMTTDIK 1274

Query: 1151 MRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRK 1210
            +RRN I+R IHVAEHCR  QN+NT+M+I+LALNSVVVQKFT +WRLIEP DML WE L+ 
Sbjct: 1275 LRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKS 1334

Query: 1211 IPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCV 1270
            IP+LD NYH +R ++ ++DP+KGCIPF+VVYLSDL +NSEK  WIV   +VNY+KF T V
Sbjct: 1335 IPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIVNYNKFQTNV 1394

Query: 1271 QIVKNFIQKVQWSSFYDIIPIQELLSKC 1298
            QIVKNFIQ+VQW+ FYDI   ++LLSKC
Sbjct: 1395 QIVKNFIQRVQWARFYDIRADEDLLSKC 1422

 Score =  279 bits (714), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 219/717 (30%), Positives = 360/717 (50%), Gaps = 80/717 (11%)

Query: 3   IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62
           +FS  DYYP PS  VI Y      +    +++ AD+ +++  L+SPVD V+Y+ F+DFFL
Sbjct: 15  VFSAADYYPAPSGRVITYAAGGRGR----QIMAADVTALVAALTSPVDGVEYELFADFFL 70

Query: 63  FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRI-GKVALIRTFVLLRHGILN 121
            YRNFL    L + L  RF W + EI +      G  + R+ G++ L+RTFVLLRH ++N
Sbjct: 71  VYRNFLEARRLLELLEARFDWSLGEIGA------GRAKARVVGEITLVRTFVLLRHWVIN 124

Query: 122 HFADDFLLNENLRLRLISFFN----EDIKSDMKVIVSCLISLKKAWLHAMKLNWDNV-LF 176
           +FA DFL +  LR R ++F N        +  K++ + ++SLKK W + ++L WD++ L 
Sbjct: 125 YFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLE 184

Query: 177 NEPAFSAYTDWIDYKIKDVSQL--DMAQKRNSRFSYHGIQSISNPDMRNRSILSIYK-SD 233
            E    +   W+ ++I DV+QL  +   +R+SR S++  QS +NP  RN S+LS+Y+  D
Sbjct: 185 REFELRSADAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKD 244

Query: 234 NFDHMVQSNSNKIS-----RNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIAL--PNI 286
           NF   V++N   I      + RT S  L+ +DS N+          G QK   +L  P  
Sbjct: 245 NFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAP--------SGNQKPQCSLEPPFP 296

Query: 287 LTSELDRKDVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESE 346
             S + +   +S VT +S++I++     S  V    P TP+KK+E  +N+ Y P    +E
Sbjct: 297 AHSHVRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPA-AAE 355

Query: 347 NIQESLNQDTSSTQKSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKYV 406
             +E   Q    +   + + +  LL++W+ NH        K    T+  E  +DN +KYV
Sbjct: 356 CSREPSAQKKPRSPNGY-RAVTGLLSKWRMNHL----SRHKACDRTSTVEPAMDNLIKYV 410

Query: 407 ISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLS 466
            SISSL + + D++   E   SKFDILSARTI+EVE+L  +E+++L ++ T  +    ++
Sbjct: 411 FSISSLESPKGDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKV-TAHEGKVPIT 469

Query: 467 NDEFNDVNVPNNI------------DSKQISAMDNLDLFRTVNGVARSVISLTNSVN-KL 513
           +    +   P  +            + ++ S +DNL+L+RTV+ +A SVI LT + + + 
Sbjct: 470 SSSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQ 529

Query: 514 NNLSDHSVLDRRRVKSSMPNFYNRERSL--------SGLSNY-AGLQFYD-ASSEMSAED 563
             ++       R+  +S+  F      +         G  N  A L     AS++ +AE 
Sbjct: 530 TKVTLPPPPPLRQRPTSLSAFRGSSSRMLLSDSLRRDGYQNSKASLHLRPLASADENAEG 589

Query: 564 DK-----PQKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVDSLASGD 618
                  P +++FH     L    T       ++ ++SP   ++        V       
Sbjct: 590 SSVQASNPPQVIFH--THALIKTPTDKVFDAKAVEDTSPKTSLVST-----QVTDARPPS 642

Query: 619 ACSYVTYDSQLSQMGTVKKSMKDETSRYS----NYEGPVLKKKVAYDNLREFTFEDS 671
             S +TYDS L  +     +  ++T  ++    +   P+L +K  + NLREF FE S
Sbjct: 643 YESTITYDSDLQDITMRDYNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEAS 699

>Kwal_26.7083
          Length = 1400

 Score =  394 bits (1011), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/455 (46%), Positives = 289/455 (63%), Gaps = 38/455 (8%)

Query: 871  ANKYLFSPDNESLDIASPVKNVEDLKSRFL-----------KXXXXXXXXXXXXXXXNTS 919
            ANKYLFSPD++SLD ASP KN+EDLK++F+           +               N S
Sbjct: 936  ANKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDS 995

Query: 920  VTATPKNNDMFGSDFDKNGLKNIMTA--------------SEEKLSKDPVELAMMKLEGT 965
              ++    +    +  +  +  I++               ++E L  DPV +A+MKLEGT
Sbjct: 996  QLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGT 1055

Query: 966  F-KKNKS-GNNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIGPSI 1023
            F K+NK  G N    +D+EK    L    L  +    S +R+S ++++RRQ    I P  
Sbjct: 1056 FSKENKEKGEN---DADIEK----LKERRLTGLG---SRERRSFLIEKRRQIKSEI-PLT 1104

Query: 1024 YPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTL 1083
              S    +  +E   TD +I  L+  Y I D+ L   N   HVPFILMY+S+ +A+Q TL
Sbjct: 1105 PRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNVSNAQQHVPFILMYDSRSIAEQLTL 1164

Query: 1084 IEREILSEXXXXXXXXXXXXYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEI 1143
            +EREIL+E             + P++TSWLQLL+QN+  +GIDLA+ARFNLTVDW ISEI
Sbjct: 1165 VEREILNEIDWKDLLDLKLKREVPSVTSWLQLLLQNERLSGIDLAIARFNLTVDWIISEI 1224

Query: 1144 VLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDML 1203
            V+T D K+RRNTI+R IHVAEHC+  QN+NT+MQIILAL+S+VVQ + +AWRLIEPGD+L
Sbjct: 1225 VMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLL 1284

Query: 1204 LWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNY 1263
             WE L+ +P+L+ NY+ +R ++  ++P+KGCIPFIVVYLSDLT+N+EK+ WIV  +V+NY
Sbjct: 1285 TWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKSNWIVPNQVLNY 1344

Query: 1264 SKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKC 1298
            SKF T VQIVKNFIQ+ QWS FY     +ELLSKC
Sbjct: 1345 SKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKC 1379

 Score =  280 bits (716), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 234/705 (33%), Positives = 363/705 (51%), Gaps = 82/705 (11%)

Query: 3   IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62
           +FS+R+YYP PS + + Y     K+     +I+ D+ ++I+ L+SP+D +DY   +DFFL
Sbjct: 16  VFSEREYYPTPSAEKMSYL----KRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFL 71

Query: 63  FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGILNH 122
            YR FL P EL   L  R +W   E      +R      +IG+V  +RTFV++RH ILN+
Sbjct: 72  SYRKFLAPNELLRLLESRLQWAFNESLQADKERQ-----KIGQVTSVRTFVVIRHWILNY 126

Query: 123 FADDFLLNENLRLRLISFFNE----DIKSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNE 178
           FA DFL ++ LR + +   N       +   K I   ++S+KK+W+  +KL W++V F E
Sbjct: 127 FAQDFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTF-E 185

Query: 179 PAFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKS-DNFDH 237
            + S   +W+D+KI+D+      ++   R S++ +QS  NPD RNRS+LS+Y   +NF  
Sbjct: 186 NSPSNVDEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENF-- 243

Query: 238 MVQSNSNKISR-------NRTPSTLLFQKDS-------SNSEMATVYSNRKGAQKKTIAL 283
            +  NS +I+R        RT S  LF +D+       ++SE +   ++      K+ + 
Sbjct: 244 QLPENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKASSESSEPANSHSSGHSKSESG 303

Query: 284 PNILTSELDRKDVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCL 343
           P+++                    +D +   S  V+K+IP TPAKKVE IL + Y P   
Sbjct: 304 PDVM--------------------KDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDS 343

Query: 344 ESENIQESLNQDTSSTQK----SFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAEL 399
            +E   +  N  T   +K    S+ KG++ LL++WKKNH +     +      + +  E+
Sbjct: 344 PTEEA-DPANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLRSENHK--AHSESPKNQEI 400

Query: 400 DNFVKYVISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQ 459
           +N +K V SI+SL +K++  +     L SKFDILSARTIDEVEY   +E+ LL+++    
Sbjct: 401 ENLIKLVFSITSLEHKQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKI---- 456

Query: 460 KTTRTLSNDEFNDVNVPNNIDSKQISAMDNLDLFRTVNGVARSVISLTNSVNKLNNLSDH 519
           +    L N E      P     + +SAMDNL+L++TV+ +A SVISL+ ++   + +S  
Sbjct: 457 RNRGGLFNFERIHHENPQTQSPEAVSAMDNLNLYKTVSSIASSVISLSKTLQYHHAVSPS 516

Query: 520 SVL-DRRRVKSSMPNFYNRERSLSGLSNYAGLQFYDASSEMSAEDDKPQKLVFHDGV--- 575
           +   +RRRVKS+   F N     S L+    L   D  +  +  +D P+KLVFH  +   
Sbjct: 517 AAAQERRRVKSAEVFFRNN----SVLNFTDALLTRDIKTPATG-NDGPRKLVFHGPMGME 571

Query: 576 ----DELKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVD----SLASGDACSYVT--Y 625
               +E + H  +T TK G  S+S+P      N  E  + D    S   G   S V    
Sbjct: 572 RIRKEEFRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITEV 631

Query: 626 DSQLSQMGTVKKSMKDETSRYSNYEGPVLKKKVAYDNLREFTFED 670
           D   S+      S +   S   + E P LK+K    NLREF FE+
Sbjct: 632 DDTFSKHENSMNSAQSVNSVSLDTELP-LKRKEGLKNLREFNFEE 675

>Kwal_14.2313
          Length = 1517

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 82/160 (51%), Gaps = 6/160 (3%)

Query: 1143 IVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDM 1202
            IV  T+ K R    + FI VAEHC +L NF++M  I+ AL S  + +  ++W L+     
Sbjct: 1298 IVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIFRLKKSWALVPEESQ 1357

Query: 1203 LLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEK--RV 1260
             + E+L  +     N+   R  +KT+     C+PF  VYLSDLT  +E N   + +   +
Sbjct: 1358 KVLENLNTLMDPAKNFATYRNWLKTIQD-TACVPFFGVYLSDLTFIAEGNPNYLHRSSEI 1416

Query: 1261 VNYSKFSTCVQIVKNFI--QKVQWSSFYDIIPIQELLSKC 1298
            +N+SK    V+I+K     Q +++  F     +Q  + +C
Sbjct: 1417 INFSKRVRIVEILKEIASYQSIRY-KFKRYDDVQAFIGEC 1455

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 79/151 (52%), Gaps = 3/151 (1%)

Query: 1129 VARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQ 1188
            +A  N   ++    IV   D++ R   I+ FI VA+HC++L NF++M  I+ AL S  + 
Sbjct: 1325 IANANSLTNYVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIY 1384

Query: 1189 KFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTIN 1248
            +  + W L+      + ++L  +     N+   R ++++V  +  C+PF  VYLSDLT  
Sbjct: 1385 RLKQTWNLVPTETKEVLDNLNSLMDSKRNFIKYRELLRSVKDV-ACVPFFGVYLSDLTFT 1443

Query: 1249 SEKNTWIVEKR--VVNYSKFSTCVQIVKNFI 1277
               N+  ++ +  ++N+ K S    I++  +
Sbjct: 1444 FAGNSDYLDGKTDIINFGKRSKIANIIEGIL 1474

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 76/151 (50%), Gaps = 3/151 (1%)

Query: 1129 VARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQ 1188
            +A  N   ++    IV   D+K R    + F+ VA+HC++L NF++M  I+ AL S  + 
Sbjct: 1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIY 1410

Query: 1189 KFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTIN 1248
            +  + W L+      L ++L  +     N+   R ++++V  +  C+PF  VYLSDLT  
Sbjct: 1411 RLKKTWDLVSTESKDLLKNLNNLMDSKRNFVKYRELLRSVTDV-ACVPFFGVYLSDLTFT 1469

Query: 1249 SEKNTWIVEK--RVVNYSKFSTCVQIVKNFI 1277
               N   +     ++N+SK +    IV+  I
Sbjct: 1470 FVGNPDFLHNSTNIINFSKRTKIANIVEEII 1500

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 70/134 (52%), Gaps = 3/134 (2%)

Query: 1143 IVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDM 1202
            IV  TD+K R   I+ FI+VA HC +L NF+++  II AL S  + +    W  +     
Sbjct: 1303 IVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIYRLKRTWAAVPEEYK 1362

Query: 1203 LLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKR--V 1260
             L E+L  +     N+   R ++K++     C+PF  VYLSDLT  +  N   + +   +
Sbjct: 1363 KLLEELNTLMDSAKNFIRYRQLLKSIGDFP-CVPFFGVYLSDLTFTANGNPDFLHRNTVL 1421

Query: 1261 VNYSKFSTCVQIVK 1274
            VN+ K    ++I+K
Sbjct: 1422 VNFGKRVRILEILK 1435

>Scas_621.1*
          Length = 1323

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 5/147 (3%)

Query: 1143 IVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDM 1202
            IV   ++  R   I  FI VA++CR + NF++M  II AL S  V +  + W L+     
Sbjct: 1143 IVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRLKKTWHLVPESSK 1202

Query: 1203 LLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIV--EKRV 1260
             L  +L  +     N+   R ++K+V  +  C+PF  VYLSDLT     N   +     +
Sbjct: 1203 ALLRELNTLMDSTKNFIRYRQLLKSVRQVV-CVPFFGVYLSDLTFAHTGNPDFLSGSTEL 1261

Query: 1261 VNYSKFSTCVQIVKNFI--QKVQWSSF 1285
            +N+SK +  V+I++  I  +K+ ++SF
Sbjct: 1262 INFSKRAKVVEIIEEVINFKKLHYTSF 1288

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 12/165 (7%)

Query: 1124 GIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALN 1183
            G++  ++  N   ++    +V   D   R   +  FI +AE+CRK  NF++M  II AL 
Sbjct: 790  GLNEFISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMTAIISALY 849

Query: 1184 SVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLS 1243
            S  + +  + W+ + P    L + L K+     N+   R  +K++     C+PF  VYLS
Sbjct: 850  SSPIYRLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHS-APCVPFFGVYLS 908

Query: 1244 DLTINSEKNT-WIV----------EKRVVNYSKFSTCVQIVKNFI 1277
            DLT     N  ++V          EK+ +N++K S  V I++  I
Sbjct: 909  DLTFTDSGNPDYLVLEHGLKGVHDEKKYINFNKRSRLVDILQEII 953

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 80/160 (50%), Gaps = 12/160 (7%)

Query: 1143 IVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDM 1202
            IV  TDLK R   ++ FI VAE CR L NF++M  I  A+ S  + +    W ++     
Sbjct: 1292 IVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRLKRTWAMVHDN-- 1349

Query: 1203 LLWEDLRKIPAL---DWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKR 1259
               E L ++ AL     N+   R +++++     C+PF  VYLSDLT  +  N   ++  
Sbjct: 1350 -YKESLDRMNALMDSAKNFRKYRELLESLGDCP-CVPFFGVYLSDLTFTAGGNPDYLKGT 1407

Query: 1260 --VVNYSKFSTCVQIVKNF--IQKVQWSSFYDIIPIQELL 1295
              V+N++K +  V ++K     Q++ +     I  IQE +
Sbjct: 1408 TGVINFAKRARIVNVLKEIDSYQRISY-RLKRIAEIQEFI 1446

>Scas_604.15
          Length = 1676

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 9/140 (6%)

Query: 1143 IVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDM 1202
            IV   D+K R   I+ FI VAEHC+ L NF++M  I+ AL S  + +  + W  I    +
Sbjct: 1429 IVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIFRLKKTWSKIP---V 1485

Query: 1203 LLWEDLRKIPAL---DWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKR 1259
             + + L+K+ +L     N+   R  +K V  +   IPF  +YLSDLT     N   +   
Sbjct: 1486 EIKKSLKKLNSLMDSKRNFIKYRESLKLVKDVPR-IPFFGIYLSDLTFTFVGNPEFLHGT 1544

Query: 1260 --VVNYSKFSTCVQIVKNFI 1277
              ++N+SK S  V I+++ +
Sbjct: 1545 TDIINFSKRSRIVDIIEDIL 1564

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 1/117 (0%)

Query: 1133 NLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTE 1192
            N   D+    IV  TDLK R   ++ FI V+E C  L+NF++M  I+ AL S  + +  +
Sbjct: 1317 NHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPIFRLKK 1376

Query: 1193 AWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINS 1249
             +  +    +   + L  +     N+   R ++KTV  +  C+PF  VYLSDLT  +
Sbjct: 1377 TFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHDVP-CVPFFGVYLSDLTFTA 1432

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 97/238 (40%), Gaps = 19/238 (7%)

Query: 1059 AKNHANHVPFILMYESKDVAQQFTLIEREILSEXXXXXXXXXXXXYKGPNLTSWLQLLIQ 1118
            AK  AN    IL   +++VAQQ  LIE  +  +             K  +      +   
Sbjct: 978  AKFTANVYESILDIPAENVAQQLALIEENLYEKITIFDCLDRVWGCKQCDFGGSKNI--- 1034

Query: 1119 NQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRN-TIERFIHVAEHCRKLQNFNTMMQ 1177
              EF     ++ ++       +S  +L  D   +R   I  FI VA    ++ NF++M  
Sbjct: 1035 -SEFISFANSITKY-------VSYKILQYDTAAKRGQAIGYFIKVARISYEINNFSSMTA 1086

Query: 1178 IILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPF 1237
            II  + +  V +  E+W+L+         +L  +     N+   R  +K V   + CIPF
Sbjct: 1087 IISGIYASPVNRLHESWKLVSRELQNTLRELDDLMISTKNFLKYRLTLKNVGN-RPCIPF 1145

Query: 1238 IVVYLSDLTINSEKNTWIVEKR--VVNYSKFSTCVQIVKNFIQ----KVQWSSFYDII 1289
              VYLSDL      N   V+K    VN++K      I++        K ++ +  DII
Sbjct: 1146 FGVYLSDLLFTHNGNPDYVDKSRGTVNFTKRFRIFDIIQEIFHYKKVKYEYKADLDII 1203

>Kwal_33.13598
          Length = 1412

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 17/139 (12%)

Query: 1125 IDLAVARFNLTVDWAISEIVLTT-DLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALN 1183
            ID A    NL  ++ I  IV +   LK+R + +  ++++A      +NFNT+  I+ AL 
Sbjct: 1168 IDFA----NLLSNYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQ 1223

Query: 1184 SVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVD-----PLKG----- 1233
            S ++ +    W  I    + L++ L KI   D NY   R  ++ +      P  G     
Sbjct: 1224 SHILSRVELVWENISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSP 1283

Query: 1234 --CIPFIVVYLSDLTINSE 1250
               +PF  ++L DLT   E
Sbjct: 1284 IPIVPFFALFLQDLTFIHE 1302

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 1152 RRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKI 1211
            R   ++ ++ +A     L+NFN++  I+ A+ +  + + T  W+ +   D LL+E L +I
Sbjct: 1031 RTTILKAWLRIALSALYLRNFNSVASIMTAIQNHSITRLTGVWQQLSRKDTLLYEYLSRI 1090

Query: 1212 PALDWNYHALRTMMK---------TVDPLKG---CIPFIVVYLSDLTINSEKNT 1253
               + N+   R  +K         ++ P+K     +PF  ++L D+T   E N+
Sbjct: 1091 IHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVPVVPFFNLFLQDITFIHEGNS 1144

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 80/191 (41%), Gaps = 24/191 (12%)

Query: 1076 DVAQQFTLIEREILSEXXXXXXXXXXXXYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLT 1135
            +V++Q +LIE  I  +             K P+L+          +   ++  +   NL 
Sbjct: 1075 EVSKQISLIESTIFLKITPPELLKCKYSSKNPDLS----------KSPNVNSIITLTNLL 1124

Query: 1136 VDWAISEIVL-TTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAW 1194
             ++ +  I++    LK R   I+ ++ +A      +NFN +  I+  L S V+ + +  W
Sbjct: 1125 SNYVLESILMPGIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSMLW 1184

Query: 1195 RLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTV-------------DPLKGCIPFIVVY 1241
             ++   D+ L+E L KI   + NY   R  ++ +               +   +PF  ++
Sbjct: 1185 GMLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFNLF 1244

Query: 1242 LSDLTINSEKN 1252
            L DLT   E N
Sbjct: 1245 LQDLTFIDEGN 1255

>AFR630C [3822] [Homologous to ScYCR038C (BUD5) - SH]
            (1582542..1586852) [4311 bp, 1436 aa]
          Length = 1436

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 1149 LKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDL 1208
            L+ R + +  ++ +A      +NFN++  I+ AL S  + + +  W  ++  D  L+  L
Sbjct: 1217 LEARVDRLRGWLKIALSALYFRNFNSVASIMTALQSHAISRLSFIWESLDERDRDLFTYL 1276

Query: 1209 RKIPALDWNYHALR------------TMMKTVDPLKGCIPFIVVYLSDLTINSEKNT 1253
             KI   + NY   R            T + T       +PF  +++ DLT  +E N 
Sbjct: 1277 SKIIHPNNNYKVYRIKLNKLAEDFVPTSLPTAKSPLPVVPFFNLFIQDLTFINEGNC 1333

>Scas_721.51
          Length = 179

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 16/113 (14%)

Query: 345 SENIQESLNQDTSSTQKSFPKGIMSL-------LARWKKNHKIADPKIRKPVGFTNKREA 397
           S +IQ+SL  +T+   KS  KG  +        L + +K   +AD K+   V    KRE 
Sbjct: 57  SGHIQKSLANNTARISKSKDKGNQTKTNPRLVHLEKIQKVDALADKKVLSIVSHMTKREI 116

Query: 398 ELDNFVKYVISISSLTNKEEDLKRL-NENLDSKFDILSARTIDEVEYLFRLES 449
           EL         +S L +K ED  +L +E +D K + L    +DE +   R+ S
Sbjct: 117 EL--------RVSELRDKLEDEDKLTDEQIDEKCNTLRKTLVDESQEQQRISS 161

>Scas_476.2
          Length = 1330

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 61/144 (42%), Gaps = 10/144 (6%)

Query: 31  NEVIQADIPSIIVHLSSPVDSVDYKGFSDFFLFYRNFLTPAELYDYLILRFKWCMREIES 90
           N +I     ++++ L+  +D  D      F L +R F TP  L + LI RF    +   +
Sbjct: 756 NNIIGGSFRALVIKLTDEIDKADDFLIFSFLLNFRIFGTPETLIEILIERFDTEGKRSTT 815

Query: 91  YQHQRSG-----DNQLRIGKVALIRTFVLLRHGILNHFADDFLLNENLRLRLISFFNEDI 145
             + +SG     +++++  +  +   F +      N+  D  LL       +I+FFNE +
Sbjct: 816 QTYNKSGPYSSSESRIKNRRRIICNIFNIWMETFWNYTTDFTLLPT-----MINFFNEGV 870

Query: 146 KSDMKVIVSCLISLKKAWLHAMKL 169
              + +    LI +    ++   L
Sbjct: 871 CEFLPIERKLLIEVAAKLMNKTSL 894

>YNL166C (BNI5) [4430] chr14 complement(322219..323565) Protein
           possibly involved in stabilizing septin ring during
           cytokinesis, associates with Gin4p and several other
           proteins during mitosis to form a multiprotein complex
           [1347 bp, 448 aa]
          Length = 448

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 8/51 (15%)

Query: 790 SGSSTPLGDSPTNVF-------ELPSSINMVESDMDTESFESSFEQRQPTN 833
           SG STPL DS T +F       E  ++IN   SD D +   ++FE R+PTN
Sbjct: 270 SGGSTPL-DSQTKIFIPKKNSKEDGTNINHFNSDGDGQKKMANFETRRPTN 319

>Sklu_2387.9 YLR389C, Contig c2387 10351-13371
          Length = 1006

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 575 VDELKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVDSLASGDACSYVTYDSQLSQMGT 634
           V+    H+TQ       +S  + L   L  L + P  D+L + +   YV + S LS  GT
Sbjct: 784 VNSCIQHVTQFGIYSEDLSAKTAL---LAQLIDEPCFDTLRTKEQLGYVVFSSALSTHGT 840

Query: 635 VKKSMKDETSRYSNY 649
           V   +  ++ R S+Y
Sbjct: 841 VNLRLLIQSERDSSY 855

>YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein
            required for normal growth rate and resistance to NaCl
            and H2O2 [8877 bp, 2958 aa]
          Length = 2958

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 17/96 (17%)

Query: 377  NHKIADPKIRKPVGFTNKREAELDNFVKYVISISSLTNKEEDL-----KRLNENLDSKFD 431
            N + ADP   KPV FT  R  E DN   YV+ +S +    + L     K L E L S+  
Sbjct: 1187 NDEEADPSSFKPVAFTEDRNHERDN---YVVDVSYILLDVDPLLFIFAKSLLEQLYSE-- 1241

Query: 432  ILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLSN 467
                   + V+ L  +E  ++ +LS +Q+   ++SN
Sbjct: 1242 -------NMVQVLDDIEIGIVKRLSNLQEGITSISN 1270

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,875,315
Number of extensions: 2024877
Number of successful extensions: 8462
Number of sequences better than 10.0: 127
Number of HSP's gapped: 8829
Number of HSP's successfully gapped: 136
Length of query: 1298
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1185
Effective length of database: 12,684,275
Effective search space: 15030865875
Effective search space used: 15030865875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)