Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06182g68167030890.0
Scas_697.176942255701e-63
YHR131C8402385443e-59
Kwal_33.146297192295272e-57
YNL144C7402334912e-52
AFR049W7172294822e-51
KLLA0E23056g8182274825e-51
Scas_654.225802353979e-41
CAGL0J05830g6072492212e-18
KLLA0A08206g230181820.051
Kwal_33.14400110552740.83
Scas_657.385676740.99
Sklu_2437.672171721.6
CAGL0L01947g75745702.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06182g
         (670 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...  1194   0.0  
Scas_697.17                                                           224   1e-63
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   214   3e-59
Kwal_33.14629                                                         207   2e-57
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   193   2e-52
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   190   2e-51
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   190   5e-51
Scas_654.22                                                           157   9e-41
CAGL0J05830g complement(552107..553930) some similarities with s...    90   2e-18
KLLA0A08206g 730940..731632 no similarity, hypothetical start          36   0.051
Kwal_33.14400                                                          33   0.83 
Scas_657.3                                                             33   0.99 
Sklu_2437.6 YDR485C, Contig c2437 11696-13861 reverse complement       32   1.6  
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    32   2.2  

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/670 (87%), Positives = 584/670 (87%)

Query: 1   MDNRDVHYLDKSGDFKSPTSTIASGNXXXXXXXXXXXXRSHTPEEPVTSTYLEIIDGEPA 60
           MDNRDVHYLDKSGDFKSPTSTIASGN            RSHTPEEPVTSTYLEIIDGEPA
Sbjct: 1   MDNRDVHYLDKSGDFKSPTSTIASGNSLDDLTSSSTSTRSHTPEEPVTSTYLEIIDGEPA 60

Query: 61  SPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNR 120
           SPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNR
Sbjct: 61  SPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNR 120

Query: 121 SWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILSLGNSKKKNDNKI 180
           SWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILSLGNSKKKNDNKI
Sbjct: 121 SWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILSLGNSKKKNDNKI 180

Query: 181 VDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHALRLRCEAEQF 240
           VDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHALRLRCEAEQF
Sbjct: 181 VDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHALRLRCEAEQF 240

Query: 241 LVAFDNVDDLINWSMYINMGISVALDLDCRQLPNYXXXXXXXXXXXXXXXXXXPLHSLVD 300
           LVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY                  PLHSLVD
Sbjct: 241 LVAFDNVDDLINWSMYINMGISVALDLDCRQLPNYRVVPRRRRPHHTRRQKRTPLHSLVD 300

Query: 301 NXXXXXXXXXXXXXXPRGLYLHGATAMXXXXXXXXXXXXATVQSTVPKRVASQPISRNSS 360
           N              PRGLYLHGATAM            ATVQSTVPKRVASQPISRNSS
Sbjct: 301 NSSSSFFSKEFFLASPRGLYLHGATAMSSPPPRTRSSSSATVQSTVPKRVASQPISRNSS 360

Query: 361 SGRIVSNGNNSSFGKFFDMFKSKRSKQDFKSLQSANVTGLKVTLESKRDQSAKFELGSDL 420
           SGRIVSNGNNSSFGKFFDMFKSKRSKQDFKSLQSANVTGLKVTLESKRDQSAKFELGSDL
Sbjct: 361 SGRIVSNGNNSSFGKFFDMFKSKRSKQDFKSLQSANVTGLKVTLESKRDQSAKFELGSDL 420

Query: 421 EVMNNSIAEEPVKEFPSDRCEEMLKRHVNMMERELLCYSTQEPEFSEAGREVNNPGSSSH 480
           EVMNNSIAEEPVKEFPSDRCEEMLKRHVNMMERELLCYSTQEPEFSEAGREVNNPGSSSH
Sbjct: 421 EVMNNSIAEEPVKEFPSDRCEEMLKRHVNMMERELLCYSTQEPEFSEAGREVNNPGSSSH 480

Query: 481 SNRNFAEAEHVDSNXXXXXXXXXXXXXXXXXGQRLDPVVSIYAEEGLVHESESDYYYEQX 540
           SNRNFAEAEHVDSN                 GQRLDPVVSIYAEEGLVHESESDYYYEQ 
Sbjct: 481 SNRNFAEAEHVDSNEDEDEDDDYTLDDDYEDGQRLDPVVSIYAEEGLVHESESDYYYEQR 540

Query: 541 XXXXXXXXXXXXNMISHADADDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVC 600
                       NMISHADADDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVC
Sbjct: 541 RLTRSRAASTASNMISHADADDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVC 600

Query: 601 CPTGPPSFKTNNDLVLLNGKKIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTG 660
           CPTGPPSFKTNNDLVLLNGKKIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTG
Sbjct: 601 CPTGPPSFKTNNDLVLLNGKKIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTG 660

Query: 661 YIPITALEAN 670
           YIPITALEAN
Sbjct: 661 YIPITALEAN 670

>Scas_697.17
          Length = 694

 Score =  224 bits (570), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 154/225 (68%), Gaps = 6/225 (2%)

Query: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110
           +L+ ID +P SPP+Y+E+N N+ + FPIWE   PC + E PP+Y P V  + IVS+KLEW
Sbjct: 88  FLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLEW 147

Query: 111 LSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILSLG 170
           LSP++ SP R+W+  IMEINSTQ+NFY ++      ++N Y+      + S  +   S G
Sbjct: 148 LSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRN-YSNDSSSSSPSKQRSTFSFG 206

Query: 171 NSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHA 230
           N      NK  D E    ++  +++RN   YLS+ +LY+S++LQ+A+ G+P DY+K  + 
Sbjct: 207 NRTTYEFNK-NDQE----QIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYKKKTYV 261

Query: 231 LRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
           LRLRCE+EQFL+ F +VDD+I W+MY+NMGISVALDL+ R LP+Y
Sbjct: 262 LRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 76/151 (50%), Gaps = 12/151 (7%)

Query: 520 SIYAEEGLVHESESD---YYYEQXXXXXXXX-XXXXXNMISHADA-----DDVKWMPPQK 570
           S+Y EEG+ H +E+D   Y Y Q              ++IS   +     D++KW PP K
Sbjct: 527 SVYDEEGIFHYNETDEYEYSYAQSITTNSTSYRRRTSSLISTMSSVPYSSDEIKWTPPLK 586

Query: 571 ILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKIDEKTVGNS 630
           I  RR+Y+++SLRCI  F+E ++W+  +V  PT  P FKTNN  +      +D       
Sbjct: 587 ITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPI---AGSLDSTCTSYR 643

Query: 631 RNKIVNSSGDKSYWKTKNHFLQLYIIEPTGY 661
           +  +   +      + KNH+L+ Y++ P  +
Sbjct: 644 KKLLAGCTSGSDLNRVKNHYLKAYVVGPAKF 674

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  214 bits (544), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 106/238 (44%), Positives = 155/238 (65%), Gaps = 20/238 (8%)

Query: 53  EIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLS 112
           E ID  PA PP YD VN N+ V FPI+ D  PC  +  PP Y P VY + ++S+KLE LS
Sbjct: 75  EHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLERLS 134

Query: 113 PFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYN---------------LKYDD 157
           P+E S NRSWR FI+EINSTQ+NFY ++    + ++NY +               +   D
Sbjct: 135 PYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVHRSD 194

Query: 158 GAKSLAKGILSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYAR 217
            ++ L   + +L  ++  ++ K  D E    R++ +++R+ S+YL+D  LY+SFTLQ AR
Sbjct: 195 QSQHLHHRLFTLP-TRSASEFKKADQE----RISYRVKRDRSRYLTDEALYKSFTLQNAR 249

Query: 218 MGIPTDYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
            GIPTDY K +  LR+ CE+EQFL+ F ++DD+I+WSMY+++GISV+LDL+ R+ P+Y
Sbjct: 250 FGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDY 307

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 21/111 (18%)

Query: 560 ADDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNG 619
            DD+KW P  K +SRRRY++DSL+CIK F++ +  +G+V+  P   P+F+T+N       
Sbjct: 689 TDDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTFETSNK------ 742

Query: 620 KKIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTGYIPITALEAN 670
                          ++ S  +S  K KNHFL+ +I+ PT  I +     N
Sbjct: 743 ---------------IHFSNRQSLQKQKNHFLKGFIVGPTALIELNCKNKN 778

>Kwal_33.14629
          Length = 719

 Score =  207 bits (527), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 145/229 (63%), Gaps = 16/229 (6%)

Query: 55  IDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLSPF 114
           ID  PA PP Y   + +R VTFP++E L   S+    P Y P V  + +VS+KLEWL P+
Sbjct: 78  IDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSL----PGYSPAVEAITVVSMKLEWLDPY 133

Query: 115 EPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSL--------AKGI 166
             SP+RSW+ F+MEINSTQ+NFY ++P   R +KNY N K   G + L           I
Sbjct: 134 TCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYESHHSI 193

Query: 167 LSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRK 226
            S  +SK        D E     ++ K+  N SKYL+D +L+RS++LQ+A+ GIPTDY +
Sbjct: 194 FSSLSSKNTYQFNKADQEC----ISKKISNNKSKYLTDNKLFRSYSLQFAKYGIPTDYNR 249

Query: 227 SAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
               LR+RCE EQF+++F +VDD+I W+MY+++GI V+LDLD R+LP Y
Sbjct: 250 KTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTY 298

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 79/156 (50%), Gaps = 10/156 (6%)

Query: 518 VVSIYAEEGLVHESESDYYY--EQXXXXXXXXXXXXXNMISHA-DADDVKWMPPQKILSR 574
             SIY EEG+ H+SE DYYY  ++             N+ S    + DVKW PP+K +SR
Sbjct: 565 ATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPPRKEMSR 624

Query: 575 RRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNN----DLVLLNGKKIDEKTVGNS 630
           RRY++DSLRCIK   ++  W+G+V+  P   P + TNN      V   GK    K    S
Sbjct: 625 RRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPISGFVGGTGKSGKSKA---S 681

Query: 631 RNKIVNSSGDKSYWKTKNHFLQLYIIEPTGYIPITA 666
            NK   S       K KNH+ + YI+ P G +   A
Sbjct: 682 PNKSSKSDKGVILQKCKNHYAKPYIVGPVGLLKTNA 717

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  193 bits (491), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 145/233 (62%), Gaps = 13/233 (5%)

Query: 52  LEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWL 111
           L  ID  P  PP YD  N ++ + +PI+E   PC  + KPP+Y P+V +  +VS+K+E L
Sbjct: 89  LYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYTVVSMKMEKL 148

Query: 112 SPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNY---------YNLKYDDGAKSL 162
           SPFE + +R W  FI++INSTQINFY+++    R +KNY         ++ K        
Sbjct: 149 SPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDMFDHSHHSKTASDRHHS 208

Query: 163 AKGILSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPT 222
           A+ +L+   +K        D E    R+  ++ R+  K+LSD RL++S++LQ A++G+P 
Sbjct: 209 ARSLLNAFTTKSTYQFDKYDKE----RICGEIARDEHKFLSDERLFKSYSLQCAKVGLPI 264

Query: 223 DYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
           DY      LR+RCE +QFLV F +VD+LI W+MY+NMGIS++LDL+ R++P Y
Sbjct: 265 DYSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTY 317

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 17/103 (16%)

Query: 560 ADDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNG 619
           ++D KW P  +++SR+RY+KDSLRCIK   E   W+G+++  P  PP+F+TNN  +    
Sbjct: 636 SNDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPI---- 691

Query: 620 KKIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTGYI 662
                        ++ +          KNH+L+ YI+   G++
Sbjct: 692 -------------RVYSGEDSTDLMHVKNHYLKPYIVGSCGFL 721

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  190 bits (482), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 141/229 (61%), Gaps = 9/229 (3%)

Query: 52  LEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWL 111
           L ++  +PA PP Y  VN NR + +PI+E       T + PAY P V+ +A+VSVK EW 
Sbjct: 64  LAVLQPQPARPPPYYAVNPNRRIRYPIYER----EETNELPAYAPAVHELALVSVKQEWA 119

Query: 112 SPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVK-----NYYNLKYDDGAKSLAKGI 166
           SP+EP+ +RSWRT +ME+NSTQ+NFY ++    R ++     +   +       SL+ G 
Sbjct: 120 SPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSFGQ 179

Query: 167 LSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRK 226
           +  G       ++   +  H + + A+ +R+  ++L   RLY+S++LQYA  G+P DY K
Sbjct: 180 VKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDYTK 239

Query: 227 SAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
            +  LRLRCE EQFLV F  VD LI+WS+ +++GI V+LDLD R++P Y
Sbjct: 240 RSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAY 288

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 7/100 (7%)

Query: 564 KWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKID 623
           KW+PP K  +RRR+V+DS+RCI+   +  +W+G +V  P+  P   ++     L    + 
Sbjct: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVVSPSAGPGSSSSGFPFDLG---LG 671

Query: 624 EKTVGNSRNKIVNSSGDKSYWKTK-NHFLQLYIIEPTGYI 662
            K +G+ R+      G +S   T+   F++ YI+ P G +
Sbjct: 672 SKRLGSRRSL---KRGSQSLSGTRAARFMKAYIVGPVGLV 708

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  190 bits (482), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/227 (40%), Positives = 138/227 (60%), Gaps = 8/227 (3%)

Query: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110
           Y + +D  P  PP Y  VN NR +T+PI+E L    +    P Y P V  + ++S+K EW
Sbjct: 125 YFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVL----PGYSPAVKAITVISLKQEW 180

Query: 111 LSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYN--LKYDDGAKSLAKGILS 168
           L+P+E S +R+W+ FIMEINSTQ+NFY +       +KNYY     + +   S  +    
Sbjct: 181 LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTRF 240

Query: 169 LGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSA 228
           L +   K+  +   ++  W  +   ++ N  KYLS+  L++SF+LQY + GIPTDY K  
Sbjct: 241 LPSLHSKSTYQFNRSDQQW--ITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKT 298

Query: 229 HALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
             LRLRCE +QFL+ F +VDD+I+WS+ +++GI V+LDL  R++P Y
Sbjct: 299 FVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (52%), Gaps = 4/146 (2%)

Query: 520 SIYAEEGLVHESESDYYYEQXXXXXXXXXXXXXNMISHA-DADDVKWMPPQKILSRRRYV 578
           SIY EEG+ H+S+ DY Y               N+ +     D++KW PP+K ++RRRY+
Sbjct: 668 SIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPRKEITRRRYI 727

Query: 579 KDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLV--LLNGKKIDEKTVGNSRNKIVN 636
           +DSLRCIK      SW+ ++   P+  P ++TNN  V   ++   +  K    S  K+ N
Sbjct: 728 RDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFISNSDLSSKN-KFSLKKLYN 786

Query: 637 SSGDKSYWKTKNHFLQLYIIEPTGYI 662
           +       + KNH+L  YII P+G +
Sbjct: 787 TQPALLLSRCKNHYLTPYIITPSGLV 812

>Scas_654.22
          Length = 580

 Score =  157 bits (397), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 132/235 (56%), Gaps = 17/235 (7%)

Query: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110
           +L  ID  P  PP YD +N +R ++FPI+E          PP+Y P V  + +VS+KLEW
Sbjct: 90  FLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEW 149

Query: 111 LSPFEP--SPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILS 168
            SP  P     + W+  +ME+NSTQ+NFY ++      +K     + +         +  
Sbjct: 150 ESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQSQLKKTIGPRKN-------STLFG 202

Query: 169 LGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSA 228
           + N++ ++      T+   +++   + RN SKYL DA L +S++LQ+ R+G PTD     
Sbjct: 203 MNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPTDLSSKN 262

Query: 229 H--------ALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275
                    ALRLRCEA+QFL+ F ++D LI  +++I+MGISV+LDL  R+LP Y
Sbjct: 263 KGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTY 317

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 55/96 (57%), Gaps = 16/96 (16%)

Query: 561 DDVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGK 620
           DD KW P  K  SRRRYV+DSLRCIK   E+  W+G+VV CPT  PSF+TNN L L  GK
Sbjct: 480 DDYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNN-LPLFIGK 538

Query: 621 KIDEKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYII 656
                TV               Y  TKNH+L+ +++
Sbjct: 539 GPHASTV---------------YDTTKNHYLKAHVV 559

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 105/249 (42%), Gaps = 75/249 (30%)

Query: 89  EKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNRSWRTFIMEINSTQINFYA---------- 138
           E+ P Y P V        KLEW SP + S +  W   ++ INSTQ+N Y           
Sbjct: 38  EELPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPAS 97

Query: 139 -----------------LEPEFHRLVKNYYNL-----------KYDDGAKSLAKGILSLG 170
                            L   F R  KNY               + +  +++ +  L   
Sbjct: 98  KSLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGAR 157

Query: 171 NSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDA----------RLYRSFTLQYARMGI 220
             +    + I DT             NY +Y S+             ++S++LQ A++G+
Sbjct: 158 KKRSNQYDFIYDT-------------NYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGM 204

Query: 221 PT-DYRKSAH-------------ALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALD 266
           PT + RK  +              LRLR E +QFLV F+++DD+I WSMY++MGI+V+ D
Sbjct: 205 PTSESRKKVYIDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKD 264

Query: 267 LDCRQLPNY 275
           L  R+ PNY
Sbjct: 265 LYDREYPNY 273

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 562 DVKWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTG 604
           D KW P +K  +R+RY++ SLRCI+     + W G  +    G
Sbjct: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAG 578

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 76/181 (41%), Gaps = 32/181 (17%)

Query: 108 LEWLSPFEPSPNRS------------WRTFIMEINSTQINFYALEPEFH----RLVKNYY 151
           +E L P+ PS   S            W    +EINSTQ+    + P  H    +L+  +Y
Sbjct: 36  MEPLPPYTPSLQISFLLQTQFEHSHRWTPHCVEINSTQL---LIRPLIHSHDEKLINKWY 92

Query: 152 NLKYDDGAKSLAKGI--LSLGNSKKKNDNKIVDTEPHWKRLNAK---LERNYSKYLSDAR 206
           + K D+      K      L + +     ++ +   H     AK   LE++ S  L    
Sbjct: 93  S-KLDELEYKQYKATSNHQLCHDQLVQSTQVPNQRDHIVLCTAKGLYLEKDKSLNLIQWN 151

Query: 207 L--YRSFTLQYARMGIPTDYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVA 264
               + ++LQ  R+G+ TD  +    LR+RCE EQFL+     DD    S++  +  +  
Sbjct: 152 RDPIKKYSLQDCRIGLNTDMSR---CLRIRCEREQFLLRVP--DDASVTSLFAKIACAAE 206

Query: 265 L 265
           L
Sbjct: 207 L 207

>Kwal_33.14400
          Length = 1105

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 385 SKQDFKSLQSANVTGLKVTLESKRDQSAKFELGSDLEVMNNSIAEEPVKEFP 436
           SK  FK L     +G+K+ L  K ++ +  EL S  + +  S+++ PVK+FP
Sbjct: 233 SKNLFKELNPHLASGMKLALAGKSEEISHTELVSLRDHLAQSLSQAPVKKFP 284

>Scas_657.3
          Length = 856

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 197 NYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHALRLR-CEAEQFLVAFDNVDDLINWSM 255
           +YS+ + +A +Y+ F +        T Y + A  L LR C ++ F  A DN  ++I   +
Sbjct: 331 HYSETIPNA-IYKFFIMLTGFTTGKTSYVERAQFLLLRHCYSQTFRNAGDNTHNVIIADL 389

Query: 256 YINMGISVALDLDCRQ 271
             + GI++ L+LD ++
Sbjct: 390 LSDAGITLGLNLDIKR 405

>Sklu_2437.6 YDR485C, Contig c2437 11696-13861 reverse complement
          Length = 721

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 48  TSTYLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKP----PAYHPTVYNVAI 103
           TS + E +DGE ++ P  D+ +  R V+F + +D+      E P    P+  P+    +I
Sbjct: 428 TSAHTEPVDGECSTSPPSDQQDRPRQVSFAVEDDIAIIDFEEPPSNIGPSKEPSSEPASI 487

Query: 104 VS-----VKLE 109
                  VKLE
Sbjct: 488 AETSAQDVKLE 498

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 152 NLKYDDGAKSLAKGILSL-GNSKKKNDNKIVDTEPHWKRLNAKLE 195
           N+ YD G  S++   L L  ++    DN++ ++ P+WK L A +E
Sbjct: 182 NMTYDSGKMSISVSHLDLVSDTINGPDNRLFNSNPNWKMLAANIE 226

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,869,852
Number of extensions: 875561
Number of successful extensions: 2039
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2075
Number of HSP's successfully gapped: 32
Length of query: 670
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 562
Effective length of database: 12,857,365
Effective search space: 7225839130
Effective search space used: 7225839130
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)