Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06138g53953123630.0
Scas_654.1752341317390.0
YHR135C (YCK1)53838816840.0
YNL154C (YCK2)54633216830.0
Kwal_33.1459650033216720.0
AFR040W54739116760.0
CAGL0J05940g48638316360.0
KLLA0D11044g53642516190.0
Scas_697.1252933515970.0
Scas_627.447534711701e-156
YER123W (YCK3)52436311661e-155
ADL053C47134911501e-153
KLLA0E13563g47334811201e-149
CAGL0K02299g53836211231e-148
Kwal_47.1731442134411071e-148
Sklu_2359.348836711131e-147
KLLA0D03168g5052938111e-102
AFL091W4782938071e-102
Kwal_56.240644752938041e-101
CAGL0H03553g4952938041e-101
Scas_720.244732938001e-101
Sklu_1892.34742938001e-101
YPL204W (HRR25)4942937941e-100
Scas_690.124882896762e-82
KLLA0C08525g15512371882e-14
AAR009W4532151728e-13
Scas_618.84272191672e-12
Kwal_23.632515422321703e-12
YDR490C (PKH1)7662591666e-12
AER264C14832321676e-12
KLLA0E03487g6472301612e-11
CAGL0L03520g14472301623e-11
Kwal_26.735514462291604e-11
AFL101C3672571557e-11
Scas_660.209572811561e-10
Kwal_56.240593532331531e-10
YPL203W (TPK2)3802331503e-10
Sklu_2429.54322161513e-10
KLLA0B02332g3612431503e-10
Sklu_2436.147842431523e-10
KLLA0F13552g12672471514e-10
YFR014C (CMK1)4461781495e-10
KLLA0D03190g3722731485e-10
YJL095W (BCK1)14782871506e-10
YGL158W (RCK1)5122501486e-10
Kwal_0.964272151486e-10
YCR073C (SSK22)13312371497e-10
YOL100W (PKH2)10812581498e-10
AFL090W3462291459e-10
AFR335C10332501481e-09
AEL284C4792391461e-09
Sklu_2437.1610712551462e-09
Kwal_56.226939842741462e-09
Kwal_33.138463752451432e-09
YHR102W (KIC1)10802221462e-09
CAGL0L11550g10722281462e-09
CAGL0J03872g6612641452e-09
Scas_502.211162491452e-09
KLLA0F16467g3401611413e-09
CAGL0F04741g4422431414e-09
YOL016C (CMK2)4472381415e-09
YDR466W (PKH3)8982561425e-09
Kwal_26.778812672181417e-09
CAGL0L07326g5062381398e-09
CAGL0M08910g6121761399e-09
Kwal_47.183076211231399e-09
CAGL0K08514g14892701401e-08
KLLA0F23155g4272421381e-08
Scas_613.55172701381e-08
Scas_711.2515152241382e-08
CAGL0K06479g9912611382e-08
Scas_720.9416832531382e-08
CAGL0G04609g9652571382e-08
Sklu_2232.23741611352e-08
AFR377C7262281372e-08
CAGL0I07513g10762611372e-08
CAGL0M08404g4622281362e-08
Kwal_26.76356912271362e-08
CAGL0G09020g3612291342e-08
Scas_660.286232341353e-08
YOR061W (CKA2)3391551333e-08
KLLA0F14190g13382231363e-08
CAGL0K03399g7032301353e-08
YKL171W9282271353e-08
Scas_673.20*7582261335e-08
YDR477W (SNF1)6332421336e-08
YKL101W (HSL1)15182631337e-08
YHR205W (SCH9)8242341327e-08
YKL166C (TPK3)3982281317e-08
ADR204W3391611307e-08
Scas_690.133542331307e-08
YJL164C (TPK1)3972341317e-08
KLLA0C12485g9252501328e-08
Scas_616.1014612751328e-08
KLLA0B12716g7162311319e-08
YPL153C (RAD53)8212381319e-08
CAGL0G02035g3391541291e-07
YGR052W3692291291e-07
Scas_689.25*4092141291e-07
YPL141C8652771301e-07
Scas_703.57492341301e-07
AFL188C4722381291e-07
CAGL0E05720g3582141281e-07
AFR092W14232221301e-07
ABL028W7222291292e-07
Kwal_47.182335981601292e-07
ABL034W14252201302e-07
YOR233W (KIN4)8002201292e-07
YNL161W (CBK1)7561511282e-07
Sklu_2430.57332291282e-07
CAGL0B04301g5421601272e-07
KLLA0B07205g4552461272e-07
Scas_580.610152421282e-07
KLLA0A03806g6021901272e-07
Sklu_2392.68081551282e-07
KLLA0E01584g4152431262e-07
AEL230W6081601273e-07
Scas_648.173401551253e-07
ADR058C2952051253e-07
CAGL0J06072g7731521273e-07
CAGL0K12562g16821851283e-07
Kwal_14.115915211541273e-07
KLLA0F09020g9281541273e-07
ADL389W7112351263e-07
KLLA0E21780g10162271274e-07
AFR035W7191541264e-07
CAGL0F09075g7461231255e-07
Kwal_14.12734152461245e-07
Kwal_33.145547141551255e-07
Kwal_47.167617441231255e-07
YPL209C (IPL1)3671551236e-07
YBR274W (CHK1)5271091246e-07
Kwal_55.215458652211247e-07
Kwal_56.240913811551227e-07
KLLA0F24618g5561561237e-07
Sklu_2104.12992051217e-07
YNR031C (SSK2)15792531247e-07
Scas_651.183712621228e-07
ACR218W15691541248e-07
ABL011C7012621239e-07
Kwal_26.87098292511239e-07
CAGL0K10604g4462141229e-07
Scas_707.315981541231e-06
Scas_654.127371511231e-06
CAGL0K07458g7041221231e-06
ADL283W3061671201e-06
KLLA0D08415g7741391221e-06
YBR028C5251351211e-06
Kwal_27.119192092051171e-06
KLLA0B03586g7341231212e-06
Scas_721.1246841241212e-06
CAGL0I09504g5282231202e-06
KLLA0D07810g7181521212e-06
Scas_700.546982451202e-06
Kwal_26.87967962151202e-06
Kwal_55.203267502601202e-06
CAGL0I05896g7781841202e-06
AEL083W5361461192e-06
Scas_721.462962051172e-06
Scas_717.696742291192e-06
CAGL0C05005g10762261202e-06
Kwal_55.217093401551173e-06
YJL141C (YAK1)8071841193e-06
Kwal_33.144347591381183e-06
YHL007C (STE20)9392051183e-06
YKL126W (YPK1)6802311183e-06
Kwal_33.139846491821184e-06
CAGL0M02233g7672341184e-06
CAGL0M08316g9642001184e-06
YDL214C (PRR2)6992101174e-06
YGL179C (TOS3)5602421174e-06
Kwal_26.78619552141184e-06
CAGL0M10153g8672081184e-06
CAGL0F00649g5141801174e-06
CAGL0M02299g8932481184e-06
YMR104C (YPK2)6772201166e-06
CAGL0H07535g2982071146e-06
YOR231W (MKK1)5081321157e-06
KLLA0B13607g9892121158e-06
YDL101C (DUN1)5132381148e-06
AEL115C3861071148e-06
KLLA0B09790g2952051139e-06
YFL033C (RIM15)17701781159e-06
Scas_668.228932071141e-05
ABR014W9712071141e-05
Scas_698.373471571121e-05
Scas_683.123562251121e-05
CAGL0F03245g10362771141e-05
Scas_675.25272171131e-05
ACR133C8512251131e-05
KLLA0D10527g6452681122e-05
ACR249C6431861122e-05
KLLA0E14828g3101891102e-05
KLLA0D13266g11522631132e-05
Sklu_1843.34861191112e-05
KLLA0F11143g8132481122e-05
ADL315C4342631112e-05
AFR076W8201961122e-05
Scas_201.1*2741171092e-05
Sklu_2361.38842441122e-05
CAGL0H10318g3071621102e-05
ACR142W8372311122e-05
ACL191C3651601102e-05
Scas_655.28001381112e-05
KLLA0F01507g4721201102e-05
CAGL0K04301g3552371102e-05
ACL104C9472171112e-05
CAGL0K02167g11623291113e-05
YDL159W (STE7)5151191103e-05
Scas_627.73491131093e-05
YOR351C (MEK1)4971891103e-05
CAGL0B01925g9441811103e-05
YNL183C (NPR1)7901381103e-05
CAGL0B02739g6762351103e-05
KLLA0F01276g5192151093e-05
CAGL0K02673g9151301104e-05
Kwal_23.35904992401094e-05
AEL205W7931111094e-05
YPL140C (MKK2)5061271084e-05
Scas_593.14d4952611085e-05
YPL031C (PHO85)3052121075e-05
Sklu_2323.34001061075e-05
YLR113W (HOG1)4351611085e-05
Kwal_23.52908191111085e-05
KLLA0B13112g7302401085e-05
Scas_700.348642301085e-05
AEL120W773611077e-05
CAGL0L12474g3022391057e-05
Scas_613.13*3121751057e-05
Kwal_55.220013632521058e-05
Kwal_14.24974181241068e-05
KLLA0A05819g7041841078e-05
CAGL0I03498g451941068e-05
Scas_705.235531831069e-05
YNL298W (CLA4)8421141069e-05
Scas_640.14*7282251069e-05
Scas_651.37931821069e-05
Scas_667.184371701051e-04
KLLA0F20053g4442031051e-04
Sklu_2366.54661081051e-04
YDL108W (KIN28)3061661041e-04
Scas_713.384321611051e-04
CAGL0M03729g861971061e-04
Scas_640.165051191051e-04
CAGL0J03828g4671331051e-04
Kwal_27.98044731751051e-04
KLLA0A06776g8001801051e-04
Sklu_2385.24342031041e-04
ADR379C4921571041e-04
KLLA0A07403g8791111051e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06138g
         (531 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   914   0.0  
Scas_654.17                                                           674   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   653   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   652   0.0  
Kwal_33.14596                                                         648   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   650   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   634   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   628   0.0  
Scas_697.12                                                           619   0.0  
Scas_627.4                                                            455   e-156
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   453   e-155
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   447   e-153
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   436   e-149
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   437   e-148
Kwal_47.17314                                                         431   e-148
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        433   e-147
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   317   e-102
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   315   e-102
Kwal_56.24064                                                         314   e-101
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   314   e-101
Scas_720.24                                                           312   e-101
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           312   e-101
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   310   e-100
Scas_690.12                                                           265   2e-82
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    77   2e-14
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    71   8e-13
Scas_618.8                                                             69   2e-12
Kwal_23.6325                                                           70   3e-12
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    69   6e-12
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    69   6e-12
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    67   2e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    67   3e-11
Kwal_26.7355                                                           66   4e-11
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    64   7e-11
Scas_660.20                                                            65   1e-10
Kwal_56.24059                                                          64   1e-10
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    62   3e-10
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        63   3e-10
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    62   3e-10
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         63   3e-10
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    63   4e-10
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    62   5e-10
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    62   5e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    62   6e-10
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    62   6e-10
Kwal_0.96                                                              62   6e-10
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    62   7e-10
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    62   8e-10
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    60   9e-10
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    62   1e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    61   1e-09
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      61   2e-09
Kwal_56.22693                                                          61   2e-09
Kwal_33.13846                                                          60   2e-09
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    61   2e-09
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    61   2e-09
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    60   2e-09
Scas_502.2                                                             60   2e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    59   3e-09
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    59   4e-09
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    59   5e-09
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    59   5e-09
Kwal_26.7788                                                           59   7e-09
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    58   8e-09
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    58   9e-09
Kwal_47.18307                                                          58   9e-09
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    59   1e-08
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    58   1e-08
Scas_613.5                                                             58   1e-08
Scas_711.25                                                            58   2e-08
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    58   2e-08
Scas_720.94                                                            58   2e-08
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    58   2e-08
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         57   2e-08
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    57   2e-08
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    57   2e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    57   2e-08
Kwal_26.7635                                                           57   2e-08
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    56   2e-08
Scas_660.28                                                            57   3e-08
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    56   3e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    57   3e-08
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    57   3e-08
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    57   3e-08
Scas_673.20*                                                           56   5e-08
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    56   6e-08
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    56   7e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    55   7e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    55   7e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    55   7e-08
Scas_690.13                                                            55   7e-08
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    55   7e-08
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    55   8e-08
Scas_616.10                                                            55   8e-08
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    55   9e-08
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    55   9e-08
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    54   1e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    54   1e-07
Scas_689.25*                                                           54   1e-07
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    55   1e-07
Scas_703.5                                                             55   1e-07
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    54   1e-07
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    54   1e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    55   1e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    54   2e-07
Kwal_47.18233                                                          54   2e-07
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    55   2e-07
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    54   2e-07
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    54   2e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           54   2e-07
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    54   2e-07
KLLA0B07205g complement(624606..625973) some similarities with s...    54   2e-07
Scas_580.6                                                             54   2e-07
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    54   2e-07
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       54   2e-07
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    53   2e-07
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    54   3e-07
Scas_648.17                                                            53   3e-07
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    53   3e-07
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    54   3e-07
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    54   3e-07
Kwal_14.1159                                                           54   3e-07
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    54   3e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    53   3e-07
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    54   4e-07
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    53   4e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    53   5e-07
Kwal_14.1273                                                           52   5e-07
Kwal_33.14554                                                          53   5e-07
Kwal_47.16761                                                          53   5e-07
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    52   6e-07
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    52   6e-07
Kwal_55.21545                                                          52   7e-07
Kwal_56.24091                                                          52   7e-07
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    52   7e-07
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             51   7e-07
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    52   7e-07
Scas_651.18                                                            52   8e-07
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    52   8e-07
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    52   9e-07
Kwal_26.8709                                                           52   9e-07
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    52   9e-07
Scas_707.3                                                             52   1e-06
Scas_654.12                                                            52   1e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    52   1e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    51   1e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    52   1e-06
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    51   1e-06
Kwal_27.11919                                                          50   1e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    51   2e-06
Scas_721.124                                                           51   2e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    51   2e-06
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    51   2e-06
Scas_700.54                                                            51   2e-06
Kwal_26.8796                                                           51   2e-06
Kwal_55.20326                                                          51   2e-06
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    51   2e-06
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    50   2e-06
Scas_721.46                                                            50   2e-06
Scas_717.69                                                            50   2e-06
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    51   2e-06
Kwal_55.21709                                                          50   3e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    50   3e-06
Kwal_33.14434                                                          50   3e-06
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    50   3e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    50   3e-06
Kwal_33.13984                                                          50   4e-06
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    50   4e-06
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    50   4e-06
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    50   4e-06
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    50   4e-06
Kwal_26.7861                                                           50   4e-06
CAGL0M10153g complement(1010688..1013291) some similarities with...    50   4e-06
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    50   4e-06
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    50   4e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    49   6e-06
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    49   6e-06
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    49   7e-06
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    49   8e-06
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    49   8e-06
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    49   8e-06
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    48   9e-06
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    49   9e-06
Scas_668.22                                                            49   1e-05
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    49   1e-05
Scas_698.37                                                            48   1e-05
Scas_683.12                                                            48   1e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    49   1e-05
Scas_675.2                                                             48   1e-05
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    48   1e-05
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    48   2e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    48   2e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    47   2e-05
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    48   2e-05
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         47   2e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    48   2e-05
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    47   2e-05
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    48   2e-05
Scas_201.1*                                                            47   2e-05
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            48   2e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    47   2e-05
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    48   2e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    47   2e-05
Scas_655.2                                                             47   2e-05
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    47   2e-05
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    47   2e-05
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    47   2e-05
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    47   3e-05
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    47   3e-05
Scas_627.7                                                             47   3e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    47   3e-05
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    47   3e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    47   3e-05
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    47   3e-05
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    47   3e-05
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    47   4e-05
Kwal_23.3590                                                           47   4e-05
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    47   4e-05
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    46   4e-05
Scas_593.14d                                                           46   5e-05
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    46   5e-05
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            46   5e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    46   5e-05
Kwal_23.5290                                                           46   5e-05
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    46   5e-05
Scas_700.34                                                            46   5e-05
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    46   7e-05
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    45   7e-05
Scas_613.13*                                                           45   7e-05
Kwal_55.22001                                                          45   8e-05
Kwal_14.2497                                                           45   8e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    46   8e-05
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    45   8e-05
Scas_705.23                                                            45   9e-05
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    45   9e-05
Scas_640.14*                                                           45   9e-05
Scas_651.3                                                             45   9e-05
Scas_667.18                                                            45   1e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    45   1e-04
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       45   1e-04
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    45   1e-04
Scas_713.38                                                            45   1e-04
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    45   1e-04
Scas_640.16                                                            45   1e-04
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    45   1e-04
Kwal_27.9804                                                           45   1e-04
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    45   1e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         45   1e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    45   1e-04
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    45   1e-04
Kwal_23.6458                                                           45   1e-04
Kwal_26.8703                                                           45   1e-04
Scas_477.5                                                             45   2e-04
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    44   2e-04
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    44   2e-04
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    45   2e-04
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    45   2e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    45   2e-04
Scas_711.15                                                            45   2e-04
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    44   2e-04
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            44   2e-04
Scas_689.22                                                            44   2e-04
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    44   2e-04
Kwal_33.13112                                                          44   2e-04
Scas_716.33                                                            44   2e-04
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         44   3e-04
Scas_635.1                                                             44   3e-04
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    44   3e-04
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      44   3e-04
Kwal_0.155                                                             44   3e-04
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    44   3e-04
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    43   3e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    44   3e-04
Scas_598.6                                                             44   3e-04
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        44   4e-04
Kwal_56.22788                                                          44   4e-04
Scas_700.35                                                            43   4e-04
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    44   4e-04
Scas_671.16                                                            44   4e-04
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    44   4e-04
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    44   4e-04
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    43   4e-04
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    43   4e-04
Scas_720.103                                                           43   5e-04
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         43   5e-04
Kwal_14.1416                                                           43   5e-04
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    43   5e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    43   5e-04
Kwal_33.14192                                                          43   5e-04
Scas_629.16                                                            43   5e-04
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    43   6e-04
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    43   6e-04
Scas_544.6                                                             43   6e-04
CAGL0K01661g complement(146952..148400) some similarities with t...    43   6e-04
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    42   6e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    43   6e-04
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    43   6e-04
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    42   7e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    43   7e-04
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    43   7e-04
Scas_568.9*                                                            42   7e-04
Kwal_14.1249                                                           42   7e-04
Scas_713.21                                                            43   7e-04
Scas_649.30                                                            42   9e-04
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    42   0.001
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    42   0.001
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    42   0.001
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    42   0.001
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    42   0.001
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    42   0.001
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    42   0.001
Kwal_26.7276                                                           42   0.001
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    42   0.001
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    42   0.001
Scas_623.11                                                            42   0.001
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    42   0.001
Kwal_55.21900                                                          42   0.001
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    42   0.001
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    42   0.001
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    42   0.001
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    42   0.001
Kwal_27.11542                                                          42   0.001
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    42   0.001
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         42   0.002
Scas_602.11                                                            42   0.002
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    42   0.002
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    41   0.002
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    41   0.002
Scas_693.17                                                            42   0.002
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    41   0.002
Kwal_56.24584                                                          41   0.002
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    41   0.002
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    41   0.002
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    41   0.002
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    40   0.002
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         41   0.002
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    41   0.003
Kwal_26.7552                                                           40   0.003
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    40   0.003
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    41   0.003
Scas_685.24                                                            40   0.003
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    41   0.003
Scas_707.36                                                            40   0.003
Kwal_23.4276                                                           40   0.003
Scas_721.132                                                           40   0.003
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    40   0.003
Scas_653.25                                                            40   0.003
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    40   0.003
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    40   0.004
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    40   0.004
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    40   0.004
Scas_718.72                                                            40   0.004
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    40   0.004
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    40   0.004
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    40   0.004
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    40   0.004
KLLA0C03938g complement(358851..360632) some similarities with s...    40   0.004
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    40   0.004
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          40   0.004
Scas_584.8                                                             40   0.005
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    40   0.005
Scas_336.1                                                             40   0.005
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    40   0.005
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         40   0.005
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    40   0.005
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      40   0.005
Kwal_56.23717                                                          40   0.005
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    40   0.005
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    40   0.005
Kwal_56.23841                                                          40   0.005
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    40   0.006
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    40   0.006
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    39   0.006
Scas_661.27                                                            40   0.006
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    40   0.006
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    39   0.007
Kwal_17.2687                                                           39   0.007
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    39   0.007
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           40   0.007
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    39   0.007
KLLA0F22297g complement(2083448..2085547) some similarities with...    39   0.007
Kwal_23.5668                                                           40   0.007
Scas_584.11                                                            40   0.007
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    39   0.007
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    39   0.007
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    39   0.007
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    39   0.007
Kwal_47.17868                                                          39   0.008
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    39   0.008
Kwal_27.10581                                                          39   0.008
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    39   0.009
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    39   0.009
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    39   0.010
Kwal_27.11777                                                          39   0.010
Kwal_56.22476                                                          39   0.010
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    39   0.010
Scas_677.18                                                            39   0.011
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    39   0.011
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    39   0.011
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          39   0.011
KLLA0C16577g complement(1451181..1452695) some similarities with...    39   0.011
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            39   0.012
Kwal_55.20221                                                          39   0.012
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    39   0.013
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    38   0.013
Scas_619.5*                                                            39   0.013
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    39   0.013
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    39   0.015
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    38   0.015
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    39   0.015
Kwal_33.14167                                                          39   0.015
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    38   0.015
Scas_707.34                                                            39   0.016
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          38   0.016
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    39   0.016
Scas_713.7                                                             39   0.016
Scas_493.2                                                             39   0.016
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    39   0.017
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    38   0.018
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    38   0.018
Scas_610.7                                                             38   0.019
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    38   0.019
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    38   0.020
KLLA0D09328g complement(788565..791705) some similarities with s...    38   0.020
Kwal_47.17252                                                          38   0.021
Scas_715.34                                                            38   0.021
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    38   0.021
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    38   0.021
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    38   0.021
Kwal_26.7682                                                           38   0.024
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    38   0.024
Scas_703.47                                                            38   0.024
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    38   0.025
Kwal_27.11803                                                          37   0.027
Scas_564.7                                                             38   0.028
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    37   0.029
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    38   0.029
Scas_680.20                                                            37   0.030
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    37   0.030
Kwal_47.17263                                                          37   0.032
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    37   0.033
Kwal_55.20189                                                          37   0.034
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    37   0.037
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    37   0.037
Kwal_47.17345                                                          37   0.037
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    37   0.037
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    37   0.040
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    37   0.040
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    37   0.040
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    37   0.041
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    37   0.043
Kwal_23.3992                                                           37   0.044
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            37   0.045
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    37   0.046
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    37   0.048
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    37   0.050
Scas_582.1                                                             37   0.051
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    37   0.052
Scas_573.10                                                            37   0.053
KLLA0D12100g complement(1031728..1033161) some similarities with...    37   0.053
Kwal_23.5576                                                           37   0.054
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    37   0.055
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    36   0.058
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    37   0.059
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    36   0.060
Scas_695.33                                                            36   0.064
Scas_721.61                                                            36   0.069
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    36   0.070
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    36   0.078
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    36   0.080
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    36   0.081
KLLA0E11979g complement(1060048..1061892) some similarities with...    36   0.087
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    36   0.088
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    36   0.089
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    36   0.093
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    36   0.093
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    35   0.11 
Scas_689.24                                                            35   0.11 
Kwal_27.9763                                                           35   0.11 
Scas_688.14                                                            35   0.11 
Kwal_23.3471                                                           35   0.12 
Kwal_27.12559                                                          35   0.13 
Kwal_27.10004                                                          35   0.13 
Scas_568.13                                                            35   0.13 
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    35   0.13 
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            35   0.14 
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    35   0.15 
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            35   0.16 
Scas_683.6                                                             35   0.16 
Scas_548.6                                                             35   0.18 
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    35   0.19 
Scas_710.28                                                            35   0.19 
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    35   0.20 
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    34   0.21 
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    35   0.21 
Sklu_1883.2 YKL171W, Contig c1883 1300-4338                            35   0.22 
KLLA0A06820g complement(615686..618004) some similarities with s...    35   0.22 
Kwal_33.13222                                                          33   0.23 
Scas_618.15                                                            35   0.23 
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    34   0.23 

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/531 (84%), Positives = 451/531 (84%)

Query: 1   MSRYQNSPXXXXXXXXXXXXXXXXGGYPAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLH 60
           MSRYQNSP                GGYPAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLH
Sbjct: 1   MSRYQNSPAVTAANTAMAVNNLTNGGYPAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLH 60

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQA 120
           YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQA
Sbjct: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQA 120

Query: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD 180
           YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD
Sbjct: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD 180

Query: 181 IKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL 240
           IKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL
Sbjct: 181 IKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL 240

Query: 241 GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSNGYPV 300
           GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSNGYPV
Sbjct: 241 GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSNGYPV 300

Query: 301 QFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKK 360
           QFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKK
Sbjct: 301 QFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKK 360

Query: 361 PNLHGYGHPNPPNDKRRHKNKMTNPXXXXXXXXXXXYPDQTHHNQIQSHQAGIGGNADNA 420
           PNLHGYGHPNPPNDKRRHKNKMTNP           YPDQTHHNQIQSHQAGIGGNADNA
Sbjct: 361 PNLHGYGHPNPPNDKRRHKNKMTNPLQQLAGQQQGQYPDQTHHNQIQSHQAGIGGNADNA 420

Query: 421 NQMQNKRNLDPTSYEAYXXXXXXXXXXXXXXXXXXXXXXXXXXXVQDNGGLRNYNNAQAQ 480
           NQMQNKRNLDPTSYEAY                           VQDNGGLRNYNNAQAQ
Sbjct: 421 NQMQNKRNLDPTSYEAYQQQLQHKYNQQTQRQQRQQPPAMQGQRVQDNGGLRNYNNAQAQ 480

Query: 481 DLQGNRYRQQQEPMVXXXXXXXXXXXXXXXXXXXXXXXXXXDYTTTSSEKG 531
           DLQGNRYRQQQEPMV                          DYTTTSSEKG
Sbjct: 481 DLQGNRYRQQQEPMVQPPNNPAQATPNNRQQFQQHTEQVEQDYTTTSSEKG 531

>Scas_654.17
          Length = 523

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/413 (79%), Positives = 347/413 (84%), Gaps = 13/413 (3%)

Query: 34  APYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEP 93
            P N TP++ +S   + RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEP
Sbjct: 43  TPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEP 102

Query: 94  RKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFS 153
           RKTEAPQLKDEYRTYKI+ GTP VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC RKFS
Sbjct: 103 RKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFS 162

Query: 154 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
           VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFL+GRPG  D NKIHLIDFGMAKQYRDP
Sbjct: 163 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222

Query: 214 KTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
           KTKQHIPYRE+KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP
Sbjct: 223 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282

Query: 274 NNKQKYEKIGEKKRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDD 333
           NNKQKYEKIGEKKRTTNVYDL+ G P+QFGRYLEIVR+LSFEETPDY+GYR LLLS LDD
Sbjct: 283 NNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDD 342

Query: 334 MNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKMT-------NP 385
           +  SADG YDWMKLNGGRGWDL INKKPNLHGYGHPNPPN+K +RH+NK+        NP
Sbjct: 343 LGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNP 402

Query: 386 XXXXXXXXXXXYPDQTHHNQIQSHQAGIGGNADNANQM-QNKRNLDPTSYEAY 437
                           HH         +  N    N M QN+  LDPTSYEAY
Sbjct: 403 QQRQTNSPLHT----AHHTPQPPQLQPLQQNQHTENDMQQNEAQLDPTSYEAY 451

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/388 (82%), Positives = 337/388 (86%), Gaps = 11/388 (2%)

Query: 51  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI 110
           RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TYKI
Sbjct: 59  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKI 118

Query: 111 MAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 170
           + GTPN+P AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED
Sbjct: 119 LNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LHAHDLIYRDIKPDNFLIGRPGQPD N IHLIDFGMAKQYRDPKTKQHIPYRE+KSLSGT
Sbjct: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR+TN
Sbjct: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTN 298

Query: 291 VYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGG 350
           VYDL+ G PVQFGRYLEIVRSLSFEE PDY+GYRKLLLSVLDD+ ++ADG YDWMKLN G
Sbjct: 299 VYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDG 358

Query: 351 RGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKMTNPXXXXXXXXXXXYPDQTHHNQIQSH 409
           RGWDL INKKPNLHGYGHPNPPN+K R+H+NK                  Q +  + +  
Sbjct: 359 RGWDLNINKKPNLHGYGHPNPPNEKSRKHRNKQLQMQQLQMQQLQQQQQQQQYAQKTE-- 416

Query: 410 QAGIGGNADNANQMQNKRNLDPTSYEAY 437
                  AD  N  Q K  LDPTSYEAY
Sbjct: 417 -------ADMRNS-QYKPKLDPTSYEAY 436

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/332 (91%), Positives = 322/332 (96%), Gaps = 1/332 (0%)

Query: 51  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI 110
           RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEYRTYKI
Sbjct: 66  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKI 125

Query: 111 MAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 170
           +AGTP +PQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIED
Sbjct: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LHAHDLIYRDIKPDNFLIGRPGQPD NK+HLIDFGMAKQYRDPKTKQHIPYRE+KSLSGT
Sbjct: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           ARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTN 305

Query: 291 VYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGG 350
           VYDL+ G P+QFGRYLEIVR+LSFEETPDY+GYR LLLSVLDD+ ++ADG YDWMKLNGG
Sbjct: 306 VYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGG 365

Query: 351 RGWDLTINKKPNLHGYGHPNPPNDK-RRHKNK 381
           RGWDL+INKKPNLHGYGHPNPPN+K +RH++K
Sbjct: 366 RGWDLSINKKPNLHGYGHPNPPNEKSKRHRSK 397

>Kwal_33.14596
          Length = 500

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/332 (90%), Positives = 320/332 (96%), Gaps = 1/332 (0%)

Query: 51  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI 110
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81

Query: 111 MAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 170
           +AGT  +PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIED
Sbjct: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LH HDLIYRDIKPDNFLIGRPG PDENK+HLIDFGMAKQYRDPKTKQHIPYRE+KSLSGT
Sbjct: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261

Query: 291 VYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGG 350
           VYDL+ G PVQFGRYLE+VRSL+FEETPDY+GYRKL LS+LDDM++ ADG YDWMKLNGG
Sbjct: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321

Query: 351 RGWDLTINKKPNLHGYGHPNPPNDK-RRHKNK 381
           RGWDL INKKPNLHGYGHPNPPNDK RRH++K
Sbjct: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSK 353

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/391 (81%), Positives = 341/391 (87%), Gaps = 20/391 (5%)

Query: 46  SNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEY 105
           S ++ RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEY
Sbjct: 54  STVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY 113

Query: 106 RTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMI 165
           RTYKI+AGT  VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMI
Sbjct: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173

Query: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
           TLIEDLHAHDLIYRDIKPDNFLIGRP QPD NK+HLIDFGMAK YRDPKTKQHIPYRE+K
Sbjct: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233

Query: 226 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 285
           SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK
Sbjct: 234 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 293

Query: 286 KRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWM 345
           KR+TNVYDLS G PVQFGRYLEIVR+L FEETPDY GYRKLLLS L+++    DG YDWM
Sbjct: 294 KRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWM 353

Query: 346 KLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKMTNPXXXXXXXXXXXYPDQTHHN 404
           KLNGGRGWDLTINKKPNLHGYGHPNPPN+K RRH++K               YP  +   
Sbjct: 354 KLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK---------------YPQPSAPQ 398

Query: 405 QIQSHQAGIGGNADNANQMQNKRNLDPTSYE 435
           Q+ S Q    G    ++Q+Q ++ LDPTSYE
Sbjct: 399 QMSSPQDPRYG----SSQLQLQQRLDPTSYE 425

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/383 (80%), Positives = 328/383 (85%), Gaps = 32/383 (8%)

Query: 55  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT 114
           TI GLHY+IGKKIGEGSFGVLFEGTN+INGMPVA+KFEPRKTEAPQLKDEYRTYKI+AGT
Sbjct: 35  TIAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGT 94

Query: 115 PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
           P VPQAYYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVVQVAVQMITLIEDLHAH
Sbjct: 95  PGVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAH 154

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           DLIYRDIKPDNFL+GRPGQPDEN IHLIDFGMAKQYRDPKTKQHIPYRE+KSLSGTARYM
Sbjct: 155 DLIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 214

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKRTT+VYDL
Sbjct: 215 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDL 274

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWD 354
           +NGYPVQF RYLEIVR+L F+ETPDY+GYRKLL S LDD+ ++ DG YDWM+LNGGRGWD
Sbjct: 275 ANGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD 334

Query: 355 LTINKKPNLHGYGHPNPPNDKRRHKNKMTNPXXXXXXXXXXXYPDQTHHNQIQSHQAGIG 414
           LTINKKPNLHGYGHPNPP DK  H+N+                             A  G
Sbjct: 335 LTINKKPNLHGYGHPNPPGDKS-HRNR----------------------------NAAKG 365

Query: 415 GNADNANQMQNKRNLDPTSYEAY 437
           GN  N     N   LDPTSYEAY
Sbjct: 366 GNHAND---ANHGGLDPTSYEAY 385

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/425 (72%), Positives = 338/425 (79%), Gaps = 28/425 (6%)

Query: 33  NAPYNGTPSNRSSSNMTS-RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKF 91
           N   NG    +SS++ TS RDDSTIVGLHYKIGKKIGEGSFGVLFEG NMIN +PVAIKF
Sbjct: 48  NGLANGATGLQSSASSTSTRDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKF 107

Query: 92  EPRKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK 151
           EPRKT+APQLKDEYRTYKI++G+  +PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+
Sbjct: 108 EPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR 167

Query: 152 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYR 211
           FS+KTVV VA+QMITLIE+LH HDLIYRDIKPDNFLIGRP QPD N +HLIDFGMAK YR
Sbjct: 168 FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYR 227

Query: 212 DPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 271
           DPKTKQHIPYRE+KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK
Sbjct: 228 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 287

Query: 272 APNNKQKYEKIGEKKRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVL 331
           A NNK KYEKIGEKKR+TNVYDLS G PVQFGRYLEIVR+L FEETPDY+GYRKLLLSVL
Sbjct: 288 AANNKLKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVL 347

Query: 332 DDMNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKMTNPXXXXX 390
           D++    DG YDWMKLNGGRGWDL INKKPNLHGYGHP PPN+K +RH+NK         
Sbjct: 348 DELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVN 407

Query: 391 XXXXXXYPDQTHHNQIQSHQAGIGGNADNANQMQNK------------------RNLDPT 432
                  P Q+H        + + G  D    + N                   + LDP 
Sbjct: 408 NLNGSNVPLQSH--------SPLPGGTDLTQGVSNAPQQPQQIMSQQQYQQHTQQRLDPM 459

Query: 433 SYEAY 437
           SYEAY
Sbjct: 460 SYEAY 464

>Scas_697.12
          Length = 529

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/335 (89%), Positives = 316/335 (94%), Gaps = 1/335 (0%)

Query: 46  SNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEY 105
           S  T  D+STIVGLHY+IGKKIGEGSFGVLFEG NMING PVAIKFEPRKTEAPQLKDEY
Sbjct: 33  STSTHDDNSTIVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEY 92

Query: 106 RTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMI 165
           RTYKI+AGTPN+P AYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQMI
Sbjct: 93  RTYKILAGTPNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMI 152

Query: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
           TLIEDLHA+DLIYRDIKPDNFLIGRPGQPDEN IHLIDFGMAKQYRDPKTKQHIPYRE+K
Sbjct: 153 TLIEDLHANDLIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKK 212

Query: 226 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 285
           SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEK
Sbjct: 213 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEK 272

Query: 286 KRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWM 345
           KRTTNVYDL+ G PVQF RYLE+VR+LSFEETPDY+GYR+LLLS LDD+  SADG YDWM
Sbjct: 273 KRTTNVYDLAQGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWM 332

Query: 346 KLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHK 379
           KLNGG+GWDL INKKPNLHGYGHP PPN+K RRH+
Sbjct: 333 KLNGGKGWDLNINKKPNLHGYGHPTPPNEKSRRHR 367

>Scas_627.4
          Length = 475

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 259/347 (74%), Gaps = 18/347 (5%)

Query: 56  IVGLHYKIGKKIGEGSFGVLFEGTNMI---NGMPVAIKFEPRKTEAPQLKDEYRTYKIMA 112
           IVG+HY +G KIGEGSFGV+FEG N++   +  PVAIKFEPR ++APQL+DE+R+YKI+ 
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 113 GTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
               +P  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 173 AHDLIYRDIKPDNFLIGR-------------PGQPDENKIHLIDFGMAKQYRDPKTKQHI 219
            HDLIYRDIKPDNFLI +                 D N I+L+DFGMAKQ+RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 220 PYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 279
           PYRERKSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 280 EKIGEKKRTTNVYDL--SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDS 337
           EKIG  K+  N  DL  +N  P QF  YL+  RSL FE+ PDY     L+   L+++N  
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 338 ADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDKRRHKNKMTN 384
            DG YDWM LN G+GWD+ INK+ NLHGYG+PNP N  + +    TN
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQTKTYDQTNTN 356

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  453 bits (1166), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/363 (60%), Positives = 261/363 (71%), Gaps = 43/363 (11%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGM-----------------PVAIK 90
           M+ R    IVG+HY +G KIGEGSFGV+FEG N+++                   PVAIK
Sbjct: 1   MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIK 60

Query: 91  FEPRKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR 150
           FEPR ++APQL+DE+R Y+I+ G   +P AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR
Sbjct: 61  FEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGR 120

Query: 151 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR----------------PGQP 194
           KFSVKT   VA QMI  +  +H HDLIYRDIKPDNFLI +                    
Sbjct: 121 KFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNN 180

Query: 195 DENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALG 254
           D N I+++DFGMAKQYRDP+TKQHIPYRERKSLSGTARYMSINTH GREQSRRDD+E+LG
Sbjct: 181 DPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG 240

Query: 255 HVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYD--LSNGYPVQFGRYLEIVRSL 312
           HVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  D  L+N  P QF  YL+  RSL
Sbjct: 241 HVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSL 300

Query: 313 SFEETPDYQGYRKLLLSVLDD---MND-SADGTYDWMKLNGGRGWDLTINKKPNLHGYGH 368
            F+E PDY      L+S++DD   +ND   DG YDWM LNGG+GW++ IN++ NLHGYG+
Sbjct: 301 KFDEDPDYD----YLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGN 356

Query: 369 PNP 371
           PNP
Sbjct: 357 PNP 359

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  447 bits (1150), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 256/349 (73%), Gaps = 22/349 (6%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING-----MPVAIKFEPRKTEAPQLK 102
           M +R    +VG+HY +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+++APQL+
Sbjct: 1   MGNRGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLR 60

Query: 103 DEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV 162
           DE+R Y+I+ G   +P+AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FSVKT   +A 
Sbjct: 61  DEFRAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAK 120

Query: 163 QMITLIEDLHAHDLIYRDIKPDNFLIGR----------------PGQPDENKIHLIDFGM 206
           QMI  +  +H  DLIYRDIKPDNFLI                      D N I+++DFGM
Sbjct: 121 QMIERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGM 180

Query: 207 AKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 266
           AKQYRDPKTKQHIPYRERKSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LP
Sbjct: 181 AKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLP 240

Query: 267 WQGLKAPNNKQKYEKIGEKKRTTNVYDL-SNGYPVQFGRYLEIVRSLSFEETPDYQGYRK 325
           WQGLKAPNNK KYEKIG  K+     +L S   PVQF  YL+  RSL F+E PDY     
Sbjct: 241 WQGLKAPNNKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLIS 300

Query: 326 LLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPND 374
           L+ SV+ D+N   +  YDWM LN   GW++ +NK+ NLHGYG+P+P N+
Sbjct: 301 LMDSVMHDLNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRNN 349

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  436 bits (1120), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 250/348 (71%), Gaps = 20/348 (5%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING---MPVAIKFEPRKTEAPQLKDE 104
           M+ R    +VG+HY +G KIGEGSFG++FEG N++NG    PVAIKFEPR++++PQL+DE
Sbjct: 1   MSKRSSQHVVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDE 60

Query: 105 YRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 164
           +R Y+I+     +P AYYF QEG+HNIL+IDLLGPSLEDLF+WC RKFSVKT   +A QM
Sbjct: 61  FRAYRILNDVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQM 120

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGR----------------PGQPDENKIHLIDFGMAK 208
           I  +  +H HDLIYRDIKPDNFLI                      D N I+++DFGMAK
Sbjct: 121 IDRVRSIHEHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAK 180

Query: 209 QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           Q+RDP TKQHIPYRERKSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQ
Sbjct: 181 QFRDPNTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQ 240

Query: 269 GLKAPNNKQKYEKIGEKKRTTNVYD-LSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLL 327
           GLKA NNK KYEKIG  K+     D L+   P QF  YL   RSL F++ PDY     L+
Sbjct: 241 GLKALNNKAKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLM 300

Query: 328 LSVLDDMNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDK 375
             ++ +     DG YDWM LNGG+GW++ +NK+ NLHGYG+P P N K
Sbjct: 301 TQIMQENGYEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  437 bits (1123), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/362 (58%), Positives = 250/362 (69%), Gaps = 46/362 (12%)

Query: 56  IVGLHYKIGKKIGEGSFGVLFEGTNMIN---------------------------GMPVA 88
           +VG+HY +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 89  IKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 148
           IKFEPR ++APQL+DE+R Y+I+ G+  +P AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 149 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI-----------------GRP 191
           GRKFS+KT   +A QMI  +  +H HDLIYRDIKPDNFLI                  + 
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 192 GQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDME 251
              D N I+++DFGMAKQYRDP+TKQHIPYRERKSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 252 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYD--LSNGYPVQFGRYLEIV 309
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  LSN  P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 310 RSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHP 369
           RSL F+E PDY     L+  VL       DG YDWM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 370 NP 371
            P
Sbjct: 377 QP 378

>Kwal_47.17314
          Length = 421

 Score =  431 bits (1107), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 246/344 (71%), Gaps = 19/344 (5%)

Query: 56  IVGLHYKIGKKIGEGSFGVLFEGTNMIN--GMPVAIKFEPRKTEAPQLKDEYRTYKIMAG 113
           IVG+HY +G KIGEGSFGV+FEG N++N    PVAIKFEPR+TEAPQL+DE+R YKI+ G
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
              +P+A+YFGQEG+HN+L+IDLLGPSLEDLF+WCGR+FSVKT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 174 HDLIYRDIKPDNFLIGR----------------PGQPDENKIHLIDFGMAKQYRDPKTKQ 217
            DLIYRDIKPDNFLI                      + N ++++DFGMAKQYRDPKTKQ
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQYRDPKTKQ 187

Query: 218 HIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 277
           HIPY+ERKSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK  N K 
Sbjct: 188 HIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANTKL 247

Query: 278 KYEKIGEKKRTTNVYD-LSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMND 336
           KYEKIG  K+     D L    P QF  YL   RSL FEE PDY     L+   L +   
Sbjct: 248 KYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQERGY 307

Query: 337 SADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDKRRHKN 380
             D  YDW+ LN G+GW++ +N++ NLHGYG+P P   +   K+
Sbjct: 308 EEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAARKS 351

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  433 bits (1113), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 213/367 (58%), Positives = 257/367 (70%), Gaps = 37/367 (10%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGM--------------------PV 87
           M+ R    +VG+HY +G KIGEGSFGV+FEG N++N                      PV
Sbjct: 1   MSKRGSQHVVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPV 60

Query: 88  AIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDW 147
           AIKFEPR+++APQL+DE+R Y+I+ G   +P AYYFGQEG+HN+L+IDLLGPSLEDLF+W
Sbjct: 61  AIKFEPRRSDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEW 120

Query: 148 CGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR------PGQP------- 194
           CG +FSVKT   VA QMI  +  +H  DLIYRDIKPDNFLI         GQ        
Sbjct: 121 CGHRFSVKTTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSS 180

Query: 195 ---DENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDME 251
              D N I+++DFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 181 SNGDPNLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 240

Query: 252 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG-EKKRTTNVYDLSNGYPVQFGRYLEIVR 310
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+R +    LS+G P QF  YL+  R
Sbjct: 241 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCR 300

Query: 311 SLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPN 370
           +L F+E PDY     L+   L+      DG YDWM LN G+GW++ +N++ NLHGYG+P 
Sbjct: 301 NLKFDEDPDYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPT 360

Query: 371 PPNDKRR 377
           P + K +
Sbjct: 361 PRDQKAK 367

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD ++  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK    V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  315 bits (807), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 206/293 (70%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKFS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K++RD +T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>Kwal_56.24064
          Length = 475

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  Y+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK ++G   
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   ++   D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLGIKLDYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_720.24
          Length = 473

 Score =  312 bits (800), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKF+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 177 IYRDIKPDNFLIG--RPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL+G  R G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGTGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CAGLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  312 bits (800), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 202/293 (68%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L
Sbjct: 181 SLNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
             G P++F  Y+   R+L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  310 bits (794), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/293 (50%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R Y+ ++G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 177 IYRDIKPDNFL--IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 294
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL 240

Query: 295 SNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKL 347
            +G P++F  Y+   ++L F+E PDY    +L   +   +    D  +DW  L
Sbjct: 241 CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  265 bits (676), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 130/289 (44%), Positives = 190/289 (65%), Gaps = 3/289 (1%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMA-GTP 115
           VG  Y++G++IG GSFG ++ G ++I+G  +AIK E  +T  PQL+ E R Y  ++ G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
            +P    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235
            ++RDIKP+NFL+G   +   N ++LIDFG++K+YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTGRRA--NIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLS 295
           +NTH G EQSRRDD+E+LG+V  YF +G LPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 296 NGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDW 344
            G P QF  Y+  VRSL +++ PDY    +L  ++ + +N + D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 113/237 (47%), Gaps = 31/237 (13%)

Query: 54   STIVGLHYKIGKK--IGEGSFGVLFEGTNMINGMPVAIK------FEPRKTEAPQLKDEY 105
            S+I  L  +  K+  IG GSFG ++   N+  G  +A+K       +  K   P LK+E 
Sbjct: 1250 SSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 106  RTYKIMAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV- 160
            R  +I+   PN+ Q  Y+G E +H    NI +    G SL  L +  GR    + V QV 
Sbjct: 1310 RVMEIL-NHPNIVQ--YYGVE-VHRDKVNIFMEFCEGSSLASLLE-HGR-IEDEMVTQVY 1363

Query: 161  AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP 220
             +Q++  +  LH   +++RDIKP+N L+ R G      I  +DFG AK      +K+   
Sbjct: 1364 TLQLLEGLACLHQSGVVHRDIKPENILLDRNGV-----IKYVDFGAAKLIAKNGSKRISL 1418

Query: 221  YRERKS-----LSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 270
                KS     + GT  YM+  T  G+   +   DD+ +LG V    + G+ PW  L
Sbjct: 1419 DANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 107/215 (49%), Gaps = 22/215 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT----EAPQLKDEYRTYKIMAGTPN 116
           Y  GK +G G+FGV+ +  N      VAIK   ++     E   L DE    + +   PN
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKL-DHPN 114

Query: 117 VPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 172
           + +   ++  +E  + +  +   G    +LFD   +K  F+    V++ VQM+T +E +H
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGG----ELFDRILKKGKFTETDAVKIVVQMLTAVEYMH 170

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
           + ++++RD+KP+N L   P   DE+++ + DFG+AKQ     ++  + +R     +G+  
Sbjct: 171 SQNVVHRDLKPENVLYLDPS--DESQLVISDFGIAKQL---SSESQLIHRA----AGSMG 221

Query: 233 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           Y++          +  D+ +LG + +  L G  P+
Sbjct: 222 YVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_618.8
          Length = 427

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 107/219 (48%), Gaps = 22/219 (10%)

Query: 54  STIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK------FEPRKTEAPQLKDEYRT 107
           S +    Y+ GK +G GSFGV+ E T   N   VAIK       E  + +   L DE   
Sbjct: 20  SKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTI 79

Query: 108 YKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMI 165
            K +     V    +F  E    I ++  L    E LFD   +K  FS    V++ +Q++
Sbjct: 80  LKKLHHPNIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQIL 136

Query: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
           + +E +H+ D+++RD+KP+N L     + +++++ + DFG+AK+    K  + + ++   
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLL--YLTEKEDSELVIADFGIAKEL---KKGEQLIFKAAG 191

Query: 226 SLSGTA-RYMSINTHLGREQSRRDDMEALGHVFFYFLRG 263
           SL   A   ++++ H      +  D+ ++G + +  L G
Sbjct: 192 SLGYVAPEVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>Kwal_23.6325
          Length = 1542

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 111/232 (47%), Gaps = 29/232 (12%)

Query: 57   VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVA---IKFEPRKTEA---PQLKDEYRTYKI 110
            V + ++  + +G G+FG +F   N+  G  +A   IK + RK+     P +K+E    + 
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLE- 1303

Query: 111  MAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 165
            M   PNV Q  Y+G E +H    N+ +    G SL  L +  GR    + V Q+ A+QM+
Sbjct: 1304 MLNHPNVVQ--YYGVE-VHRDKVNLFMEYCEGGSLAQLLEH-GR-IEDEMVTQIYALQML 1358

Query: 166  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
              +  LH   +++RDIKP+N L+   G      I  +DFG A+      TK      E K
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILLDFNGV-----IKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 226  -----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 270
                 S+ GT  YMS  +  G ++ +    D+ +LG V    + G+ PW  L
Sbjct: 1414 ADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 117/259 (45%), Gaps = 42/259 (16%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMA-----GTP 115
           +K G+++G+GS+  +   T   +G   A+K   ++    Q K +Y T + +A     GT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 116 NVPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRKFSVKTVVQVAVQMITL 167
            + + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 168 IEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQY-RDPK-TKQHIP---- 220
           ++ LH   +I+RDIKP+N L+      D+N K+ L DFG AK    +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 221 YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 281 KIGEKKRTTNVYDLSNGYP 299
           K+ + +     Y  + G+P
Sbjct: 348 KVMKIQ-----YAFTAGFP 361

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 107/232 (46%), Gaps = 32/232 (13%)

Query: 57   VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVA---IKFEPRKT---EAPQLKDEYRTYKI 110
            V + ++    IG GSFG ++   N+  G  +A   IKF  RKT     P ++DE    + 
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLE- 1245

Query: 111  MAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 165
            M   PNV Q  Y+G E +H    NI +    G SL  L      +   + V QV ++QM+
Sbjct: 1246 MLNHPNVVQ--YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 166  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK-----QHIP 220
              +  LH   + +RDIKP+N L+   G      I  +DFG AK      +K     QH+ 
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILLDFNG-----IIKYVDFGAAKVLASNGSKKLNLEQHM- 1354

Query: 221  YRERKSLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 270
              E + + GT  YMS     G    +   DD+ +LG V    + G+ PW  L
Sbjct: 1355 --EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 101/230 (43%), Gaps = 22/230 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYK-----IMA--G 113
           +   +++G GS+  +++  +   G   AIK   +K    + K +Y T +     ++A   
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 114 TPNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
            P + + YY   +  +   V+D   G  L  L    GR F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
              +++RD+KP+N L+       E K+ + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLS-----SEGKLMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 233 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 108/230 (46%), Gaps = 43/230 (18%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ--------------LKDEYRTYK 109
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              LK E  T K
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVK----QVEVPKYGTQNELVKDMVEALKSEVATLK 1209

Query: 110  IMAGTPNVPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
             +    N+ Q  Y G E   NI  + L    G S+  L    GR F  K +  +  Q+++
Sbjct: 1210 DLDHL-NIVQ--YLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLS 1265

Query: 167  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLI-DFGMAKQYRDPKTKQHIPYRERK 225
             ++ LH+  +++RD+K DN L+      DE+ I  I DFG++K+ ++  +   +  R   
Sbjct: 1266 GLKYLHSKGILHRDMKADNLLL------DEDGICKISDFGISKKSKNIYSNSDMTMR--- 1316

Query: 226  SLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
               GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1317 ---GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>Kwal_26.7355
          Length = 1446

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 107/229 (46%), Gaps = 41/229 (17%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ--------------LKDEYRTYK 109
            G+ IG+GSFG +F G N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 110  IMAGTPNVPQAYYFGQEG---LHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
             +  T N+ Q  Y G E    ++++ +  + G S+  L    G KF    +  +AVQ++ 
Sbjct: 1205 DLDHT-NIVQ--YLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLR 1260

Query: 167  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKS 226
             +  LH+  +++RD+K DN L+   G        + DFG++K+  +  +   +  R    
Sbjct: 1261 GLSYLHSKKILHRDMKADNLLLDVDGI-----CKISDFGISKKSNNIYSNSDMTMR---- 1311

Query: 227  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
              GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1312 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1356

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 115/257 (44%), Gaps = 28/257 (10%)

Query: 25  GGYPAMNANAPYNGTPSNRSSSNMTSRDDSTIVG-------LHYKIGKKIGEGSFGVLFE 77
           G  P +  +   N +P N++     +R     +          ++IGK +G+G FG ++ 
Sbjct: 66  GKRPTLEISELKNVSPINQAHKTGKARAGGVPLSKLQNLKLADFEIGKVLGKGKFGRVYC 125

Query: 78  GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGT---PNVPQAY-YFGQEGLHNIL 132
             ++ +G   A+K  E +      ++ ++R    +  +   PN+ Q Y YF  E    +L
Sbjct: 126 VRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLL 185

Query: 133 VIDLLGPSLEDLFDWCGRKFSVKTVVQVAV-QMITLIEDLHAHDLIYRDIKPDNFLIGRP 191
           +  L+   L       GR      V    V QM   ++ +H  ++++RDIKP+N +IG  
Sbjct: 186 MEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGF- 242

Query: 192 GQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDME 251
                N I L DFG +     PK  +      RK+L GT  Y+S      RE + + D+ 
Sbjct: 243 ----NNTIKLTDFGWS--VITPKGSK------RKTLCGTVDYLSPELIRSREYNEKVDVW 290

Query: 252 ALGHVFFYFLRGQLPWQ 268
           ALG + +  L G  P++
Sbjct: 291 ALGVLTYELLVGSPPFE 307

>Scas_660.20
          Length = 957

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 127/281 (45%), Gaps = 31/281 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPV-AIKFEPRKTEAPQLKDEYRTYK-----IMAGT 114
           +   +++G GS+  +++  +  N   + AIK   +     + K +Y T +     ++A  
Sbjct: 11  FIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKA 70

Query: 115 --PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 171
             P + + YY   +  +   V+D L G  L  L     + FS        VQ++  +E +
Sbjct: 71  HHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFI 129

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
           H+  +I+RD+KP+N L+ R G     K+ + DFG A          +   +   S  GTA
Sbjct: 130 HSQGVIHRDLKPENVLLDRDG-----KLMITDFGAAYTTTAGNNDAN---KSSSSFVGTA 181

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK---RT 288
            Y+S    L  + S   D+ ALG + F F+ G  P++G    N  + +EKI        +
Sbjct: 182 EYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKIVALDYPWSS 238

Query: 289 TNVYD---LSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKL 326
           TN+++   L+N  P+     + +VR +   E  D    +K+
Sbjct: 239 TNIHNNKFLNNINPL----IINLVRKILVLEPKDRLSLKKI 275

>Kwal_56.24059
          Length = 353

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 109/233 (46%), Gaps = 28/233 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK------DEYRTYKIMAGT 114
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K +   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLK-LVDH 100

Query: 115 PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           P + + +   Q+  +  +V+D + G  L  L     ++F        A ++I  +E LH+
Sbjct: 101 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           HD+IYRD+KP+N L+ R G      I + DFG AK+  D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 286
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 111/233 (47%), Gaps = 28/233 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK------DEYRTYKIMAGT 114
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLKLVEH- 127

Query: 115 PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           P + + +   Q+  +  +V+D + G  L  L     ++F        A ++I  +E LHA
Sbjct: 128 PFLIRMWGTFQDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H++IYRD+KP+N L+ R G      I + DFG AK+       Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV------QTVTW----TLCGTPDY 231

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 286
           ++      +  ++  D  +LG + +  L G  P+         + YEKI + K
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGK 281

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 104/216 (48%), Gaps = 22/216 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT---EAPQLKDEYRTYKIMAGT--P 115
           Y  GK +G GSFGV+ +   +  G  VA+K   +K       QL+  Y    I+     P
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 116 NVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDL 171
           N+ +   ++  +E  + +  +   G    +LFD   +K  F+    V++ VQ++  +E L
Sbjct: 106 NIVKFKDWFESKEKFYIVTQLATGG----ELFDRILQKGKFTEVDAVKIVVQILKAVEYL 161

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
           H+ ++++RD+KP+N L     + D +++ L DFG+AK+ ++     H         +G+ 
Sbjct: 162 HSRNIVHRDLKPENLL--YLDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSM 212

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
            Y++          +  D+ ++G + +  L G  P+
Sbjct: 213 GYVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 49/243 (20%)

Query: 42  NRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQ 100
           N    NMT +D        ++IGK +G+G FG ++   +   G+  A+K  E ++     
Sbjct: 89  NDKFENMTLQD--------FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYT 140

Query: 101 LKDEYRTYKIMAGT---PNVPQAYYFGQEGLHNILVIDLL------------GPSLEDLF 145
           ++ ++R    + G+    N+ Q Y F  +     L+++ +            GP  E L 
Sbjct: 141 IQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLA 200

Query: 146 DWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFG 205
            +               QM   ++ +H+ ++++RDIKP+N LIG       N I L DFG
Sbjct: 201 SY------------FVYQMANALDYMHSKNILHRDIKPENILIGF-----NNTIKLTDFG 243

Query: 206 MAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 265
            +    D +        +RK+L GT  Y+S      RE + + D+ ALG + +  L G  
Sbjct: 244 WSVYNEDGQ--------KRKTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSP 295

Query: 266 PWQ 268
           P++
Sbjct: 296 PFE 298

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 110/243 (45%), Gaps = 36/243 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMI---NGMP---VAIKFEPRKTEAPQLKDEYRTYK----- 109
           +   +++G GS+  +++  +     +G+P    AIK   +K    + K +Y T +     
Sbjct: 10  FIFKEQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHIIRENKVKYVTIEKNTLN 69

Query: 110 IMA--GTPNVPQAYY--FGQEGLHNILVIDLLGPSLEDL-----FDWCGRKFSVKTVVQV 160
           ++A    P + + YY    QE L+ +L     G  L  L     FD    K         
Sbjct: 70  LLAQGNNPGIVKLYYTFHDQENLYFVLDYAPGGELLHLLQRYGTFDEVWSK-------HF 122

Query: 161 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP 220
             Q++ ++E +H+  +I+RD+KP+N L+ + G     ++ + DFG A       T     
Sbjct: 123 MCQLVDVVEYIHSKGVIHRDLKPENVLLSKDG-----RLMVTDFGAASVVTTDGTSSDNS 177

Query: 221 YRER-KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 279
             ER  S  GTA Y+S    L  +     D+ ALG + + F++G  P++G    N  Q +
Sbjct: 178 VSERAASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTF 234

Query: 280 EKI 282
           EKI
Sbjct: 235 EKI 237

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 30/247 (12%)

Query: 32  ANAPYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKF 91
           + A  N   +N  +S   +RD    VG  +K+GK +G+GS G +    NM  G   AIK 
Sbjct: 48  STASSNANVNNTKTSKRRNRD---TVG-PWKLGKTLGKGSSGRVRLAKNMETGKLSAIKI 103

Query: 92  EPRK-TEAPQLKD-------EYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLED 143
            P+K  ++ Q+K        E    K+++  PNV   Y   +      LV++ +     +
Sbjct: 104 VPKKFVKSNQIKQLPYGIEREIIIMKLISH-PNVMGLYEVWENKSELYLVLEYVEGG--E 160

Query: 144 LFDWCGRKFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHL 201
           LFD+   K  +     +    Q++  +   H  ++ +RD+KP+N L+ +     +  I +
Sbjct: 161 LFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDK----KKRSIKI 216

Query: 202 IDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYF 260
            DFGMA      K  +        +  G+  Y S    LGR+      D+ + G + F  
Sbjct: 217 ADFGMAALETSDKLLE--------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFAL 268

Query: 261 LRGQLPW 267
           L G LP+
Sbjct: 269 LTGHLPF 275

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 91/178 (51%), Gaps = 14/178 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT---EAPQLKDEYRTYKIMAGT--P 115
           Y  GK +G G+FGV+ +  N   G  VA+K   +K       QL+  Y    I+     P
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           N+  A+    E      +I  L    E LFD   +K  F+ +  V++ V++++ ++ +H+
Sbjct: 97  NIV-AFKDWFESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMHS 154

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
            ++++RD+KP+N L     + DE+ + + DFG+AK+    K+ + + Y+   SL   A
Sbjct: 155 QNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 120/273 (43%), Gaps = 38/273 (13%)

Query: 28  PAMNANAPYNGTPSNRSSSNMTSRDDSTIV-----------GLH-YKIGKKIGEGSFGVL 75
           PA N   P + T  ++S+  + ++   +++            LH ++I + +G GSFG +
Sbjct: 17  PATNPVNPADVTVGSQSTDYLLAQQKESLLPQRSTVSKGKYTLHDFQIMRTLGTGSFGRV 76

Query: 76  FEGTNMINGMPVAIKFEP-----RKTEAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHN 130
               ++ NG   AIK        R  +     DE R  K++   P + + +   Q+  + 
Sbjct: 77  HLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEH-PFLIRMWGTFQDSRNL 135

Query: 131 ILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIG 189
            +V+D + G  L  L     ++F        A ++   +E LH+H++IYRD+KP+N L+ 
Sbjct: 136 FMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLD 194

Query: 190 RPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDD 249
           R G      I + DFG AK+                +L GT  Y++      +  ++  D
Sbjct: 195 RNGH-----IKITDFGFAKEV----------ITVTWTLCGTPDYIAPEVITTKPYNKSVD 239

Query: 250 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
             +LG + F  L G  P+  +      + YEKI
Sbjct: 240 WWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 49/287 (17%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ--------------LKDEYRTYK 109
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 110  IMAGTPNVPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
             +    N+ Q  Y G E  +NI  + L    G S+  L    GR F    +  +  Q++ 
Sbjct: 1234 DLDHL-NIVQ--YLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLK 1289

Query: 167  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKS 226
             +  LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R    
Sbjct: 1290 GLAYLHSKGILHRDMKADNLLLDQDGI-----CKISDFGISRKSKDIYSNSDMTMR---- 1340

Query: 227  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
              GT  +M+   ++T  G   S + D+ +LG +      G+ PW  L+         KIG
Sbjct: 1341 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIG 1393

Query: 284  EKKRTTNVYDLSNGYPVQFGR-YLEIVRSLSFEETPDYQGYRKLLLS 329
            + K    + + +     Q GR +L+      FE  P+ +     LLS
Sbjct: 1394 KSKSAPPIPEDTLPLISQIGRNFLDAC----FEINPEKRPTANELLS 1436

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 108/250 (43%), Gaps = 52/250 (20%)

Query: 59  LH-YKIGKKIGEGSFGVLFE--GTNMINGMPVAIKFEPRK----------------TEAP 99
           LH YK+  KIGEG+F  +F+  G N  +  PVAIK   +K                +   
Sbjct: 118 LHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRK 177

Query: 100 QLKDEYRTYKIMA-GTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKT 156
           ++ +E   +K+++   P+  +   F +   +  LV +L+     ++FD   +   FS   
Sbjct: 178 KVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDL 235

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI---------GRPGQPDE----------N 197
              V  Q+   I+ +H   +++RD+KP+N L          G   + DE           
Sbjct: 236 ARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIG 295

Query: 198 KIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 257
            + L+DFG+AK+ R+            K+  GT  Y++      +  S + DM ++G V 
Sbjct: 296 LVKLMDFGLAKKLRNNTA---------KTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVL 346

Query: 258 FYFLRGQLPW 267
           F  L G  P+
Sbjct: 347 FTLLCGYPPF 356

>Kwal_0.96
          Length = 427

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRK------TEAPQLKDEYRTYKIMAGT 114
           Y  GK +G GSFGV+ +   + +G  VAIK   +K       E   L DE    + +   
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 115 PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLH 172
             V    +F  E      ++  L    E LFD   +  KF+ +  V++  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
           + ++++RD+KP+N L     +  ++++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLL--YLTEAADSQLVLGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 233 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           Y++          +  D+ +LG V +  L G  P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 104/237 (43%), Gaps = 34/237 (14%)

Query: 57   VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK------FEPRKTEAPQLKDEYRTYKI 110
            V + ++    IG G+FG ++   N+ NG  +A+K          K   P +K+E    + 
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLE- 1088

Query: 111  MAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 165
            M   PN+ Q  Y+G E +H    NI +    G SL  L D  GR    + V QV   +++
Sbjct: 1089 MLNHPNIVQ--YYGVE-VHRDKVNIFMEYCEGGSLASLLD-HGR-IEDEMVTQVYTFELL 1143

Query: 166  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH------- 218
              +  LH   +++RDIKP+N L+   G      I  +DFG A+     +T+         
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILLDFNG-----IIKYVDFGTARTVVGSRTRTVRNAAVQD 1198

Query: 219  --IPYRERKSLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGQLPWQGL 270
              +  +    + GT  YM+  T  G     +   DD+ ALG V      G+ PW  L
Sbjct: 1199 FGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 109/258 (42%), Gaps = 40/258 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMA-----GTP 115
           +K G  IG+G++  +   T++      A K   ++    Q K +Y + +  A      +P
Sbjct: 179 FKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSP 238

Query: 116 NVPQAY---------YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
           +V + +         YF  E   N   + L+      L + C R +        A Q+I 
Sbjct: 239 SVVRLFSTFQDESSLYFLLEYAPNGDFLSLMK-KYGSLDETCARYY--------AAQIID 289

Query: 167 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP----YR 222
            I+ LH++ +I+RDIKP+N L+       E KI L DFG AK           P      
Sbjct: 290 AIDYLHSNGIIHRDIKPENILLD-----GEMKIKLTDFGTAKLLNPTNNSVSKPEYDLST 344

Query: 223 ERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
             KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 345 RSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKV 401

Query: 283 GEKKRTTNVYDLSNGYPV 300
            + +     Y  + G+P+
Sbjct: 402 MKVQ-----YAFTPGFPL 414

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 60.5 bits (145), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 108/229 (47%), Gaps = 28/229 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK------DEYRTYKIMAGT 114
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVL-KKQQVIRMKQIEHTNDERRMLKVVEH- 93

Query: 115 PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           P + + +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LHA
Sbjct: 94  PFLIRMWGTFQDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H++IYRD+KP+N L+ R G      I + DFG AK+  D  T          +L GT  Y
Sbjct: 153 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 197

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           ++      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 198 IAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKI 243

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 107/250 (42%), Gaps = 25/250 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI-------MAG 113
           +K G+ +G+GS+  +   T + +G   A K   ++    Q K +Y   +         + 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDL 171
            P V + Y+  Q+   N+  +    P+  D      R    S +       Q++  I  L
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPN-GDFLSVMKRFGTLSEECTKYYGAQILDAIHHL 317

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY-RDPKTKQHIPYRERKSLSGT 230
           H   +I+RD+KP+N L+ +       KI L DFG AK   R+ + K +      KS  GT
Sbjct: 318 HKQGIIHRDVKPENILLDK-----TMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGT 372

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           A Y+S           R D+ A G + F  + G+ P+   KA N    ++K+   +    
Sbjct: 373 AEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKVMRVQ---- 425

Query: 291 VYDLSNGYPV 300
            Y  + G+P+
Sbjct: 426 -YAFTAGFPM 434

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 104/239 (43%), Gaps = 36/239 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKF--------EPRKTEAPQLKDEYRTYKIMA 112
           YK+G+ I  GSF V+    +   G  VA+K+        E  +  A  + +EY   + + 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 113 GTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-----AVQMITL 167
              N+ Q   F ++    + V++    +  DL+D+  +    +  +++       Q+ + 
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFI-KAIRERPTMRINFHSFLFQLCSA 123

Query: 168 IEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSL 227
           I   H+ D+ +RDIKP+N L+   GQ     + L DFG+++          I    +   
Sbjct: 124 ISYCHSKDVSHRDIKPENVLMDDRGQ-----VKLTDFGLSQ----------IGSVSKDYC 168

Query: 228 SGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLK--APNNKQKYEKI 282
            GT +Y++  T L RE   +   D  +LG   F  + G  P++     AP     +++ 
Sbjct: 169 IGTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRF 226

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 118/255 (46%), Gaps = 38/255 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-----FEPRKTEAPQLKDEYRTYKIMAGTP 115
           +K G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + +  + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 116 NVPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRKFSVKTVVQVAVQMITL 167
            V + Y+  Q+      ++      D L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 168 IEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQY-RDPKTKQHIPYRERK 225
           I+ +H + +++RDIKP+N L+      DE+ K+ L DFG AK   RD K+  ++  ++ +
Sbjct: 294 IDFIHKNGVVHRDIKPENILL------DEHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSR 346

Query: 226 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 285
           S  GTA Y+S         + + D+ A G + +  + G+ P+   KA N    ++K+ + 
Sbjct: 347 SFVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKV 403

Query: 286 KRTTNVYDLSNGYPV 300
           +     Y  + G+P+
Sbjct: 404 Q-----YAFTAGFPL 413

>Kwal_56.22693
          Length = 984

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 124/274 (45%), Gaps = 25/274 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-----FEPRKTEAPQLKDEYRTYKIMAGTP 115
           ++ G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + +    
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIEDLH 172
            V + Y+  Q+      +++   P+ +  F    +KF   S +  V  + Q++  I+ LH
Sbjct: 218 GVIKLYFTFQDEASLYFLLEY-APNGD--FLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRER-KSLSGTA 231
              +++RDIKP+N L+ +     + K+ L DFG A+     +T Q     ER KS  GTA
Sbjct: 275 HKGIVHRDIKPENILLDK-----DMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTA 329

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV 291
            Y+S           + D+ A G + F  + G+ P+   KA N    ++K+ + +     
Sbjct: 330 EYVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 381

Query: 292 YDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRK 325
           Y  + G+P+     ++ +   S E+  D    +K
Sbjct: 382 YAFTAGFPLVIRDLIKKILVKSPEQRLDASQIKK 415

>Kwal_33.13846
          Length = 375

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 109/245 (44%), Gaps = 27/245 (11%)

Query: 45  SSNMTSRDDSTIVGLH-YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT-----EA 98
           S+ + SR  S    L+ + I + +G GSFG +    +  NG   A+K   ++T     + 
Sbjct: 48  SAALHSRQTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQV 107

Query: 99  PQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTV 157
               DE R   +++  P + + +   Q+  H  +++D + G  L  L     ++F     
Sbjct: 108 EHTNDERRMLSVVSH-PFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVA 165

Query: 158 VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQ 217
              A ++   +E LHA D+IYRD+KP+N L+ + G      + + DFG AK   D     
Sbjct: 166 KFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGH-----VKITDFGFAKFVPD----- 215

Query: 218 HIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 277
            + Y    +L GT  Y++      +  ++  D  + G + F  L G  P+      N  +
Sbjct: 216 -VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMK 267

Query: 278 KYEKI 282
            YE I
Sbjct: 268 TYENI 272

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 102/222 (45%), Gaps = 21/222 (9%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAG--- 113
           V   +K  + IG G FGV+++G N+  G   AIK     +++ +++D  R  + +A    
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 114 TPNVPQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 171
             N+ + Y  Y     L  I++    G SL  L      K   K +  +  +++  ++ +
Sbjct: 79  ISNITRYYGSYLKDTSLW-IIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCI 135

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
           H  ++I+RDIK  N LI      +E  + L DFG+A Q      +       R++++GT 
Sbjct: 136 HKDNVIHRDIKAANVLIT-----NEGNVKLCDFGVAAQVNQTSLR-------RQTMAGTP 183

Query: 232 RYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
            +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 184 YWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 33/228 (14%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           +   +K  + IG G FG++++G ++      AIK     +   +++D  R  + +A    
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQ 71

Query: 117 VPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RKFSVKTVVQVAVQMI 165
           +P    Y+G           L G SL  + ++C            K   K +  +  +++
Sbjct: 72  IPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 122

Query: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
             ++ +H  ++I+RDIK  N LI   GQ     + L DFG+A Q      +       R+
Sbjct: 123 VALKVIHKDNVIHRDIKAANVLITNEGQ-----VKLCDFGVAAQLNQTSLR-------RQ 170

Query: 226 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 171 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 118/264 (44%), Gaps = 40/264 (15%)

Query: 25  GGYPAMN-ANAPYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEG-TNMI 82
           GG P ++    PY+  P N    +M+SR    +    Y +G  +GEG FG +  G T   
Sbjct: 11  GGGPEVHYTRNPYSAAPRN----SMSSRGKKHVTFGPYIVGSTLGEGEFGKVKLGWTRTP 66

Query: 83  NGMP---------VAIKFEPRKTEAPQLKDEYRTYKIMAGT-----PNVPQAYYFGQEGL 128
           +  P         VAIK   R T     + E + Y+ +        PNV +     Q   
Sbjct: 67  STGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKHLTHPNVVRLEEVLQNSK 126

Query: 129 HNILVIDLLGPSLEDLFDWCGRKFSVK--TVVQVAVQMITLIEDLHAHDLIYRDIKPDNF 186
           +  +V++    S  + + +  RK  +K  T  ++  Q+I+ +  +H+ +L++RD+K +N 
Sbjct: 127 YIGIVLEYA--SGGEFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENL 184

Query: 187 LIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRE-RKSLSGTARYMSINTHLGREQ- 244
           L+ +    +EN + + DFG   ++        +P  E  K+  G+  Y +    +     
Sbjct: 185 LLDK----NENLV-ITDFGFVNEF--------LPDNEYMKTSCGSPCYAAPELVISTRPY 231

Query: 245 -SRRDDMEALGHVFFYFLRGQLPW 267
            +R+ D+ + G + +  L G LPW
Sbjct: 232 VARKADVWSCGIILYAMLAGYLPW 255

>Scas_502.2
          Length = 1116

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 115/249 (46%), Gaps = 25/249 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMA-----GTP 115
           +K G+ +G+G++  +   T+  +G   A+K   ++    Q K +Y   + +A      + 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIEDLHA 173
           ++ + ++  Q+      +++   P+  DL     +  S+  +       Q+I  I+ +H+
Sbjct: 234 SIIRLFFTFQDEASLYFLLEY-APN-GDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY--RDPKTKQHIPYRERKSLSGTA 231
             +I+RDIKP+N L+ +     + K+ + DFG AK    + P T   +  R  KS  GTA
Sbjct: 292 KGIIHRDIKPENILLDK-----DMKVKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGTA 345

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV 291
            Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + +     
Sbjct: 346 EYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 397

Query: 292 YDLSNGYPV 300
           Y  + G+P 
Sbjct: 398 YAFTAGFPT 406

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 84/161 (52%), Gaps = 28/161 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y++ KKIG G +  +F+G +++N +P  IK  +P K     +K  YR  K+   + G PN
Sbjct: 51  YEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGPN 105

Query: 117 VPQAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIE 169
           +         GL +I+      +  L+   ++++ F      F++        Q++T ++
Sbjct: 106 II--------GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALD 157

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
             H+  +++RD+KP N +I     P+E K+ LID+G+A+ Y
Sbjct: 158 YCHSMGIMHRDVKPQNVMI----DPNERKLRLIDWGLAEFY 194

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 113/243 (46%), Gaps = 18/243 (7%)

Query: 28  PAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPV 87
           PA+       G    +  + +  + +S +   +Y  GK +G G+FGV+ +         V
Sbjct: 12  PAVRKPEQVEGHTVTKFFNKLNGQPESYVSKSNYVFGKTLGAGTFGVVRQARYSPTNEDV 71

Query: 88  AIKFEPRK------TEAPQLKDEYRTYKIMAGTPNVPQAY-YFGQEGLHNILVIDLLGPS 140
           A+K   +K       +   L DE    + M   PN+ +   +F  +    I+    +G  
Sbjct: 72  AVKILLKKALKGNDVQLQMLYDELSILQ-MLKHPNIVEFKDWFESKDKFYIVTQLAVGGE 130

Query: 141 LEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIH 200
           L D     G KF+ +  V + +Q+++ ++ +H+ ++++RD+KP+N L     + D++++ 
Sbjct: 131 LFDRILAKG-KFTERDAVSITMQILSAVDYMHSKNVVHRDLKPENVLY--IDKSDDSQLV 187

Query: 201 LIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 260
           + DFG+AKQ +D      + ++   SL   A  +  N   G+      D+ ++G + +  
Sbjct: 188 IADFGIAKQLQD---NDDLIFKAAGSLGYVAPEVLTNNGHGKPC----DIWSIGVIVYTL 240

Query: 261 LRG 263
           L G
Sbjct: 241 LCG 243

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 113/238 (47%), Gaps = 18/238 (7%)

Query: 37  NGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT 96
           NG P  +  + ++ + +S +   +Y  G+ +G GSFGV+ +   +     VAIK   +K 
Sbjct: 23  NGHPVAKFINKLSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKA 82

Query: 97  ---EAPQLKDEYRTYKIM--AGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR- 150
                 QL+  Y    I+     PN+  ++    E      ++  L    E LFD     
Sbjct: 83  LQGNNVQLQMLYEELSILQKLSHPNIV-SFKDWFESKDKFYIVTQLATGGE-LFDRILSR 140

Query: 151 -KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ 209
            KF+    V++ VQ++  +E +H+ ++++RD+KP+N L     + + + + + DFG+AKQ
Sbjct: 141 GKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVL--YVDKSENSPLVIADFGIAKQ 198

Query: 210 YRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
               K ++ + Y+     +G+  Y++          +  D+ ++G + +  L G  P+
Sbjct: 199 L---KGEEDLIYKA----AGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPF 249

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 111/256 (43%), Gaps = 35/256 (13%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPV-AIKFEPRKTEAPQLKDEYR 106
           MTSR  S      +   +++G GS+  +F+  +  +   + AIK   +K    + K +Y 
Sbjct: 1   MTSRKRSP---HDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYV 57

Query: 107 TYKIMAGTPN---------VPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKT 156
           T  I   T N         + + YY   +  +   V+D   G  L  L    G  F+   
Sbjct: 58  T--IEKNTMNLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMG-TFNDIW 114

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
                 Q+I  +E +H+H +I+RD+KP+N L+ R G     ++ + DFG A       + 
Sbjct: 115 TRHFTAQLIDALEFIHSHGIIHRDLKPENVLLDRDG-----RLMITDFGAAATIDPSLSG 169

Query: 217 QHIPY----------RERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 266
               +          +   S  GTA Y+S    L  +     D+ ALG + + F++GQ P
Sbjct: 170 DSAKFNSDSNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPP 229

Query: 267 WQGLKAPNNKQKYEKI 282
           ++G    N  + +EKI
Sbjct: 230 FRG---ENELKTFEKI 242

>Kwal_26.7788
          Length = 1267

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 98/218 (44%), Gaps = 28/218 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ-------LKDEYRTYKIMAG 113
           +K+GK +G+GS G +    NM  G   AIK  P KT++ +       ++ E    K+++ 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVP-KTKSSRTGSLPYGIEREIIIMKLISH 116

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC---GRKFSVKTVVQVAVQMITLIED 170
            PNV   Y   +  L   LV++ +     +LFD+    GR    K  +    Q+I     
Sbjct: 117 -PNVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGR-LPEKEAIHYFRQIIEGTAY 172

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
            H  ++ +RD+KP+N L+ +  +    +I + DFGMA      K  +        +  G+
Sbjct: 173 CHGFNICHRDLKPENLLLDKKNK----RIKIADFGMAALQTSNKLLE--------TSCGS 220

Query: 231 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 267
             Y S    +G+       D+ + G + F  L G LP+
Sbjct: 221 PHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 107/238 (44%), Gaps = 35/238 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYR---TYKIMAGTPN 116
           Y +GK +G G + ++ E  N   G  VA+K F P++ +  +   ++R   T  +    PN
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 117 VPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLIE 169
           +            +  +   LV++ +     +LFD   +K S+      A+  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 170 DLHAHDLIYRDIKPDNFL--IGRPGQPDEN------------KIHLIDFGMAKQYRDPKT 215
            LH+ ++I+RDIKP+N L  I R   PDE             ++ + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 216 KQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 19/176 (10%)

Query: 45  SSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAP----- 99
           S+ ++S  D + VG +Y+I K +GEGSFG +    ++  G  VA+K   +K  A      
Sbjct: 24  SNKVSSLADGSRVG-NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQG 82

Query: 100 QLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTV 157
           +++ E  +Y  +   P++ + Y   +     I+VI+  G    +LFD+  +  K S +  
Sbjct: 83  RIEREI-SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSEQEA 138

Query: 158 VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRD 212
            +   Q+I+ +E  H H +++RD+KP+N L+      DE+  + + DFG++    D
Sbjct: 139 RRFFQQIISAVEYCHRHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>Kwal_47.18307
          Length = 621

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 11/123 (8%)

Query: 160 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHI 219
           +  Q++  ++ +H+  +I+RD+KP+N L+ +     E ++ + DFG A    D K +   
Sbjct: 117 ITAQLVDTVDYMHSKGVIHRDLKPENVLLSQ-----EGRVVITDFGAACTAADRKFENT- 170

Query: 220 PYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 279
             +   S  GTA Y+S    L  +     D+ ALG + +   +G+ P++G    N  Q +
Sbjct: 171 --KRTASFVGTAEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTF 225

Query: 280 EKI 282
           EKI
Sbjct: 226 EKI 228

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 111/270 (41%), Gaps = 64/270 (23%)

Query: 42  NRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQL 101
           N  SS   SRD    VG  +K+GK +G+GS G +    N+ NG   AIK  P++T   ++
Sbjct: 78  NTKSSKRKSRD---TVG-PWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRM 133

Query: 102 KDEY------------------RTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLG-PSLE 142
           +D+                   R   I  GT +    Y   +E    I+++ L+  P++ 
Sbjct: 134 RDQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVM 189

Query: 143 ----------------------DLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAHDLIY 178
                                 +LFD+   K   S    V    Q+I  +   H+ ++ +
Sbjct: 190 GLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICH 249

Query: 179 RDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINT 238
           RD+KP+N L+ +  +     I + DFGMA           +P +  ++  G+  Y S   
Sbjct: 250 RDLKPENLLLDKKNKV----IKIADFGMA--------ALELPNKLLETSCGSPHYASPEI 297

Query: 239 HLGRE-QSRRDDMEALGHVFFYFLRGQLPW 267
            +G+       D+ + G + F  L G LP+
Sbjct: 298 VMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 111/242 (45%), Gaps = 22/242 (9%)

Query: 35  PYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR 94
           P  G    +  + +T +  S +    Y  GK +G G+FGV+ +   + +G  VA+K   +
Sbjct: 20  PVEGHKLTKLFNKVTGQPSSYVNKSDYIFGKTLGAGTFGVVRQARCISSGENVAVKILLK 79

Query: 95  KT---EAPQLKDEYRTYKIMAGT--PNVP--QAYYFGQEGLHNILVIDLLGPSLEDLFDW 147
           K    ++ QL+  Y    I+     PN+   + ++  +E  + +  +   G    +LFD 
Sbjct: 80  KALKGQSVQLQMLYDELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGG----ELFDR 135

Query: 148 CGR--KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFG 205
                KF     V +  Q++  ++ LH  ++++RD+KP+N L     + D++ + + DFG
Sbjct: 136 ILEKGKFCEVDAVFIVKQILQGVQYLHQRNIVHRDLKPENIL--YLNKSDDSPLVIGDFG 193

Query: 206 MAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 265
           +AK+ +D     H         +G+  Y++          +  D+ ++G + +  L G  
Sbjct: 194 IAKELKDDNELIH-------KAAGSMGYVAPEVLTSSGHGKPCDIWSIGVITYTLLCGYS 246

Query: 266 PW 267
           P+
Sbjct: 247 PF 248

>Scas_613.5
          Length = 517

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 122/270 (45%), Gaps = 36/270 (13%)

Query: 35  PYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEP 93
           P  G  S+++++    R         Y +GK +G G +  + EG N + G  VA+K F P
Sbjct: 178 PQLGFTSSQNATKKIVRTKQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHP 237

Query: 94  RKTEAPQLKDEYR--TYKIM-AGTPNVPQAYYF-----GQEGLHNILVIDLLGPSLEDLF 145
           ++ +  +   ++R  T  +M    PN+     F      +  +   LV+D +     +LF
Sbjct: 238 QQNDDEKKSKQFREETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDG--ELF 295

Query: 146 DWCGRKFSVKTVVQVAV--QMITLIEDLHAHDLIYRDIKPDNFL--IGRPGQPDEN---- 197
           +   +K  ++     A+  Q++  ++ LH  ++I+RDIKP+N L  I R   P++     
Sbjct: 296 ERIVKKTCLRQDETKAIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGP 355

Query: 198 --------KIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDD 249
                   ++ + DFG+AK   +         +   +L GT  Y++      +  + + D
Sbjct: 356 WDEDEIDIQVKIADFGLAKFTGE--------MQFTNTLCGTPSYVAPEVLTKKGYTSKVD 407

Query: 250 MEALGHVFFYFLRGQLPW-QGLKAPNNKQK 278
           M + G + +  L G  P+ + L  P+ K++
Sbjct: 408 MWSAGVILYVCLCGFPPFSEQLGPPSLKEQ 437

>Scas_711.25
          Length = 1515

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 101/224 (45%), Gaps = 41/224 (18%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ--------------LKDEYRTYK 109
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 110  IMAGTPNVPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
             +    N+ Q  Y G E   NI  + L    G S+  L    GR F    +  +  Q++ 
Sbjct: 1273 DLDHL-NIVQ--YLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLR 1328

Query: 167  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKS 226
             +  LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R    
Sbjct: 1329 GLAYLHSRGILHRDMKADNLLLDQDGV-----CKISDFGISRKSKDIYSNSDMTMR---- 1379

Query: 227  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
              GT  +M+   ++T  G   S + D+ +LG +      G+ PW
Sbjct: 1380 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPW 1419

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 115/261 (44%), Gaps = 38/261 (14%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGM-PVAIKFEPRKTEAPQLKDEYR 106
           MTSR  S      +   +++G GS+  +++  +  +   P AIK   ++    + K +Y 
Sbjct: 1   MTSRKRSP---HEFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYV 57

Query: 107 TYK-----IMA--GTPNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVV 158
           T +     ++A    P + + YY   +  +   V+D   G  L  L    G  F+     
Sbjct: 58  TIEKNTLNLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMG-TFTDSWAK 116

Query: 159 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH 218
             A Q++  +E +HA  +I+RD+KP+N L+ + G      + + DFG A    +   K +
Sbjct: 117 HFAAQLVDTLEFMHARGVIHRDLKPENVLLSKEGI-----LMITDFGAAATQNNFSDKDN 171

Query: 219 --------IP---------YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 261
                   IP           E  S  GTA Y+S    L  + S   D+ ALG + + F+
Sbjct: 172 TRSNANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFI 231

Query: 262 RGQLPWQGLKAPNNKQKYEKI 282
           +G  P++G    N  + +EKI
Sbjct: 232 QGFPPFRG---ENELKTFEKI 249

>Scas_720.94
          Length = 1683

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 112/253 (44%), Gaps = 49/253 (19%)

Query: 54   STIVGLHYKIGKK--IGEGSFGVLFEGTNMINGMPVA---IKFEPRKTEA---PQLKDEY 105
            S+I  L  +  K+  IG G+FG ++   N+ NG  +A   IK +  KT     P +K+E 
Sbjct: 1352 SSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEM 1411

Query: 106  RTYKIMAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV- 160
               + M   PN+ Q  Y+G E +H    NI +    G S+  L +  GR    + V QV 
Sbjct: 1412 TVLE-MLNHPNIVQ--YYGVE-VHRDKVNIFMEYCEGGSMASLLE-HGR-IEDEMVTQVY 1465

Query: 161  AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP 220
             ++++  +  LH   +++RDIKP+N L+   G      I  +DFG A++     TK  + 
Sbjct: 1466 TLELLEGLAYLHQAGVVHRDIKPENILLDFNG-----IIKYVDFGAARKIAKNGTK--VT 1518

Query: 221  YRERKS--------------------LSGTARYM---SINTHLGREQSRRDDMEALGHVF 257
                KS                    + GT  YM   SI  +  + +   DD+ + G V 
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 258  FYFLRGQLPWQGL 270
               + G+ PW  L
Sbjct: 1579 LEMITGRRPWANL 1591

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 113/257 (43%), Gaps = 37/257 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPV-AIKFEPRKTEAPQLKDEY--------RTYKIM 111
           +K G  +G+GS+  +F  T+  +     A+K   ++    Q K +Y        +  K +
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 112 AGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV---KTVVQVAVQMITLI 168
            G  N+  ++ F  E   N+  +    P+ +  F    +KF     +  +  + Q+I  I
Sbjct: 178 TGVINL--SFTFQDEA--NLYFLLEYAPNGD--FLSLIKKFGTLNEECTIYYSAQIIDAI 231

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRDPKTKQHIPY----RE 223
             +H+H +I+RDIKP+N L+      D N KI L DFG AK  +    K   P+      
Sbjct: 232 GSMHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTR 285

Query: 224 RKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
             S  GTA Y+S           + D+ A G + +  + G+ P+   KA N    ++K+ 
Sbjct: 286 SSSFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQKVM 342

Query: 284 EKKRTTNVYDLSNGYPV 300
           + +     +  + G+P 
Sbjct: 343 KVQ-----FAFTAGFPT 354

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 28/161 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIM---AGTPN 116
           Y+I  KIG G +  +F G +++N     IK  +P K     +K  YR  KI+   +G PN
Sbjct: 86  YEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGPN 140

Query: 117 VPQAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIE 169
           V         GL +I+      +  L+   + ++ F      F++  +     Q++  +E
Sbjct: 141 VI--------GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALE 192

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
             H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 193 YCHSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 229

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 101/228 (44%), Gaps = 22/228 (9%)

Query: 65  KKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKI-------MAGTPNV 117
           +++G GS+  ++      +    AIK   ++    + K +Y T +         A  P +
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 118 PQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
            + YY   +  +   V+DL  G  L  L     R FS         Q++  +E +H+  +
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLR-RQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY--RDPKTKQHIPYRERKSLSGTARYM 234
           I+RD+KP+N L+ +     E ++ + DFG A      D  +    P     S  GTA Y+
Sbjct: 133 IHRDLKPENVLLDK-----EGRLMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAEYV 184

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           S    L  +     D+ ALG + + FL+G  P++G    N  + +E+I
Sbjct: 185 SPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG---QNEMETFEQI 229

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 108/261 (41%), Gaps = 46/261 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEY--------------R 106
           +K G+ +G+G++  +   T   +G   A+K   ++    Q K +Y              R
Sbjct: 182 FKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSR 241

Query: 107 TYKIMAGTPNVPQAYYFGQEGLHN---ILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQ 163
               +  T     + YF  E   N   + V+   G   ED    C R +S         Q
Sbjct: 242 GIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSED----CTRYYSA--------Q 289

Query: 164 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP--- 220
           +I  I+ LH+  +I+RDIKP+N L+ +     + K+ + DFG AK        +  P   
Sbjct: 290 IIDGIKYLHSKGIIHRDIKPENILLDK-----DMKVKITDFGTAKILEPKNEDEDNPEFN 344

Query: 221 -YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 279
                KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    +
Sbjct: 345 LLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF---KATNEYLTF 401

Query: 280 EKIGEKKRTTNVYDLSNGYPV 300
           +K+ + +     Y  + G+PV
Sbjct: 402 QKVMKVQ-----YAFTAGFPV 417

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 100/228 (43%), Gaps = 26/228 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT-----EAPQLKDEYRTYKIMAGTP 115
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++  P
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSH-P 210

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            + + +   Q+  H  +V+D + G  L  L     R F        A ++   +E LH+ 
Sbjct: 211 FIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHSK 269

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           ++IYRD+KP+N L+ + G      I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>Kwal_26.7635
          Length = 691

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 96/227 (42%), Gaps = 21/227 (9%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           +++ K IG+GSFG + +     TN +  +    K +   K+E      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
            VP  + F       I++  + G  L       GR FS+        +++  +E LH  D
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR-FSLSRARLYTAELLCALETLHNLD 476

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235
           +IYRD+KP+N L+   G      I L DFG+ K     + K +       +  GT  Y++
Sbjct: 477 VIYRDLKPENILLDHQGH-----IALCDFGLCKLNMKGQDKTN-------TFCGTPEYLA 524

Query: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
               LG+  S+  D   LG + +  + G  P+     P   + Y+KI
Sbjct: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 103/229 (44%), Gaps = 28/229 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK------DEYRTYKIMAGT 114
           + I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLKLVEH- 108

Query: 115 PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           P + + +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LH 
Sbjct: 109 PFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H++IYRD+KP+N L+ R G      I + DFG AK+                +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEVETVTW----------TLCGTPDY 212

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           ++      +  ++  D  +LG + +  L G  P+         + YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKI 258

>Scas_660.28
          Length = 623

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 110/234 (47%), Gaps = 28/234 (11%)

Query: 49  TSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAP-----QLKD 103
           +S  D + +G +Y+I K +GEGSFG +    +M  G  VA+K   +K  A      +++ 
Sbjct: 35  SSLSDGSHIG-NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIER 93

Query: 104 EYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVA 161
           E  +Y  +   P++ + Y   +     I+V++  G    +LFD+  +  K S     +  
Sbjct: 94  EI-SYLRLLRHPHIIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFF 149

Query: 162 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRDPKTKQHIP 220
            Q+I+ +E  H H +++RD+KP+N L+      DE+  + + DFG++    D        
Sbjct: 150 QQIISAVEYCHRHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTDGNF----- 198

Query: 221 YRERKSLSGTARYMSINTHLGREQSRRD-DMEALGHVFFYFLRGQLPWQGLKAP 273
               K+  G+  Y +     G+  +  + D+ + G + +  L  +LP+     P
Sbjct: 199 ---LKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIP 249

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 16/155 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y+I  KIG G +  +F G  ++N     IK  +P K     +K  YR  KI   + G PN
Sbjct: 50  YEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
           V   Y   Q+    I    L+   ++++ F      F +  +     Q++  ++  H+  
Sbjct: 105 VVGLYDIVQDADSKIPA--LIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMG 162

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 163 IMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 29/223 (13%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIK------FEPRKTEA----PQLKDEYRTYKIMAG 113
            G+ IG+GSFG ++   N+  G  +A+K      F  +   A      LK E  T K +  
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 114  TPNVPQAYYFGQE-GLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
              N+ Q   F ++ G++++ +  + G S+  L    GR F  + +  +  Q++  +  LH
Sbjct: 1101 V-NIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLH 1158

Query: 173  AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
            +  +++RD+K DN L+   G        + DFG++++  +  +   +  R      GT  
Sbjct: 1159 SKGILHRDMKADNLLLDNDGV-----CKISDFGISRKSNNIYSNSDMTMR------GTVF 1207

Query: 233  YMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
            +M+   ++T  G   S + D+ +LG V      G+ PW   + 
Sbjct: 1208 WMAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 97/230 (42%), Gaps = 27/230 (11%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     T  I  +    K +   K+E      E      +    
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 116 NVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLH 172
            VP  + F  QE L+ +L     G    +LF    R  +F +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
             D+IYRD+KP+N L+   G      I L DFG+ K     + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDEDKTD-------TFCGTPE 533

Query: 233 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 108/227 (47%), Gaps = 26/227 (11%)

Query: 28  PAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPV 87
           P+M + A  N  P + S+      DD  +  L +++GK IG G++G++ E  ++  G+  
Sbjct: 416 PSMTSIAKMNSNPLSGSAGGSARPDDKGMEILGHRLGKIIGFGAWGIIRECFDIETGVGR 475

Query: 88  AIK---FEPRKTEAPQLKDEYRTYKIMAGTPNVPQ---------AYYFGQEGLHNILVID 135
            IK   F+  +     +  E   ++ +     +P          A Y   E +++  + D
Sbjct: 476 VIKIVKFKGHQNIKKHVLREVAIWRTLKHNRILPLLDWKLDDNYAMYCLTERINDGTLYD 535

Query: 136 LLGPSLEDLFDWCGRKFS--VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQ 193
           L+     D F      F+   +  + +++Q+++ ++ +H+  +++ DIK +N L+ + G+
Sbjct: 536 LVIS--WDEFKRSKIPFAERCRLTIFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGK 593

Query: 194 PDENKIHLIDFGMAKQ------YRDPKTKQHI----PYRERKSLSGT 230
             + K+ L DFGM+        YR+    +++     +R+RKS+  T
Sbjct: 594 KSDWKVFLCDFGMSCHFDEKHVYRNDTFDENLSSGNSHRKRKSIEQT 640

>Scas_673.20*
          Length = 758

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 97/226 (42%), Gaps = 50/226 (22%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-----FEPRK----TEAPQLKDEYRTYKIM 111
           Y+  K+IGEG+ G+++    +   + VAIK      +PR     TE   LK EY+   I+
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQPRLQMIWTEMLVLK-EYQHPNII 539

Query: 112 AGTPNVPQAYYFGQEGLHNILVIDLL---GPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 168
               N   +Y      LH+ L I +    G SL D+         V        QM T+ 
Sbjct: 540 ----NFINSYL-----LHDTLWIVMEYMDGGSLADI---------VSFFTPTEEQMATIC 581

Query: 169 ED-------LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
            +       LH+  +++RDIK DN L+   G      I + DFG   Q  +  TK     
Sbjct: 582 RETLFGLNFLHSRGIVHRDIKSDNILLSMNGD-----IKITDFGFCGQLTESNTK----- 631

Query: 222 RERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
             R ++ GT  +M+      +E   + D+ +LG +    + G+ P+
Sbjct: 632 --RTTMVGTPYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 111/242 (45%), Gaps = 30/242 (12%)

Query: 44  SSSNMTSRDDSTIVGLH---YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAP- 99
           S+S + +   S   G H   Y+I K +GEGSFG +    +   G  VA+K   +K  A  
Sbjct: 35  SNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS 94

Query: 100 ----QLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFS 153
               +++ E    +++   P++ + Y   +     I+VI+  G    +LFD+  +  K S
Sbjct: 95  DMQGRIEREISYLRLLRH-PHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMS 150

Query: 154 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRD 212
            +   +   Q+I+ +E  H H +++RD+KP+N L+      DE+  + + DFG++    D
Sbjct: 151 EQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 204

Query: 213 PKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRD-DMEALGHVFFYFLRGQLPWQGLK 271
                       K+  G+  Y +     G+  +  + D+ + G + +  L  +LP+    
Sbjct: 205 GNF--------LKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDES 256

Query: 272 AP 273
            P
Sbjct: 257 IP 258

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 106/263 (40%), Gaps = 56/263 (21%)

Query: 45  SSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDE 104
           SS   SRD    VG  +K+GK +G+GS G +    NM  G   AIK  P+K       + 
Sbjct: 69  SSKRKSRD---TVG-PWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNN 124

Query: 105 ---YRTYKIMAGTPNVPQAYYFGQE----------GLH-NILVIDLLGPS---------- 140
                +Y     T NV       +E          G+   I+++ L+  +          
Sbjct: 125 GTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWE 184

Query: 141 --------LE-----DLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 185
                   LE     +LFD+   K     +  +    Q++  +   H+ ++ +RD+KP+N
Sbjct: 185 NKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPEN 244

Query: 186 FLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGRE-Q 244
            L+ +  +    +I + DFGMA           +P +  K+  G+  Y S    +GR   
Sbjct: 245 LLLDKKNR----RIKIADFGMA--------ALELPNKLLKTSCGSPHYASPEIVMGRPYH 292

Query: 245 SRRDDMEALGHVFFYFLRGQLPW 267
               D+ + G V F  L G LP+
Sbjct: 293 GGPSDVWSCGIVLFALLTGHLPF 315

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 101/234 (43%), Gaps = 31/234 (13%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPV-AIKFEPRKTEAPQLKDEYRTYKIMAG-- 113
           +++ + +G+G+FG +++     T  I  M V + K   +K E      E       A   
Sbjct: 412 FEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKS 471

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK---FSVKTVVQVAVQMITLIED 170
           +P +    +  Q      LV D +  S  +LF W  +K   FS         +++  +E 
Sbjct: 472 SPFIVGLKFSFQTPTDLYLVTDYM--SGGELF-WHLQKEGRFSEDRAKFYIAELVLALEH 528

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LH +D++YRD+KP+N L+   G      I L DFG++K     +T          +  GT
Sbjct: 529 LHDNDIVYRDLKPENILLDANGN-----IALCDFGLSKADLKDRT---------NTFCGT 574

Query: 231 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
             Y++    L     ++  D  +LG + F    G   W    A NN++ Y+KI 
Sbjct: 575 TEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAENNQKMYQKIA 625

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 26/228 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT-----EAPQLKDEYRTYKIMAGTP 115
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++  P
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSH-P 146

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            + + +   Q+     +V+D + G  L  L     ++F        A ++   +E LH+ 
Sbjct: 147 FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 205

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
           D+IYRD+KP+N L+ + G      I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 206 DIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 250

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 251 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENI 295

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 28/161 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y+I  KIG G +  +F G +++N  P  IK  +P K     +K  YR  KI   + G PN
Sbjct: 50  YEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 117 VPQAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIE 169
           +         GL +I+      +  L+   ++++ F      F++        Q++  ++
Sbjct: 105 II--------GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALD 156

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
             H+  +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 157 YCHSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>Scas_690.13
          Length = 354

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 108/233 (46%), Gaps = 28/233 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK------DEYRTYKIMAGT 114
           +++ + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLKLVEH- 101

Query: 115 PNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           P + + +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LH+
Sbjct: 102 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H++IYRD+KP+N L+ R G      I + DFG AK+  D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 286
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYD---TTPMKTYEKILQGK 255

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 102/234 (43%), Gaps = 26/234 (11%)

Query: 55  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK-----FEPRKTEAPQLKDEYRTYK 109
           +IV  +++I + +G GSFG +    +  NG   A+K        R  +     DE     
Sbjct: 81  SIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLS 140

Query: 110 IMAGTPNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 168
           I+   P + + +   Q+     +++D + G  L  L     ++F        A ++   +
Sbjct: 141 IVTH-PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLAL 198

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLS 228
           E LH+ D+IYRD+KP+N L+ + G      I + DFG AK   D      + Y    +L 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLC 243

Query: 229 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           GT  Y++      +  ++  D  + G + +  L G  P+      N  + YEKI
Sbjct: 244 GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 111/250 (44%), Gaps = 26/250 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEY-----RTYKIMAGTP 115
           +K G+ +G+GS+  +   T++ +    A+K   ++    Q K +Y      T + +  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIEDLHA 173
            +   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY---RERKSLSGT 230
             +I+RD+KP+N L+       + K+ L DFG A+   D  ++  + Y       S  GT
Sbjct: 273 KGVIHRDLKPENILLDV-----DMKVKLTDFGTAR-LLDSTSEDDLKYDLLTRSNSFVGT 326

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           A Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + +    
Sbjct: 327 AEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKVMKVQ---- 379

Query: 291 VYDLSNGYPV 300
            +  + G+P+
Sbjct: 380 -FAFTAGFPM 388

>Scas_616.10
          Length = 1461

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 109/275 (39%), Gaps = 64/275 (23%)

Query: 38  GTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRK-- 95
            T ++  SS   SRD    VG  +K+GK +G+GS G +    N+  G   AIK  P+K  
Sbjct: 82  STSTDTKSSKRKSRD---TVG-PWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHK 137

Query: 96  ---------------------------TEAPQ-------------LKDEYRTYKIMAGTP 115
                                      T  P              ++ E    K+++  P
Sbjct: 138 LFMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISH-P 196

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           NV   Y   +      LV++ +     +LFD+   K   S K  V    Q+I  +   H+
Sbjct: 197 NVMALYEVWENKSELYLVLEYVDGG--ELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHS 254

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            ++ +RD+KP+N L+ +  +     I + DFGMA           +P +  ++  G+  Y
Sbjct: 255 FNICHRDLKPENLLLDKKNK----SIKIADFGMA--------ALELPNKLLQTSCGSPHY 302

Query: 234 MSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 267
            S    +G+       D+ + G + F  L G LP+
Sbjct: 303 ASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 98/231 (42%), Gaps = 29/231 (12%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     TN I  +    K +   K+E      E RT       P
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 440

Query: 116 N-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDL 171
             VP  + F   E L+ +L     G    +LF    R  +F +        +++  +E L
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEAL 496

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
           H  D+IYRD+KP+N L+   G      I L DFG+ K     + K         +  GT 
Sbjct: 497 HDFDIIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQEKT-------TTFCGTP 544

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
            Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 545 EYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 102/238 (42%), Gaps = 33/238 (13%)

Query: 63  IGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQA 120
           I + +G+G+F  + +      G   A+K   ++     +    R  +++     P + + 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIY 178
             F ++     +V++ +     DL D+     +V      +++ Q++T I+ +H+  + +
Sbjct: 260 KGFYEDTESYYMVMEFVSGG--DLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 179 RDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINT 238
           RD+KPDN LI    Q D   + + DFG+AK   +            K+  GT  Y++   
Sbjct: 318 RDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEV 366

Query: 239 HLGR-------------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
             G+             E S   DM ++G + +  L G LP+ G       Q Y++IG
Sbjct: 367 IRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 14/154 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KI   + G PN
Sbjct: 50  YEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
           V       Q+    I  +        D F      F+++ +     Q++  ++  H+  +
Sbjct: 105 VIGLLDIVQDQASKIPALIFEEVKNAD-FRTLYPSFTLQDLQYYFTQLLIALDYCHSMGI 163

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           ++RD+KP N +I     P + K+ LID+G+A+ Y
Sbjct: 164 MHRDVKPQNVMI----DPAQKKLRLIDWGLAEFY 193

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 97/229 (42%), Gaps = 28/229 (12%)

Query: 65  KKIGEGSFGVLFEGTNMINGMPVAIKFEPR-KTEAPQLKDEYRTYKIMAGT---PNVPQA 120
           + I  G+F  +++  +  +   VA+K  P+ KT    +K+EY   KI++     PN+   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 121 YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL-------H 172
             F  +  + I+V++      L D  D    + S  +   + + M  +I+ L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP----YRERKSLS 228
           +  + +RDIKP+N L+   G      I L D+G A Q   PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTINGD-----IKLADWGHAIQ--SPKSNDFQIGTDNYRAPETFS 178

Query: 229 GTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRGQLPWQGLKA 272
           G         +  R       + + D  +LG   FY + G   ++  K+
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFGDCLFRVSKS 227

>Scas_689.25*
          Length = 409

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 92/214 (42%), Gaps = 25/214 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT-----EAPQLKDEYRTYKIMAGTP 115
           + I +  G GSFG +    ++ NG   A+K   ++T     +     DE R   +     
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVSVHAF 158

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 173
            V     F Q+  H  +++D +     +LF    R  +F        A ++   ++ LH+
Sbjct: 159 IVRLWGTF-QDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            D+IYRD+KP+N L+ R G      I + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDRNGH-----IKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 126/277 (45%), Gaps = 53/277 (19%)

Query: 61  YKIGKKIGEGSFGVLFEG--------TNMINGMP--VAIKFEPRKTEAPQLKDEYRTYKI 110
           Y +G  +GEG FG +  G        +N     P  VAIK   R + +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 111 MAGT-----PNVPQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWCGRKFSVKTV--V 158
           +        PN+ +     +E L N   I ++   LE     + + +  +K  +K +   
Sbjct: 101 INALKHLSHPNIVKL----EEVLQNSRYIGIV---LEYACGGEFYKYIQKKRRLKEMNAC 153

Query: 159 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH 218
           ++  Q+I+ +  +H+  L++RD+K +N L+ +    +EN + + DFG   ++    ++  
Sbjct: 154 RLFSQLISGVHYIHSKGLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF---CSRNE 205

Query: 219 IPYRERKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNK 276
           +     K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW     PNN 
Sbjct: 206 L----MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNNP 259

Query: 277 QKYEKIGEKKRTTNVYDLSNGYPVQFGRY-LEIVRSL 312
           +  + IG       +Y+  N  P++F  Y L I R L
Sbjct: 260 EGSD-IGR------LYNYINSTPLKFPDYILPIPRDL 289

>Scas_703.5
          Length = 749

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 102/234 (43%), Gaps = 31/234 (13%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPV-AIKFEPRKTEAPQLKDEYRTYKIMA--G 113
           +++ + +G+G+FG +++     T  I  M V + K   +K E      E       A   
Sbjct: 344 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKA 403

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK---FSVKTVVQVAVQMITLIED 170
           +P +    +  Q      LV D +  S  +LF W  +K   F+ +       +++  +E 
Sbjct: 404 SPFIVGLKFSFQTPTDLYLVTDFM--SGGELF-WHLQKEGRFTEERAKFYIAELVLALEY 460

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LH +D++YRD+KP+N L+   G      I L DFG++K     +T          +  GT
Sbjct: 461 LHDNDIVYRDLKPENILLDANGN-----IALCDFGLSKADLKDRT---------NTFCGT 506

Query: 231 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
             Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 507 TEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 557

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 106/238 (44%), Gaps = 35/238 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRT-YKIMAGT--PN 116
           Y  GK++G G + ++ E  N I G  VA+K F P+K +  +   ++R   KI+ G    N
Sbjct: 155 YIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHEN 214

Query: 117 VPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLIE 169
           + +          +  +   LV++ +     +LFD   RK  +      A+  Q++  ++
Sbjct: 215 IVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGLK 272

Query: 170 DLHAHDLIYRDIKPDNFL--IGRPGQPDENK------------IHLIDFGMAKQYRDPKT 215
            LH  ++I+RDIKP+N L  I R   PD+ +            + + DFG+AK   +   
Sbjct: 273 YLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE--- 329

Query: 216 KQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
                 +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 -----MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 98/214 (45%), Gaps = 21/214 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ---LKDEYRTYKIMAGT--P 115
           +++G+K+G+G FG ++   +  +G   A+K    K E  Q   LK   R   I  G   P
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHP 158

Query: 116 NVPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
           N+ + Y +F  E    +L+   +   L       G  F+         Q+   +  +H  
Sbjct: 159 NIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNG-PFNDVLASHYIYQIADALHYMHKK 217

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
            +I+RD+KP+N LIG      +N + L DFG +    +P+  +      RK+L GT  Y+
Sbjct: 218 RIIHRDVKPENVLIGF-----DNVVKLADFGWS--ILNPEGSK------RKTLCGTIDYL 264

Query: 235 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           S      RE   + D+ ALG + +  + G  P++
Sbjct: 265 SPEMITPREYDEQVDVWALGVLAYELVVGVPPFE 298

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 97/222 (43%), Gaps = 27/222 (12%)

Query: 64   GKKIGEGSFGVLFEGTNMINGMPVAIKF----------EPRKTEAPQLKDEYRTYKIMAG 113
            G+ IG+GSFG ++ G N+  G  +A+K           E     A  L  E  T K +  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 114  TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
               V    +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYGH-FDEQLIRFLTTQVLEGLAYLHL 1245

Query: 174  HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
              +++RD+K DN L+   G        + DFG++++        +I      ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSEMTMRGTVFW 1294

Query: 234  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
            M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 99/229 (43%), Gaps = 25/229 (10%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     TN I  +    K +   K+E      E RT       P
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 447

Query: 116 -NVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             VP  + F   E L+ +L   + G  L       GR F +        +++  +E LH+
Sbjct: 448 FIVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGR-FDLSRARFYTAELLCALETLHS 505

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            ++IYRD+KP+N L+   G      I L DFG+ K     + K +       +  GT  Y
Sbjct: 506 LNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKTN-------TFCGTPEY 553

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           ++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 554 LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>Kwal_47.18233
          Length = 598

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 81/160 (50%), Gaps = 18/160 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAP-----QLKDEYRTYKIMAGTP 115
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  +   P
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 89

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 173
           ++ + Y   +     ++VI+  G    +LFD+  +  K S     +   Q+I+ +E  H 
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 174 HDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRD 212
           H +++RD+KP+N L+      DE+  + + DFG++    D
Sbjct: 147 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 180

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 97/220 (44%), Gaps = 28/220 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRK---------TEAP-QLKDEYRTYKI 110
           +K+GK +G+GS G +    NM +G   AIK  P++         T  P  ++ E    K+
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKL 120

Query: 111 MAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDW-CGR-KFSVKTVVQVAVQMITLI 168
           +   PN+   Y   +      LV++ +     +LFD+   R K   +  +    Q++  +
Sbjct: 121 ITH-PNIMALYEVWENKSELYLVLEYVEGG--ELFDYLIARGKLPEQEAIHYFKQIVQGV 177

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLS 228
              H  ++ +RD+KP+N L+ +  +     + + DFGMA              R  ++  
Sbjct: 178 SYCHNFNICHRDLKPENLLLDKKNK----TVKIADFGMA--------ALETTNRLLETSC 225

Query: 229 GTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 267
           G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 226 GSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 100/220 (45%), Gaps = 26/220 (11%)

Query: 61  YKIGKKIGEGSFGVLFEG---TNMINGMP--VAIKFEPRKTEAPQLKDEYRTYKIMAGTP 115
           Y IG  +GEG FG +  G    +  N +P  VAIK   R T       E + Y+ +    
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 116 NV--PQAYYFGQEGLHNILVIDLLGPSLE--DLFDWCGRKFSVK--TVVQVAVQMITLIE 169
           ++  P   Y  +E L N   I ++   +   + + +  RK  +K  +  ++  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSG 229
            +H   L++RD+K +N L+ +     EN + + DFG   ++ +            K+  G
Sbjct: 165 YMHYKGLVHRDLKLENLLLDK----HENLV-ITDFGFVNEFFEDNELM-------KTSCG 212

Query: 230 TARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 267
           +  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 17/151 (11%)

Query: 65  KKIGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVP 118
           K IG+G+FG    V  + T  I  M   +K E  K +  QL        ++AG+  P V 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 119 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
           I+RDIKPDN LI   G      I L DFG++
Sbjct: 472 IHRDIKPDNILIDIRGH-----IKLSDFGLS 497

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 99/229 (43%), Gaps = 25/229 (10%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     TN I  +    K +   K+E      E RT       P
Sbjct: 400 FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 458

Query: 116 N-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             VP  + F   E L+ +L   + G  L       GR F +        +++  +E LH+
Sbjct: 459 FIVPLKFSFQSPEKLYLVLAF-INGGELFYHLQKEGR-FDLSRARFYTAELLCALETLHS 516

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            ++IYRD+KP+N L+   G      I L DFG+ K     + K +       +  GT  Y
Sbjct: 517 LNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMQDQDKTN-------TFCGTPEY 564

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           ++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 565 LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 16/160 (10%)

Query: 156 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKT 215
           TV   A ++   ++ LH+  ++YRD+KP+N L+ + G      + L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGH-----LVLTDFGLSKSSASNAS 325

Query: 216 KQHI-------PYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 269 GLKAPNNKQKYEKIGEKKRTTNV-YDLSNGYPVQFGRYLE 307
           G    N+K    KI   K+   + Y LS+G     G  L+
Sbjct: 386 G---ANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLK 422

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 107/246 (43%), Gaps = 27/246 (10%)

Query: 44  SSSNMTSRDDSTIVGLH-YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT-----E 97
           S+S + +R  S    L+ ++I + +G GSFG +    +  NG   A+K   + T     +
Sbjct: 127 STSTLKARVTSGKYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQ 186

Query: 98  APQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKT 156
                DE     I++  P + + +   Q+     +++D + G  L  L     ++F    
Sbjct: 187 VEHTNDERNMLSIVSH-PFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLR-KSQRFPNPV 244

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
               A ++   +E LH+  +IYRD+KP+N L+ + G      I L DFG AK   D    
Sbjct: 245 AKFYAAEVCLALEYLHSKGIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD---- 295

Query: 217 QHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNK 276
             + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+      N  
Sbjct: 296 --VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNTI 346

Query: 277 QKYEKI 282
           + YE I
Sbjct: 347 KTYENI 352

>Scas_580.6
          Length = 1015

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 109/242 (45%), Gaps = 23/242 (9%)

Query: 37  NGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKT 96
           NG P  R+SS    +     V   ++  + IG G FG++++G ++      AIK     +
Sbjct: 15  NGKP--RASSLPKKQTSDQDVNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDS 72

Query: 97  EAPQLKDEYRTYKIMAG---TPNVPQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRK 151
           +  +++D  R  + ++     PN+ + Y  Y     L  I++    G SL  L      K
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSLW-IIMEYCAGGSLRSLLR--PGK 129

Query: 152 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYR 211
              K +  +  +++  ++ +H  ++I+RDIK  N LI      +E  + L DFG+A Q  
Sbjct: 130 IDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLIT-----NEGSVKLCDFGVAAQLN 184

Query: 212 DPKTKQHIPYRERKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGL 270
               +       R++++GT  +M+    + G     + D+ +LG   +    G  P+  +
Sbjct: 185 QSTLR-------RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEV 237

Query: 271 KA 272
           +A
Sbjct: 238 EA 239

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 91/190 (47%), Gaps = 19/190 (10%)

Query: 31  NANAPYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK 90
           N   P+ G+        +T+      +G  Y+I K +GEGSFG +    ++  G  VA+K
Sbjct: 6   NQQQPHGGSGQGHHQRQLTNHAQGQHIG-KYQIIKTLGEGSFGKVKLAYHISTGQKVALK 64

Query: 91  FEPRKTEAP-----QLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLF 145
              +K  A      +++ E  +Y  +   P++ + Y   +     I+VI+  G    +LF
Sbjct: 65  IINKKVLAKSDMQGRIEREI-SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELF 120

Query: 146 DWCGR--KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLI 202
           D+  +  K   +   +   Q+I+ ++  H H +++RD+KP+N L+      DE+  + + 
Sbjct: 121 DYIVQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLL------DEHLNVKIA 174

Query: 203 DFGMAKQYRD 212
           DFG++    D
Sbjct: 175 DFGLSNIMTD 184

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (45%), Gaps = 17/155 (10%)

Query: 61  YKIGKKIGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT-- 114
           ++  K IG+G+FG    V  + T  I  M   +K E  K +  QL        ++AG+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 115 PNVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
           P V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
               I+RDIKPDN LI   G      + L DFG++
Sbjct: 517 KLGFIHRDIKPDNILIDIRGH-----VKLSDFGLS 546

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 108/243 (44%), Gaps = 45/243 (18%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGT----- 114
           Y  GK++G G + ++ E  N   G  VA+K F P++ +     D+ RT K    T     
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 115 ---PNVPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QM 164
              PN+ +          +  +   LV++ +     +LF+   RK +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 165 ITLIEDLHAHDLIYRDIKPDNFL--IGRPGQPDE------------NKIHLIDFGMAKQY 210
           +  ++ LH+ ++I+RDIKP+N L  I +   P+E             ++ + DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 211 RDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 270
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+   
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ 325

Query: 271 KAP 273
            AP
Sbjct: 326 LAP 328

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 81/160 (50%), Gaps = 18/160 (11%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAP-----QLKDEYRTYKIMAGTP 115
           Y++ K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  +   P
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 97

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 173
           ++ + Y   +     I+VI+  G    +LFD+  +  K S     +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 174 HDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQYRD 212
           H +++RD+KP+N L+      DE+  + + DFG++    D
Sbjct: 155 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>Scas_648.17
          Length = 340

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 16/155 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KI   + G PN
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
           V +     Q+    I    L+   ++++ F      F++  +     Q++  +   H+  
Sbjct: 105 VIELLDIVQDPGSKIPA--LIFEEVKNMDFRQLYPTFTLPDIQFYFTQLLIALNYCHSMG 162

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 163 IMHRDVKPQNVMI----DPKERKLRLIDWGLAEFY 193

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 89/205 (43%), Gaps = 20/205 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVA----IKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P       +        N
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 117 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           + + Y       H + LV + L   L+   +   +      K + +  +Q+   I   HA
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYCHA 126

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H +I+RD+KP N LI R G      + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRIIHRDLKPQNLLINRNGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 234 MSINTHLGREQ-SRRDDMEALGHVF 257
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDVWSIGCIF 199

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 69/152 (45%), Gaps = 17/152 (11%)

Query: 67  IGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQA 120
           IG+G+FG    V  + T  I  M   +K E  K +  QL        ++AGT  P +   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 121 YYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 178
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 179 RDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           RDIKPDN LI   G      I L DFG++  +
Sbjct: 492 RDIKPDNILIDIRGH-----IKLSDFGLSTGF 518

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 15/185 (8%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y I K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 782 YDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 841

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H +
Sbjct: 842 YVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMG-CLPDEWVKQYLSEIIIGVEDMHNN 900

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYM 234
            +I+ D+KP+N LI   G      + L DFG+++     K  +HIP  +  SLS      
Sbjct: 901 GIIHHDLKPENLLIDVSGH-----LKLTDFGLSRAGL-VKRHRHIP--KPISLSNADTRS 952

Query: 235 SINTH 239
           +I++H
Sbjct: 953 NIDSH 957

>Kwal_14.1159
          Length = 1521

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y + K I +G++G +F     I G   AIK   +     K +   +K E     + +  P
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMG-SLPDQWVKQYISEVIYGVEDMHQS 795

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
            +I+ D+KPDN LI + G      + L DFG+++
Sbjct: 796 GIIHHDLKPDNLLIDQRGH-----LKLTDFGLSR 824

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 70/154 (45%), Gaps = 12/154 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y + K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 702 YDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 761

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + Y   Q   +  LV+  L G  +  L    G     K   Q   ++I+ ++D+H +
Sbjct: 762 YVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGN-LPEKWAKQYICEVISGVDDMHQN 820

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
            +I+ D+KPDN LI   G      I L DFG+++
Sbjct: 821 GIIHHDLKPDNLLIDSLGH-----IKLTDFGLSR 849

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 103/235 (43%), Gaps = 33/235 (14%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPV-AIKFEPRKTEAPQLKDEYRTYKIMAGTP 115
           +++ + +G+G+FG +++     T  I  M V + K   +K E      E R   +   + 
Sbjct: 304 FEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGE-RNILVRTASK 362

Query: 116 NVPQAY---YFGQEGLHNILVIDLLGPSLEDLFDWCGRK---FSVKTVVQVAVQMITLIE 169
           + P      +  Q      LV D L  S  +LF W  +K   F+ +       +++  +E
Sbjct: 363 SCPFIVGLKFSFQTPTDLYLVTDFL--SGGELF-WHLQKEGRFTEERAKFYIAELVLALE 419

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSG 229
            LH +D++YRD+KP+N L+   G      I L DFG++K     +T          +  G
Sbjct: 420 YLHDNDIVYRDLKPENILLDANGN-----IALCDFGLSKADLKDRT---------NTFCG 465

Query: 230 TARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
           T  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 466 TTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 517

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 100/227 (44%), Gaps = 39/227 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK---FEPRKTEAPQLKDEYRTYKIMAGTPNV 117
           +K  + IG G FGV+++  ++      AIK    +  + E   ++ E +    +  TPN+
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 118 PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV-----------QMIT 166
              +Y+G           L+   L  + ++C    S++T+++  +           +++ 
Sbjct: 76  --THYYGSY---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILV 123

Query: 167 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKS 226
            +  +H  ++I+RDIK  N LI   G      + L DFG+A Q      K       R++
Sbjct: 124 ALISIHRDNVIHRDIKAANILIANNG-----SVKLCDFGVAAQLSQSMLK-------RQT 171

Query: 227 LSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
           ++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 172 MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 65  KKIGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVP 118
           K IG+G+FG    V  + T  I  M   +K E  K +  QL        ++AG+  P V 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 119 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           I+RDIKPDN LI   G      I L DFG++  +
Sbjct: 430 IHRDIKPDNILIDIRGH-----IKLSDFGLSTGF 458

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 162 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
            +++  +E LH +D++YRD+KP+N L+   G      I L DFG++K     +T      
Sbjct: 448 AELVLALEHLHDNDIVYRDLKPENILLDANGN-----IALCDFGLSKADLKDRT------ 496

Query: 222 RERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
               +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+
Sbjct: 497 ---NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFYAEDNQKMYQ 550

Query: 281 KIG 283
           KI 
Sbjct: 551 KIA 553

>Kwal_14.1273
          Length = 415

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 101/246 (41%), Gaps = 38/246 (15%)

Query: 66  KIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-------APQLKDEYRTYKIM-AGTPNV 117
           KI  GSF  ++   +      VA+K   + +E       A  +  E    +++  G PNV
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 118 PQAYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRKFSVKTV----VQVAVQMITLIE 169
                F +     + V++       DL+D    W  ++ S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 170 DLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSG 229
             H+  + +RDIKP+N L+   G      + L D+G++       T+  +    R    G
Sbjct: 123 YAHSCGIAHRDIKPENVLLDSAGN-----VKLADWGLS-------TRMRVSCDTRI---G 167

Query: 230 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG---LKAPNNKQKYEKIGEKK 286
           T +Y++   +     +   D  +LG    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 287 RTTNVY 292
           R  + Y
Sbjct: 228 RFISEY 233

>Kwal_33.14554
          Length = 714

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 71/155 (45%), Gaps = 17/155 (10%)

Query: 61  YKIGKKIGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT-- 114
           ++  K IG+G+FG    V  + T  I  M   +K E  K +  QL        ++AG+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 115 PNVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
           P V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
               I+RDIKPDN LI   G      I L DFG++
Sbjct: 419 KLGFIHRDIKPDNILIDIRGH-----IKLSDFGLS 448

>Kwal_47.16761
          Length = 744

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 162 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
            +++  +E LH +D++YRD+KP+N L+   G      I L DFG++K     +T      
Sbjct: 442 AELVLALEYLHENDIVYRDLKPENILLDANG-----NIALCDFGLSKADLKDRT------ 490

Query: 222 RERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
               +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+
Sbjct: 491 ---NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQ 544

Query: 281 KIG 283
           KI 
Sbjct: 545 KIA 547

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (45%), Gaps = 15/155 (9%)

Query: 115 PNVPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           PN+ ++Y YF  E    +L+  L+   +  L    G  F+         Q+   ++ +H 
Sbjct: 162 PNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHG-PFNDILASDYIYQIANALDYMHK 220

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            ++I+RDIKP+N LIG       N I L DFG +    +P      P   RK++ GT  Y
Sbjct: 221 KNIIHRDIKPENILIGF-----NNVIKLTDFGWS--IINP------PENRRKTVCGTIDY 267

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +S      RE     D  ALG + F  L G  P++
Sbjct: 268 LSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE 302

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 163 QMITLIEDLHAHD-LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
           Q+++ I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTLRVSM 178

Query: 222 RERKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQ 268
            +R    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>Kwal_55.21545
          Length = 865

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 97/221 (43%), Gaps = 19/221 (8%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           V   +K  + IG G FGV+++G         AIK     +   +++D  +  + ++    
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 117 VPQAYYFGQEGLHN----ILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 172
           VP   ++    L++    +++    G SL  L      K   + +  +  +++T +  +H
Sbjct: 75  VPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLR--PGKIGEQYIGVIMRELLTALMHIH 132

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
              +I+RDIK  N LI   G      I L DFG+A Q    K +       R++++GT  
Sbjct: 133 KDGVIHRDIKAANVLITNDGH-----IKLCDFGVAAQLSQTKIR-------RQTMAGTPY 180

Query: 233 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 181 WMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>Kwal_56.24091
          Length = 381

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 73/155 (47%), Gaps = 15/155 (9%)

Query: 115 PNVPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           PN+ + Y YF  E    +L+  L+   L       G  F+  T      QM   +  +H+
Sbjct: 181 PNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHG-PFNDITASHFVHQMADALNYMHS 239

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            ++++RDIKP+N L+G      +N + L DFG +          ++   +RK+L GT  Y
Sbjct: 240 KNILHRDIKPENILLGF-----QNTLKLTDFGWS--------VSNVGNSKRKTLCGTMDY 286

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +S      RE   + D+ ALG + +  L G  P++
Sbjct: 287 LSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 14/156 (8%)

Query: 156 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ--YRDP 213
           TV   A ++   ++ LH+  ++YRD+KP+N L+   G      + L DFG++K+  + D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGH-----LVLTDFGLSKKSVFDDA 336

Query: 214 KTKQHIP-YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 270
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 271 KAPNNKQKYEKIGEKKRTTNVYDLSNGYPVQFGRYL 306
           K   NK K EK G +  +     LS+G+    G  L
Sbjct: 397 KIILNKIKQEKTGARIPSY----LSDGFKDYLGALL 428

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 90/205 (43%), Gaps = 20/205 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVA----IKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P       +        N
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPSTAIREISLLKELRDDN 66

Query: 117 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           + + Y       H + LV + L   L+   +   ++     K + +  +Q+   I   HA
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYCHA 126

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H +++RD+KP N LI R G      + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRILHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 234 MSINTHLGREQ-SRRDDMEALGHVF 257
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDIWSIGCIF 199

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 109/253 (43%), Gaps = 50/253 (19%)

Query: 57   VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK------FEPRKTEAPQLKDEYRTYKI 110
            V + ++    IG G+FG ++   ++ NG  +A+K       +  +   P +K+E    +I
Sbjct: 1262 VSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEI 1321

Query: 111  MAGTPNVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 165
            +   PN+    Y+G E +H    NI +    G SL  L +  GR    + V QV  +Q++
Sbjct: 1322 L-NHPNI--VSYYGVE-VHRDKVNIFMEYCEGGSLAALLE-HGR-IEDEMVTQVYTLQLL 1375

Query: 166  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK--------- 216
              +  LH   +++RD+KP+N L+   G      I  +DFG AK+  +  T+         
Sbjct: 1376 EGLAYLHESGIVHRDVKPENILLDFNGV-----IKYVDFGAAKKIANNGTRLASMNKIEN 1430

Query: 217  --------------QHIPYRERKSLS--GTARYM---SINTHLGREQSRRDDMEALGHVF 257
                          + +   E   L   GT  YM   SI     + +   DD+ +LG V 
Sbjct: 1431 ADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVV 1490

Query: 258  FYFLRGQLPWQGL 270
               + G+ PW  L
Sbjct: 1491 LEMITGRRPWANL 1503

>Scas_651.18
          Length = 371

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 109/262 (41%), Gaps = 27/262 (10%)

Query: 28  PAMNANAPYNGTPSNRSSSNMTSRDDSTIVGLH-YKIGKKIGEGSFGVLFEGTNMINGMP 86
           PA     P+  T       N+  R  S    L+ ++I + +G GSFG +    +  NG  
Sbjct: 25  PAPVQQHPHPRTEHQAPRKNLHGRKTSGKYTLNDFQILRTLGTGSFGRVHLIRSNHNGRF 84

Query: 87  VAIKFEPRKT-----EAPQLKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLL-GPS 140
            A+K   + T     +     DE R    +   P + + +   Q+     +++D + G  
Sbjct: 85  YALKVLKKHTIVKLKQVEHTNDE-RLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGE 143

Query: 141 LEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIH 200
           L  L     ++F        A ++   +E LH+ D+IYRD+KP+N L+ + G      I 
Sbjct: 144 LFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLDKNGH-----IK 197

Query: 201 LIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 260
           + DFG AK   D      I Y    +L GT  Y++      +  ++  D  + G + +  
Sbjct: 198 ITDFGFAKYVPD------ITY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEM 247

Query: 261 LRGQLPWQGLKAPNNKQKYEKI 282
           L G  P+      N  + YE I
Sbjct: 248 LAGYTPFYD---SNTMKTYENI 266

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y I K I +G++G ++     I G   AIK   +     K +   +K E     + +  P
Sbjct: 682 YDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKP 741

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + Y   Q   +  LV++ L G  L  L    G     K   Q   ++I  ++D+H  
Sbjct: 742 YVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMG-NLPDKWAKQYITEVIIGVDDMHMS 800

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
            +I+ D+KPDN LI   G      + L DFG+++
Sbjct: 801 GIIHHDLKPDNLLIDSNGH-----VKLTDFGLSR 829

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 109/262 (41%), Gaps = 51/262 (19%)

Query: 45  SSNMTSRDDSTIVGLHYKI--------GKKIGEGSFGVLFEGTNMINGMPVAIK---FEP 93
           S + +  DD  IV L  K+        G +IG GSFG ++ G N   G  +A+K    EP
Sbjct: 391 SESESECDDDNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEP 450

Query: 94  RKTEAPQLKDEYRTY----KIMAGTPNVPQ---------------------AYYFG--QE 126
               A    D+ +++     ++    + PQ                       Y+G  QE
Sbjct: 451 TTVMASS--DDKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHHENIVTYYGSSQE 508

Query: 127 GLH-NILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 185
           G + NI +  + G S+  + +  G  F    V     Q +  +  LH  ++I+RDIK  N
Sbjct: 509 GGNLNIFLEYVPGGSVSSMLNSYG-PFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGAN 567

Query: 186 FLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQS 245
            LI   G      + + DFG++K+      KQ+    +R SL G+  +M+         +
Sbjct: 568 LLIDIKGS-----VKITDFGISKKLSPLNKKQN----KRASLQGSVYWMAPEVVKQVVTT 618

Query: 246 RRDDMEALGHVFFYFLRGQLPW 267
            + D+ ++G V      G+ P+
Sbjct: 619 EKADIWSVGCVVVEMFTGKHPF 640

>Kwal_26.8709
          Length = 829

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 114/251 (45%), Gaps = 33/251 (13%)

Query: 34  APYNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEG----TNMINGMP--V 87
           AP +    +R S++ +++    +    Y +G  +GEG FG +  G    +N    +P  V
Sbjct: 13  APTSSYTKSRQSTSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQV 72

Query: 88  AIKFEPRKTEAPQLKDEYRTYKIMAGT-----PNVPQAYYFGQEGLHNILVIDLLGPSLE 142
           AIK   R T     + E + Y+ +        PN+ +     Q   +  +V++    S  
Sbjct: 73  AIKLIRRDTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYA--SGG 130

Query: 143 DLFDWCGRKFSVKT--VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIH 200
           + + +  +K  +K     ++  Q+I+ +  +H+  L++RD+K +N L+      D+N+  
Sbjct: 131 EFYKYIQKKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLL------DKNENL 184

Query: 201 LI-DFGMAKQYRDPKTKQHIPYRE-RKSLSGTARYMSINTHLGRE--QSRRDDMEALGHV 256
           LI DFG   ++        +P  E  K+  G+  Y +    +     ++R+ D+ + G +
Sbjct: 185 LITDFGFVNEF--------LPENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVI 236

Query: 257 FFYFLRGQLPW 267
            +  L G LPW
Sbjct: 237 LYAMLAGYLPW 247

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 99/214 (46%), Gaps = 15/214 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQ--LKDEYRTYKIMAGT--PN 116
           Y   + +G GSFGV+     + +   VA+K   ++       L+  Y    I+     PN
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 117 VPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
           + +   +F  E    I+     G  L D     G K++ +  V + VQ++  +E LH+ +
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDG-KYTEEDAVNIVVQILKAVEYLHSQN 183

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235
           +I+RD+KP+N L     +  +++I L DFG+A+Q  +      + YR     +G+  Y++
Sbjct: 184 IIHRDLKPENLL--YLDKSKDSRIVLADFGIARQLEND---DDVIYRP----AGSLGYVA 234

Query: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 269
                     +  D+ ++G + +  L G  P++ 
Sbjct: 235 PEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>Scas_707.3
          Length = 1598

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y I K I +G++G ++     I G   AIK   +     K +   +K E     + +  P
Sbjct: 699 YTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 758

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + +   Q   +  LV++ L G  L  L    G     + V Q   ++I  ++D+H +
Sbjct: 759 YVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRN 817

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
            +I+ D+KPDN LI   G      + L DFG+++
Sbjct: 818 WIIHHDLKPDNLLIDNLGH-----VKLTDFGLSR 846

>Scas_654.12
          Length = 737

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 65  KKIGEGSFG----VLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVP 118
           K IG+G+FG    V    T  I  M   +K E  K +  QL        ++AG+  P V 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 119 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
           I+RDIKPDN LI   G      I L DFG++
Sbjct: 439 IHRDIKPDNILIDIRGH-----IKLSDFGLS 464

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 15/122 (12%)

Query: 161 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP 220
           A +++  ++ LH  D++YRD+KP+N L+   G      I L DFG+ K       K    
Sbjct: 481 ASELLLALDSLHKMDVVYRDLKPENILLDSQGH-----IALCDFGLCKLNMKDNEKT--- 532

Query: 221 YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
                +  GT  Y++    LG+  ++  D   LG + +  L G  P+      N  + Y+
Sbjct: 533 ----STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYD---ENVSEMYK 585

Query: 281 KI 282
           KI
Sbjct: 586 KI 587

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 76/167 (45%), Gaps = 20/167 (11%)

Query: 56  IVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD-----EYRTYKI 110
           +  ++Y   KK+GEG++ V++ G    +G  +AIK    + +  Q KD       R  K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 111 MAGT--PNVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 166
           +      NV +    +  QE L+  LV++ L   LE L       F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 167 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
            +   H   +++RD+KP+N L+   GQ     + + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLAPDGQ-----LKIADFGLARTLAAP 156

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 143 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHL 201
           DLF      K S + +     Q++T +E LH+  L +RD+K DN +I   G      + L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQG-----IVKL 562

Query: 202 IDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 260
           IDFG A+ +  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 261 LRGQLPWQGLKAPNNKQKY 279
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 11/135 (8%)

Query: 156 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-YRDPK 214
           TV   A ++   +  LH   ++YRD+KP+N L+ + G      + L DFG++K+   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGH-----LVLTDFGLSKKSANDSA 307

Query: 215 TKQHIP--YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
             +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G+ P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 273 PNNKQKYEKIGEKKR 287
            N+K    KI + K+
Sbjct: 365 SNHKVIINKIQQNKQ 379

>Kwal_27.11919
          Length = 209

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 89/205 (43%), Gaps = 20/205 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVA----IKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           YK  +K+GEG++GV+++  ++ +G  V     I+ E      P       +        N
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 117 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           + + Y       H + LV + L   L+   +   ++       + +  +Q+   I   H+
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYCHS 126

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H +++RD+KP N LI R G      + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRILHRDLKPQNLLINRDGN-----MKLADFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 234 MSINTHLGREQ-SRRDDMEALGHVF 257
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDIWSIGCIF 199

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 162 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
            +++  +E LH +D++YRD+KP+N L+   G      I L DFG++K     +T      
Sbjct: 433 AELVLALEYLHDNDIVYRDLKPENILLDANGN-----IALCDFGLSKADLKDRT------ 481

Query: 222 RERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
               +  GT  Y++    +     ++  D  +LG + F    G   W    A +N++ Y+
Sbjct: 482 ---NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WSPFFASDNQKMYQ 535

Query: 281 KIG 283
           KI 
Sbjct: 536 KIA 538

>Scas_721.124
          Length = 684

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 19/124 (15%)

Query: 161 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK--QYRDPKTKQH 218
           A +++  +E LH  ++IYRD+KP+N L+   G      I L DFG+ K     D KT   
Sbjct: 455 AAELLCALETLHNLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT--- 506

Query: 219 IPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQK 278
                  +  GT  Y++    LG+  ++  D   LG + +  L G  P+     P   + 
Sbjct: 507 ------DTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KM 557

Query: 279 YEKI 282
           Y+KI
Sbjct: 558 YKKI 561

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 91/223 (40%), Gaps = 35/223 (15%)

Query: 62  KIGKKIGEGSFGVLFEG-TNMINGMPVAIKFEPRKTEAPQ------LKDEYRTYKIMAGT 114
           ++G  IGEGSFG +        + + VA+KF    T A        +  E   +   +  
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKH 74

Query: 115 PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVK-TVVQVAV-QMITLIEDLH 172
            NV +       G +  +++++      DLFD       V   V Q    Q+I  +  LH
Sbjct: 75  ANVLRVIDCNVGGEYLWIMLEMADGG--DLFDKIEPDVGVDPDVAQFYFQQLIRALNYLH 132

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHI--------PYRER 224
              + +RDIKP+N L+ + G      + L DFG+A Q+R       +        PY   
Sbjct: 133 DVGVAHRDIKPENILLDKKGN-----LKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAP 187

Query: 225 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           + LS    Y +I            D+ + G + F  L G++PW
Sbjct: 188 EILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 70/152 (46%), Gaps = 19/152 (12%)

Query: 65  KKIGEGSFG----VLFEGTNMINGMPVAIKFEP-RKTEAPQLKDEYRTYKIMAGT--PNV 117
           K IG+G+FG    V  + T  I  M   +K E   K +   +K E     ++AG+  P V
Sbjct: 307 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAER---DVLAGSDSPWV 363

Query: 118 PQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
              YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H   
Sbjct: 364 VSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVIHKLG 421

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
            I+RDIKPDN LI   G      I L DFG++
Sbjct: 422 FIHRDIKPDNILIDIRGH-----IKLSDFGLS 448

>Scas_700.54
          Length = 698

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 108/245 (44%), Gaps = 31/245 (12%)

Query: 53  DSTIVGLHYKIG---KKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYK 109
           +ST+ G+        + +G+G+F  + +      G   A+K   ++     ++   R  +
Sbjct: 212 ESTLTGIFKDFSIQDEVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELE 271

Query: 110 IMAGT--PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMI 165
           ++     P + +   F ++     +V++ +     DL D+     +V  +   +++ Q++
Sbjct: 272 VLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQIL 329

Query: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225
             ++ +H+  + +RD+KPDN LI    Q D   + + DFG+AK   +            K
Sbjct: 330 EAVKYIHSKGISHRDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MK 378

Query: 226 SLSGTARYMSINTHLGR--------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 277
           +  GT  Y++     G+        E S   DM ++G + +  L G LP+ G      +Q
Sbjct: 379 TFCGTLAYVAPEVIGGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQ 435

Query: 278 KYEKI 282
            Y++I
Sbjct: 436 LYKQI 440

>Kwal_26.8796
          Length = 796

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 93/215 (43%), Gaps = 25/215 (11%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYYFG 124
           +G+G+F  + +      G   A+K   ++     +    R  +++     P +     F 
Sbjct: 194 VGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVARELEVLQRLDHPRIVSLKGFY 253

Query: 125 QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 182
           ++   + LV++ +  S  DL D+     SV      ++  Q++  ++ +H+  + +RD+K
Sbjct: 254 EDKDSHYLVMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLK 311

Query: 183 PDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGR 242
           PDN LI R    D   + + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 312 PDNILIER---DDPVLVKITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGK 360

Query: 243 EQSRRD--------DMEALGHVFFYFLRGQLPWQG 269
               ++        DM ++G + +  L G LP+ G
Sbjct: 361 NSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSG 395

>Kwal_55.20326
          Length = 750

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 107/260 (41%), Gaps = 54/260 (20%)

Query: 52  DDSTIVGLHYKI--------GKKIGEGSFGVLFEGTNMINGMPVAIK---FEPRKTEA-- 98
           +D  ++ L  KI        G +IG GSFG ++ G N   G  +A+K    +P    A  
Sbjct: 441 EDEDVISLPTKIATPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGV 500

Query: 99  ----PQLKDEYRTYKIMAGTPNVPQAY------------------------YFG--QEGL 128
                ++K +Y      +   N  Q +                        Y+G  QEG 
Sbjct: 501 VSVPDEVKKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGG 560

Query: 129 H-NILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFL 187
           + NI +  + G S+  + +  G  F    +     Q++  +  LH  D+I+RDIK  N L
Sbjct: 561 NLNIFLEYVPGGSVSSMLNSYG-PFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANIL 619

Query: 188 IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRR 247
           I   G      + + DFG++K+      +Q+    +R SL G+  +M+         +++
Sbjct: 620 IDIKGC-----VKITDFGISKKLSPLNQQQN----KRASLQGSVYWMAPEVVKQVVTTKK 670

Query: 248 DDMEALGHVFFYFLRGQLPW 267
            D+ ++G V      G+ P+
Sbjct: 671 ADIWSVGCVIIEMFTGKHPF 690

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 82/184 (44%), Gaps = 28/184 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGT--PNV 117
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E +  +++     PN 
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 118 PQAYYFGQEGL----HNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIED 170
              +    +      H  LV +LL  +L +L      KF   S++ +    +Q++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKTKQ 217
           L    LI+ D+KP+N L+  P +PD   + +IDFG + +             YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 218 HIPY 221
            IPY
Sbjct: 536 GIPY 539

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 14/146 (9%)

Query: 156 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK----QYR 211
           TV   A ++   ++ LH+  ++YRD+KP+N L+      D+  + L DFG++K    Q  
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 212 DPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 271
            P   + +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G+ P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 272 APNNKQKYEKIGEKKRTTNVYDLSNG 297
             N+K    KI + K     + LS+G
Sbjct: 376 -ANHKVILSKIKQDKGIKIPHYLSDG 400

>Scas_721.46
          Length = 296

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 88/205 (42%), Gaps = 20/205 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVA----IKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           YK  +K+GEG++GV+++  +M  G  V     I+ E      P       +        N
Sbjct: 8   YKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDN 67

Query: 117 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAVQMITLIEDLHA 173
           + + Y       H + LV + L   L+   +   +  S+ +  + +   Q+   I   HA
Sbjct: 68  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAYCHA 127

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H +++RD+KP N LI + G      + L DFG+A+ +        +P R       T  Y
Sbjct: 128 HRILHRDLKPQNLLINKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 175

Query: 234 MSINTHLGREQ-SRRDDMEALGHVF 257
            +    LG +Q S   D  ++G +F
Sbjct: 176 RAPEVLLGGKQYSTGVDTWSIGCIF 200

>Scas_717.69
          Length = 674

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 94/229 (41%), Gaps = 25/229 (10%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     T  I  +    K +   K+E      E RT       P
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVNCP 403

Query: 116 N-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             VP  + F   E L+ +L   + G  L       GR F +        +++  +E LH 
Sbjct: 404 FIVPLKFSFQSPEKLYLVLAC-INGGELFYHLQKEGR-FELSRARFYTAELLCALETLHN 461

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            D+IYRD+KP+N L+   G      I L DFG+ K     + K         +  GT  Y
Sbjct: 462 LDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKT-------DTFCGTPEY 509

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           ++    L +  S+  D   LG + +  L G  P+     P   + Y KI
Sbjct: 510 LAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP---KMYRKI 555

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 93/226 (41%), Gaps = 40/226 (17%)

Query: 58  GLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNV 117
            + Y++ + IG GS+GV+++ TN      VAIK E    +  +L D      ++    ++
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 118 PQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQ------------VAVQM 164
               Y G  +  HN+ +I           ++C  K S+K ++                Q 
Sbjct: 78  NIVKYHGFIQKQHNLYII----------LEYCA-KGSLKNLISRNRPMSEHEAKPYVRQT 126

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRER 224
           +  +  LH   +I+RDIK  N L+       EN + L DFG++ +  +            
Sbjct: 127 LNGLNYLHEQGVIHRDIKAANILLD-----SENVVKLADFGVSTKVNNTAM--------- 172

Query: 225 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 270
            +L+G+  +M+      R  S   D+ +LG      L G  P+  L
Sbjct: 173 -TLAGSLNWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>Kwal_55.21709
          Length = 340

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMA---GTPN 116
           HY+I  KIG G +  +F G  ++N     IK      +  +LK  YR  KI+    G PN
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGPN 104

Query: 117 VPQAYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
           V       Q+    I    L+   ++++ F     KF++  +     Q++  ++  H+  
Sbjct: 105 VIALLDIVQDSGSKIPA--LIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIALDYCHSMG 162

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           +++RD+KP N +I     P E K+ LID+G+A+ Y
Sbjct: 163 IMHRDVKPQNVMI----DPVERKLRLIDWGLAEFY 193

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGTPNVPQ 119
           Y +   +G+G+FG + +  N++    +A+K    +TE   Q   E +  +++    +   
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 120 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIED 170
            ++F +         H  LV +LL  +L +L      KF   S++ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKTKQ 217
           L    LI+ D+KP+N L+  P +P+   + +IDFG + +             YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 218 HIPY 221
            IPY
Sbjct: 544 GIPY 547

>Kwal_33.14434
          Length = 759

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 143 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHL 201
           DLF      K S + +     Q++T ++ LH+  L +RD+K DN +I + G      + L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINKHGV-----VKL 543

Query: 202 IDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 260
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 261 LRGQLPWQGLKAPNNKQK 278
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 93/205 (45%), Gaps = 18/205 (8%)

Query: 66  KIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAY-Y 122
           KIG+G+ G ++    +   + VAIK +    + P+ +       +M G+  PN+      
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIK-QMNLEKQPKKELIINEILVMKGSKHPNIVNFIDS 683

Query: 123 FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIK 182
           +  +G   +++  + G SL D+   C    +   +  V  + ++ +E LH+  +++RDIK
Sbjct: 684 YVLKGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIK 741

Query: 183 PDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGR 242
            DN L+   G      I L DFG   Q  +   K       R ++ GT  +M+      +
Sbjct: 742 SDNILLSMEGD-----IKLTDFGFCAQINELNLK-------RTTMVGTPYWMAPEVVSRK 789

Query: 243 EQSRRDDMEALGHVFFYFLRGQLPW 267
           E   + D+ +LG +    + G+ P+
Sbjct: 790 EYGPKVDIWSLGIMIIEMIEGEPPY 814

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 96/231 (41%), Gaps = 29/231 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-----FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +          A+K     +   K+E      E RT       P
Sbjct: 347 FDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDCP 405

Query: 116 N-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             VP  + F   E L+ +L   + G  L       GR F +        +++  +++LH 
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAF-INGGELFYHLQKEGR-FDLSRARFYTAELLCALDNLHK 463

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK--QYRDPKTKQHIPYRERKSLSGTA 231
            D++YRD+KP+N L+   G      I L DFG+ K     D KT          +  GT 
Sbjct: 464 LDVVYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT---------DTFCGTP 509

Query: 232 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
            Y++    LG   ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 510 EYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 557

>Kwal_33.13984
          Length = 649

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 24/182 (13%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGTPNVPQ 119
           Y +   +G+G+FG + +  N++    +A+K    K+E   Q   E +  +++ G  +   
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 120 AYYFGQ--EGL----HNILVIDLLGPSLEDLFDWCG-RKFSVKTVVQVAVQMITLIEDLH 172
            ++F +  E      H  LV +LL  +L +L         S+  +   A Q++  +  L 
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLK 397

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKTKQHI 219
            H LI+ D+KP+N L+    +P+   + +IDFG A +             YR P+    I
Sbjct: 398 EHKLIHCDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVILGI 454

Query: 220 PY 221
           PY
Sbjct: 455 PY 456

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 97/234 (41%), Gaps = 34/234 (14%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYYFG 124
           +G G+F  + +      G   A+K   ++     +    R  +++     P +     F 
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFY 253

Query: 125 QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 182
           ++  +  +V++ +     DL D+     +V      +++ Q++  I+ +H+  + +RD+K
Sbjct: 254 EDEANYYMVMEFISGG--DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLK 311

Query: 183 PDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLG- 241
           PDN LI    Q D   + + DFG+AK   +            K+  GT  Y++     G 
Sbjct: 312 PDNILI---EQDDPVLVKITDFGLAKVQGNGSI--------MKTFCGTLAYVAPEVIGGF 360

Query: 242 -------------REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
                         E S   DM ++G + F  L G LP+ G      +Q YE+I
Sbjct: 361 TGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSG---STQEQLYEQI 411

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 92/200 (46%), Gaps = 26/200 (13%)

Query: 52  DDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK---FEPRKTEAPQLKDEYRTY 108
           DD  +  + +K+GK IG G++G++ E  ++ +G   A+K   F+  +     +  E   +
Sbjct: 478 DDKGLFIMGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVW 537

Query: 109 KIMAGTPNVPQ---------AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFS------ 153
           K M     +P          A Y   E + +  + DL+         W  RK +      
Sbjct: 538 KEMHHMYILPLLDWKLISDYAMYCLTERVKDGTLYDLV-------LSWEDRKNNQIPVDE 590

Query: 154 -VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRD 212
            +K  + + +Q+I+ ++ +H++  ++ DIK +N L+ +  Q     I L DFGM+ ++  
Sbjct: 591 RIKLTMFLMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGS 650

Query: 213 PKTKQHIPYRERKSLSGTAR 232
            +++      E K+ SG  R
Sbjct: 651 YRSRYDTLIDEEKNNSGIIR 670

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 92/210 (43%), Gaps = 19/210 (9%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIKF----EPRKTEAPQLKDEYRTYKIMAGT--PNVPQA 120
           +GEGS G +     +++    A+K     + R++E   +K+    Y I +    PN+ + 
Sbjct: 367 LGEGSGGKVKLVQRVLDNKVFALKEYRSKKKRESERKYIKNIISEYCIASTLKNPNICET 426

Query: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYR 179
                E      +  +L     DLF      K   + +  +  Q+I  ++ LH   L +R
Sbjct: 427 LEILYEKGK---IFQILEYCEYDLFSLVMSEKMHYEEICCLFKQLINGVKYLHDIGLSHR 483

Query: 180 DIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTH 239
           D+K DN ++ R G      + LIDFG +  +  P + Q I   E   + G+  Y+S    
Sbjct: 484 DLKLDNCVVTRRGI-----LKLIDFGASSVFHYPLSSQMI---EANGIVGSDPYLSPEVF 535

Query: 240 LGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 268
              E   R  D+ ++G +FF  +  + PW+
Sbjct: 536 YFNEYDPRALDVWSVGIIFFCMITRRFPWK 565

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 98/242 (40%), Gaps = 44/242 (18%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIK----FEPR-------KTEAPQLKDEYRTY 108
           +++I   +G G +G +    ++  G  VAIK    FE R       K E P++  E    
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVM 108

Query: 109 KIMAGTPNVPQAYYF--GQEGLHNILVIDLL--GPSLEDLFDWCGR-KFSVKTV------ 157
           K      NV + Y      E     LV++    GP       WC   K  +K V      
Sbjct: 109 K-RCHHENVVELYEILNDPESTKVYLVLEYCSRGP-----VKWCPENKMEIKAVGPSILT 162

Query: 158 ----VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
                +V + +++ +E LH+  + +RDIKP N LI   G      + + DFG+A      
Sbjct: 163 FQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGT-----VKISDFGVAMSTATG 217

Query: 214 KT---KQHIPYRERKSLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
            T     H    + ++L GT  + +    +T      S   D+ +LG   +  L G+LP+
Sbjct: 218 STNIQSSHEQLLKSRAL-GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

Query: 268 QG 269
             
Sbjct: 277 NA 278

>Kwal_26.7861
          Length = 955

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 92/214 (42%), Gaps = 26/214 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIM-------AG 113
           YK   KIG+G+ G ++    +     VAIK   +     Q K E    +I+       A 
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIK---QMNLEKQPKKELIINEILVMKASKHAN 723

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             N   +Y     G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+
Sbjct: 724 IVNFIDSYLL--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHS 779

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
             +I+RDIK DN L+   G+     I L DFG   Q  +   K       R ++ GT  +
Sbjct: 780 KGVIHRDIKSDNVLLSMSGE-----IKLTDFGFCAQINEINLK-------RTTMVGTPYW 827

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           M+      +E   + D+ +LG +    + G+ P+
Sbjct: 828 MAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 861

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 90/208 (43%), Gaps = 23/208 (11%)

Query: 66  KIGEG-SFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQ--AYY 122
           KIG+G S GV    +       VAIK   +     Q K E    +IM  + +  Q    Y
Sbjct: 571 KIGQGASGGVYLSHSRSDKSQCVAIK---QMNLEKQPKKELIVNEIMVMSSSKHQNIVNY 627

Query: 123 FGQ--EGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYR 179
                 GL   +V++ + G  L D+  +C    +   +  V  +++  +E LH+  +++R
Sbjct: 628 IDSYLSGLDLWVVMEYMEGGCLTDVVTYCV--LTEGQIGAVCREVLQGLEFLHSKGVLHR 685

Query: 180 DIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTH 239
           DIK DN L+   G      I L DFG   Q  D   K       R ++ GT  +M+    
Sbjct: 686 DIKSDNVLLSMNGD-----IKLTDFGFCAQVNDTVIK-------RTTMVGTPYWMAPEIV 733

Query: 240 LGREQSRRDDMEALGHVFFYFLRGQLPW 267
             +E   + D+ +LG +    + G+ P+
Sbjct: 734 SRKEYGPKVDIWSLGIMIIEMIEGEPPY 761

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (43%), Gaps = 37/180 (20%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMP----VAIKFEPR---------KTEAPQLKDEYRT 107
           Y+I  KIGEG+F  +F+   + N +     VAIK  P+         KT   Q  +E   
Sbjct: 67  YRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELNI 126

Query: 108 YKIM--AGTPNVPQA---------YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT 156
           +  +  A  PNV +          YYF QE +         G     +  +    FS   
Sbjct: 127 HLKLTKANVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYTY--FSEDL 177

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
              V  Q+ T ++ LH +++I+RDIKP+N LI  P    E  IH   +   ++  DPKTK
Sbjct: 178 TRHVIRQVATAVKGLHENNIIHRDIKPEN-LIFEPI-IKEQTIH--RYQKLRKSDDPKTK 233

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 106/248 (42%), Gaps = 54/248 (21%)

Query: 36  YNGTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIK----- 90
           YN   S  SSS +T       VG +YKI K+IGEGSFG ++  T+      V +K     
Sbjct: 24  YNRLYSQFSSSELTE------VG-NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS 76

Query: 91  --------FEPRKTEAPQLKDEYRTYKIMAGTPNVPQA--YYFGQEGLHNILVIDLLGPS 140
                   F  R+ + P +    + Y+++     V  A  Y  G+E   ++L    L P+
Sbjct: 77  DPNVVREVFYHRQFDYPYIT---KLYEVIVTETKVWMALEYCPGKELYDHLLSKSRL-PT 132

Query: 141 LEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIH 200
           LE     C   F+         Q+   +   H  + ++RD+K +N L+ + G        
Sbjct: 133 LE-----CAELFA---------QITGAVHYAHTLNCVHRDLKLENVLLDKNGNA-----K 173

Query: 201 LIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFY 259
           L DFG     R+  TK  +     +++ GT  YM+      +     + D+ +LG + + 
Sbjct: 174 LTDFGFT---RESMTKAVL-----ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYT 225

Query: 260 FLRGQLPW 267
            L G LP+
Sbjct: 226 LLCGCLPF 233

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 90/220 (40%), Gaps = 22/220 (10%)

Query: 61  YKIGKKIGEGSFGVLFE----GTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKIMAGTP 115
           + + K IG+GSFG + +     T  I  +    K +   K E      E RT       P
Sbjct: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAE-RTVLARVDCP 402

Query: 116 N-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
             VP  + F   E L+ +L   + G  L       GR FS+        +++  ++ LH 
Sbjct: 403 FIVPLKFSFQSPEKLYLVLAF-INGGELFYHLQHEGR-FSLARSRFYIAELLCALDSLHK 460

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
            D+IYRD+KP+N L+   G      I L DFG+ K       K         +  GT  Y
Sbjct: 461 LDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDNDKT-------DTFCGTPEY 508

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
           ++    LG+  ++  D   LG + +  + G  P+     P
Sbjct: 509 LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVP 548

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 89/207 (42%), Gaps = 22/207 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGM---PVA---IKFEPRKTEAPQLKDEYRTYKIMAGT 114
           YK  +K+GEG++GV+++  ++  G     VA   I+ E      P       +       
Sbjct: 8   YKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

Query: 115 PNVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDL 171
            N+ + Y       H + LV++ L   L+   +   +     V  + +  VQ+   I   
Sbjct: 68  DNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKGIAYC 127

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTA 231
           HAH +++RD+KP N LI + G      + L DFG+A+ +        +P R       T 
Sbjct: 128 HAHRILHRDLKPQNLLIDKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 175

Query: 232 RYMSINTHLGREQ-SRRDDMEALGHVF 257
            Y +    LG +Q S   D  ++G +F
Sbjct: 176 WYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 149 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
           G + S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     + L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-----VKLCDFGVSG 372

Query: 209 QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +  +             + +GT+ YM+     G+  S   D+ +LG        G+ P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 269 GLKAPNNKQKYE 280
             K   N   +E
Sbjct: 424 SEKMAANIAPFE 435

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 93/212 (43%), Gaps = 22/212 (10%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTP----- 115
           YK   KIG+G+ G ++    +     VAIK +    + P+ +       +M G+      
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIK-QMNLEKQPKKELIVNEILVMKGSKHNNIV 756

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175
           N   +Y F   G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+  
Sbjct: 757 NFIDSYLF--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHSKG 812

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235
           +I+RDIK DN L+   G      I L DFG   Q  +   K       R ++ GT  +M+
Sbjct: 813 VIHRDIKSDNILLSMNGD-----IKLTDFGFCAQINEVNLK-------RTTMVGTPYWMA 860

Query: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
                 +E   + D+ +LG +    + G+ P+
Sbjct: 861 PEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 107/238 (44%), Gaps = 35/238 (14%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYR--TYKIM-AGTPN 116
           Y +GK++G G + ++ E  N   G  VA+K F  ++ +  +   ++R  T  +M    PN
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 117 VPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLIE 169
           +            +  +   LV++ +     +LF+   RK  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 170 DLHAHDLIYRDIKPDNFL--IGRPGQP--------DENKI----HLIDFGMAKQYRDPKT 215
            LH  ++I+RDIKP+N L  I R   P        DE++I     + DFG+AK   + + 
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 377

Query: 216 KQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
                     +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 378 TN--------TLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 15/107 (14%)

Query: 161 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP 220
           A ++   +E LH+ D+IYRD+KP+N L+ + G      I L DFG AK   D      + 
Sbjct: 180 AAEVCLALEYLHSKDIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VT 228

Query: 221 YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           Y    +L GT  Y++      +  ++  D  + G + +  L G  P+
Sbjct: 229 Y----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 87/205 (42%), Gaps = 20/205 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVA----IKFEPRKTEAPQLKDEYRTYKIMAGTPN 116
           YK  +K+GEG++GV+++  ++ +   V     I+ E      P       +        N
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 117 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 173
           + + Y       H + LV + L   L+   +   +        + +  +Q+   I   HA
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYCHA 126

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           H +I+RD+KP N LI R G      + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRIIHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 234 MSINTHLGREQ-SRRDDMEALGHVF 257
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDVWSIGCIF 199

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-----KTEAPQLKDEYRTYKIMAGTP 115
           Y I K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 794 YDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 853

Query: 116 NVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 174
            V + +   Q   +  LV++ L G  L  L    G     +   Q   +++  + D+H +
Sbjct: 854 YVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQN 912

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH--IPYRERKSLSGT 230
            +I+ D+KP+N LI   G      + L DFG++   R    ++H  +P++   S+S T
Sbjct: 913 GIIHHDLKPENLLIDNAGH-----VKLTDFGLS---RAGLIRRHKFVPHKSSLSISST 962

>Scas_668.22
          Length = 893

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 94/207 (45%), Gaps = 22/207 (10%)

Query: 66  KIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVPQ---A 120
           KIG+G+ G ++    + +   VAIK +    + P+ +       +M G+  PN+     +
Sbjct: 616 KIGQGASGGVYIANEIGSNESVAIK-QMNLEKQPKKELIINEILVMKGSRHPNIVNFIDS 674

Query: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD 180
           Y    +G   +++  + G SL D+   C    +   +  V  + ++ ++ LH+  +++RD
Sbjct: 675 YLL--DGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLQFLHSKGVLHRD 730

Query: 181 IKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL 240
           IK DN L+   G      I L DFG   Q  +   K       R ++ GT  +M+     
Sbjct: 731 IKSDNILLSISGD-----IKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVS 778

Query: 241 GREQSRRDDMEALGHVFFYFLRGQLPW 267
            +E   + D+ +LG +    + G+ P+
Sbjct: 779 RKEYGPKVDIWSLGIMIIEMIEGEPPY 805

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 66  KIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT-----PNVPQA 120
           KIG+G+ G ++    +     VAIK +    + P+ +       +M G+      N   +
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIK-QMNLEKQPKKELIINEILVMKGSRHNNIVNFIDS 746

Query: 121 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD 180
           Y    +G   +++  + G SL D+   C    +   +  V+ + +  +  LH+  +I+RD
Sbjct: 747 YLL--KGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIAAVSRETLRGLHFLHSKGVIHRD 802

Query: 181 IKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL 240
           IK DN L+   G      I L DFG   Q  +   K       R ++ GT  +M+     
Sbjct: 803 IKSDNILLSMDGN-----IKLTDFGFCAQINETNLK-------RTTMVGTPYWMAPEVVS 850

Query: 241 GREQSRRDDMEALGHVFFYFLRGQLPW 267
            +E   + D+ +LG +    + G+ P+
Sbjct: 851 RKEYGPKVDIWSLGIMIIEMIEGEPPY 877

>Scas_698.37
          Length = 347

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 75/157 (47%), Gaps = 20/157 (12%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIK-FEPRKTEAPQLKDEYRTYKI---MAGTPN 116
           Y+I  KIG G +  +F G +++N +   IK  +P K     L+  +R  KI   + G PN
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVK-----LRKIHRELKILWNLTGGPN 112

Query: 117 VPQ---AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 173
           + +     +  +  +   +  D+      +L+      F +  V     Q++  +   H+
Sbjct: 113 IVELLDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAHS 168

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
             +++RD+KP N +I     P + K+ LID+G+A+ Y
Sbjct: 169 MGIMHRDVKPQNVMI----DPVQRKLRLIDWGLAEFY 201

>Scas_683.12
          Length = 356

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 101/225 (44%), Gaps = 35/225 (15%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIKFEPR-KTEAPQLKDEYRTYKIMAGT-PNVPQAYYFG 124
           I  G+F  +++  +      VA+K  P+ K  +  + +E+   KI+  + PN+     F 
Sbjct: 9   IQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSGGMANEFEIMKILGRSHPNICSMLDFY 68

Query: 125 QEGLHNILVIDLLGPSLEDLFDWC------GRKFSVKTV----VQVAVQMITLIEDLHAH 174
           Q+  + +LV++       DL+D+       G +    T+     +V  Q+ + I   H+ 
Sbjct: 69  QDTNYYVLVLEYC--EYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSL 126

Query: 175 DLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQ-HI---PYRERKSLSGT 230
            + +RDIKP+N L+ + G      I L D+G A   RD  +K+ HI    YR  ++   T
Sbjct: 127 GIAHRDIKPENILLTKEGD-----IKLADWGHA--IRDSFSKESHIGTDNYRAPETFDCT 179

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 275
             Y           + + D  +LG    Y + GQ P++ L   ++
Sbjct: 180 IEY----------DTFKIDYWSLGVTSLYLIFGQAPFKNLTLSSD 214

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 117/277 (42%), Gaps = 67/277 (24%)

Query: 38  GTPSNRSSSNMTSRDDSTIVGLHYKIGKKIGEGSFG-VLFEGTNMINGMPVAIKFEPRKT 96
           G   N+ S+ +++ DD     +     K +G GS G V++EG           KF+ R  
Sbjct: 578 GGKKNKKSAFISNNDDELSNRVLQVSDKVLGYGSSGTVVYEG-----------KFQERSV 626

Query: 97  EAPQLKDEY-----RTYKIMAGT---PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 148
              ++  ++     +  ++++ +   PNV + Y   +      + ++L   +LE L +  
Sbjct: 627 AVKRMLVDFYDIASKEIELLSESDEHPNVVRYYCSEETSKFLYIALELCDSNLEQLIETN 686

Query: 149 G-----RKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIG----RPGQP----- 194
                 ++     +V +  Q+   I  LH+ ++I+RDIKP N LI     R  +P     
Sbjct: 687 NVMRHEQRLKDYELVDILAQITQGIAYLHSLNIIHRDIKPQNILISKSKKRLQKPTTGNG 746

Query: 195 -DENKIHLIDFGMAKQ--YRDPKTKQHIPYRERKSLSGTARYMS---------------- 235
            ++ +I L DFG+ K+  +     K +I     K+ +GT  +M+                
Sbjct: 747 NNKTRIMLSDFGLCKKLDFEQSSFKTNI-----KNAAGTVGWMAPELLIEDENSNKISVS 801

Query: 236 ---------INTHLGREQSRRDDMEALGHVFFYFLRG 263
                     + +L R  ++  D+ +LG VF+Y L G
Sbjct: 802 QEIEKIDEVYDPYLRRRLTKAIDIFSLGCVFYYVLSG 838

>Scas_675.2
          Length = 527

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 93/217 (42%), Gaps = 22/217 (10%)

Query: 63  IGKKIGEGSFGVLFEGTNMIN-GMPVAIKFEPRKT------EAPQLKDEYRTYKIMAGTP 115
           +G  IG+GSFG +      ++  + +A+K+    T          +  E   +   +  P
Sbjct: 17  LGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIPTCKKNGLTEKDISREVLLHSRCSKNP 76

Query: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT-VVQVAVQ-MITLIEDLHA 173
           NV +         +  +++++      DLFD       V + V Q   Q ++  I  LH 
Sbjct: 77  NVLRLIDCNIAKDYMWMIMEMADGG--DLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHE 134

Query: 174 HD-LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
              + +RDIKP+N L+ + G      + L DFG++ QYR       I   +R    G+  
Sbjct: 135 ECGVAHRDIKPENILLDKNGN-----LKLADFGLSSQYRRKDGTLRISTDQR----GSPP 185

Query: 233 YMSINTHLGR-EQSRRDDMEALGHVFFYFLRGQLPWQ 268
           YM+      R   +   D+ ++G + F  L G+ PW+
Sbjct: 186 YMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 99/225 (44%), Gaps = 49/225 (21%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIK-------------FEPRKTEAPQLKDEYR 106
           +Y+I K++GEGSFG ++  T+ +    V +K             F  R+ E P +    +
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFIT---K 92

Query: 107 TYKIMAGTPNVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 164
            Y+++     V  A  Y  G E L++ L++    P      D   R F+         Q+
Sbjct: 93  LYEVIVTETRVWMALEYCPGNE-LYDYLLLKQRIP-----LDETRRLFA---------QI 137

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRER 224
           ++ +   H+   ++RD+K +N L+ + G        L DFG     R+  TK  +     
Sbjct: 138 VSAVFYAHSLQCVHRDLKLENILLDKNGYA-----MLTDFGFT---RECATKTQL----- 184

Query: 225 KSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 267
           +++ GT  YM+    + RE     + D  +LG + +  L G +P+
Sbjct: 185 ETVCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 106/268 (39%), Gaps = 52/268 (19%)

Query: 48  MTSRDDSTIVGL-----HYKIGKKIGEGSFGVLFEGTNMINGMPVAIK---------FEP 93
           + SR++  + G+     +Y+  +K+G+G+FG +F+G ++     VAIK           P
Sbjct: 37  VQSRENEKVYGVTKFLNNYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFP 96

Query: 94  --RKTEAPQLK---------------DEYRTYKIMAGTPNVPQAYYFGQ---------EG 127
              + E   LK               DE  T K  + +P  P   Y G           G
Sbjct: 97  ITAQREITILKRMNHKNIVKLIEIVYDESPTPKTDSTSPR-PVGNYHGNNTANQQKLITG 155

Query: 128 LHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFL 187
            H  +++  +   L  L      +F +  V  + +Q++  I  +H +  ++RDIK  N L
Sbjct: 156 KHFFMILPYMVSDLTGLLHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANIL 215

Query: 188 IGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIP-----YRERKSLSGTARYMSINTHLG- 241
           I   G      + + DFG+A+ Y         P       +  S+  T  Y +    LG 
Sbjct: 216 IDHKGV-----VKIADFGLARNYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGD 270

Query: 242 REQSRRDDMEALGHVFFYFLRGQLPWQG 269
           R  +   D+  +G VF  F   +   QG
Sbjct: 271 RHYTTAVDIWGIGCVFAEFFEKKPILQG 298

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 32/186 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGTPNVPQ 119
           Y I   +G+G+FG + +  NM     VA+K    KTE   Q   E +  +++    +   
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 120 AYYFGQEGLHN--------ILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLI 168
            ++F +  LH+         LV +LL  +L +L      KF   S+  +     Q++  +
Sbjct: 333 QHHFLR--LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSL 388

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKT 215
             L    LI+ D+KP+N L+  P +P+   + +IDFG A +             YR P+ 
Sbjct: 389 CVLKESKLIHCDLKPENVLLVSPDRPE---LKVIDFGSACEEARTVYTYIQSRFYRAPEV 445

Query: 216 KQHIPY 221
              IPY
Sbjct: 446 LMGIPY 451

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD-----EYRTYKIMAGTP 115
           Y   KK GEG++ V++ GT    G  +A+K    + +  Q KD       R  K +    
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 116 NVPQA----YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 171
           +V        +   + L+  LV++ L   LE +       FS   +    +  +  +   
Sbjct: 66  HVNVIELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPK---TKQHIP--YRERKS 226
           H + +++RD+KP+N L+   GQ     + + DFG+A+    P+   T   +   YR  + 
Sbjct: 124 HRNFILHRDLKPNNLLLAPDGQ-----LKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178

Query: 227 LSGTARYMS 235
           L G   Y S
Sbjct: 179 LFGAKHYTS 187

>KLLA0D13266g complement(1137750..1141208) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1 protein kinase
           singleton, hypothetical start
          Length = 1152

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 112/263 (42%), Gaps = 65/263 (24%)

Query: 60  HYKIGKKI-GEGSFG-VLFEGTNMINGMPVAIK-----FEPRKTEAPQLKDEYRTYKIMA 112
           H  I  ++ G GS G V+F+G       PVA+K     F    ++  QL  E   +    
Sbjct: 707 HLSISSRVLGYGSSGTVVFQGK--FQNRPVAVKRLLIDFYDIASKEIQLLSESDDH---- 760

Query: 113 GTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTV--------VQVAVQM 164
             PNV + Y+         + ++L   SLED+ +  G K   K V        + V  Q+
Sbjct: 761 --PNVIRYYFSESTEKFMYIAVELCSASLEDVIE--GSKGLAKNVAVQKNIDPINVLFQI 816

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQ-----PDENKIHLI--DFGMAKQ-------- 209
            + +  LH+  +++RD+KP N LI  P +       +NK  ++  DFG+ K+        
Sbjct: 817 TSGVNHLHSMKIVHRDLKPQNILIAPPKRYLSLHASKNKFRVLISDFGLCKKLEIDESSF 876

Query: 210 -------------YRDPK------TKQHIPYRERKSLSGTARYMSINT-HLG----REQS 245
                        +R P+      +       E  ++S +   +S++  H+     +  +
Sbjct: 877 RTNNFNNPTGTSGWRAPEIISGEVSLSESFASETSTVSNSTETVSLDVNHMDLVTKKRLT 936

Query: 246 RRDDMEALGHVFFYFL-RGQLPW 267
           R  D+ +LG +F+Y L +G+ P+
Sbjct: 937 RAVDIFSLGCIFYYVLSKGEHPF 959

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 149 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
           G + S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     + L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIGQ-----VKLCDFGVSG 349

Query: 209 QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           +  +             + +GT+ YM+     G+  S   D+ +LG       +G  P+
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPF 399

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 110/248 (44%), Gaps = 30/248 (12%)

Query: 39  TPSNRSSSN-MTSRDDSTIVGLH--YKIGKKI-GEGSFGVLFEGTNMINGMPVAIKFEPR 94
           +P++ S S    S   + + G+H  Y I   I G+G+F  + +      G   A+K   +
Sbjct: 166 SPASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHK 225

Query: 95  KTEAPQLKDEYRTYKIMAGT--PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKF 152
           +    +     R   ++     P + +   F ++  +  ++++ +     DL D+     
Sbjct: 226 RKVMDKFDGVKRELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGG--DLMDFVAAHG 283

Query: 153 SVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           +V      ++  Q++  ++ +H   + +RD+KPDN +I    Q D   I + DFG+AK  
Sbjct: 284 TVGEDAGREITRQVLEAVKYMHDQGISHRDLKPDNIMI---EQDDPVLIKITDFGLAK-V 339

Query: 211 RDPKTKQHIPYRERKSLSGTARYMS---INTHLGREQSRRD------DMEALGHVFFYFL 261
           ++  T  +       +  GT  Y++   I+     +++ RD      DM ++G + +  L
Sbjct: 340 QNQNTFLN-------TFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVIL 392

Query: 262 RGQLPWQG 269
            G LP+ G
Sbjct: 393 TGHLPFSG 400

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 112/263 (42%), Gaps = 58/263 (22%)

Query: 30  MNANAPYNGTPSN--RSSSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING-MP 86
           MN  AP N    +       + ++ + +I G HY++ + +G+GS+G +    + +N   P
Sbjct: 41  MNGIAPMNLIEKSVVHPPRTIYTKANFSIPG-HYEVLQMLGKGSYGTVVSAIDNLNANYP 99

Query: 87  VAIKFEPRKTEAPQ----LKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGP--- 139
           + I  + + T   Q    LK   R  K M         Y+ G + + +++ ++++     
Sbjct: 100 IRIAIK-KITNIFQREVLLKRAIRELKFMH--------YFKGHKNIVSLINLEIVNEKPY 150

Query: 140 ----SLEDLFDW-------CGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI 188
                 ++L D+          +FS   +     Q++  ++ +H+ D+I+RD+KP N L 
Sbjct: 151 DGLYCYQELIDYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILC 210

Query: 189 GRPGQPDENKIHLIDFGMAK----QYRDPKTKQHIP-------YRERKSLSGTARYMSIN 237
              GQ     + + DFG+A+     + + KT  HI        YR  + +    RY    
Sbjct: 211 SISGQ-----LKICDFGLARGISPLFTNTKTSNHITNYVATRWYRAPELILSHKRY---- 261

Query: 238 THLGREQSRRDDMEALGHVFFYF 260
                  ++  DM A+G +   F
Sbjct: 262 -------NKSIDMWAIGCILAEF 277

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 84/196 (42%), Gaps = 47/196 (23%)

Query: 61  YKIGKKIGEGSFGVLF--------------EGTNMINGMPVAIKFE-------------P 93
           YK+ +++G GSFG +               EGT M   +   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 94  RKTEAPQLKDEYRTYKI-----MAGTPNVPQAY-YFGQEGLHNI-LVIDLLGPSLEDLFD 146
             T  P L D  R  +I     +    ++ Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 147 WCGRK-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQ------------ 193
              R+ FS+ T+  +  Q+++ I  +HAH+  +RDIKP+N LI    +            
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 194 PDENKIHLIDFGMAKQ 209
           PD   + + D+G+A+ 
Sbjct: 218 PDNYVVKIADYGLARH 233

>Scas_201.1*
          Length = 274

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 63/117 (53%), Gaps = 9/117 (7%)

Query: 151 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           KF+    V + VQ++  ++ +H+ ++++RD+KP+N L   P   DE+++ + DFG+AK+ 
Sbjct: 130 KFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLVIADFGIAKEL 187

Query: 211 RDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
              K+   + ++     +G+  Y++          +  D+ +LG + +  L G  P+
Sbjct: 188 ---KSNDDLIFKG----AGSLGYVAPEVLTKEGHGKPCDIWSLGVITYTLLSGYSPF 237

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 109/244 (44%), Gaps = 53/244 (21%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIK-------------FEPRKTEAPQLKDEYR 106
           +YKI K IGEGSFG ++   + +    V +K             F  R+ + P +    +
Sbjct: 36  NYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPNVVREVFYHRQFDFPHIT---K 92

Query: 107 TYKIMAGTPNVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 164
            Y+++     V  A  Y  G+E    +L+   +  SLE+     G+ F+         Q+
Sbjct: 93  LYEVIVTESKVWMALEYCPGKELYEYLLMQHRI--SLEE----SGKLFA---------QI 137

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRER 224
           ++ +   H+   ++RD+K +N L+ + G     +  + DFG     R+  TK  +     
Sbjct: 138 VSAVYYAHSLQCVHRDLKLENILLDKKG-----RAKITDFGFT---RECATKTML----- 184

Query: 225 KSLSGTARYMSINTHLGREQSR---RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 281
           +++ GT  YM+    L   +S    + D+ +LG + +  + G +P+   +    K K++ 
Sbjct: 185 ETVCGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFD--EEDETKTKWKI 240

Query: 282 IGEK 285
           I E+
Sbjct: 241 INEE 244

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 18/162 (11%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD--------EYRTYKIM 111
            Y   KK+GEG++ V++ GT    G  +A+K    + +  + KD        E +  + M
Sbjct: 5   EYTKEKKVGEGTYAVVYVGTKQSTGRRIAVK----EIKTSEFKDGLDMSAIREVKYLQEM 60

Query: 112 AGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 171
                +     F   G  N LV++ L   LE +       F+   +    +  +  +   
Sbjct: 61  QHVNVIELVDIFMSYGNLN-LVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHC 119

Query: 172 HAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
           H + +++RD+KP+N LI   GQ     I + DFG+A+    P
Sbjct: 120 HRNFILHRDLKPNNLLIAPDGQ-----IKVADFGLARAVPSP 156

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 96/231 (41%), Gaps = 30/231 (12%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIM--AGTPNVPQAYYFG 124
           +G+G+F  + +      G   A+K   ++     +    R  +++     P +     F 
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIVSLKGFY 282

Query: 125 QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 182
           ++     L+++ +     DL D+     SV      ++  Q++  +  +H   + +RD+K
Sbjct: 283 EDDESYYLLMEFVSGG--DLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLK 340

Query: 183 PDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGR 242
           PDN LI    Q D   + + DFG+AK  +D  T         K+  GT  Y++     G+
Sbjct: 341 PDNILI---EQDDPVLVKITDFGLAK-IQDNTTFM-------KTFCGTLAYVAPEVIGGK 389

Query: 243 E----------QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283
                       S   DM ++G + +  L G LP+ G      +Q Y++I 
Sbjct: 390 NPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSG---STQEQLYKQIA 437

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 72/160 (45%), Gaps = 19/160 (11%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIK---------FEPRKTEAPQLKDEYRTYKI 110
           HYK+   IGEG++G++    +   G  VAIK         F  R     +L   + +++ 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 111 MAGTPNV--PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 168
           +    ++  P +Y   Q+     LV +L+   L+ +        S   +     Q++  +
Sbjct: 72  IISVLDIVRPTSY---QDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRAL 128

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
           + LH+  +I+RD+KP N L+          + L DFG+++
Sbjct: 129 KSLHSAQVIHRDLKPSNLLLNSSCD-----LKLCDFGLSR 163

>Scas_655.2
          Length = 800

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 143 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHL 201
           DLF      K S + +     Q++T ++ LH+  L +RD+K DN +I   G      + L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 582

Query: 202 IDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 260
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 261 LRGQLPWQGLKAPNNKQK 278
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 12/120 (10%)

Query: 152 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI----GRPGQPDENKIHLIDFGMA 207
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R       K  + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 208 KQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           + Y           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 98/237 (41%), Gaps = 31/237 (13%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPR-KTEAPQLKDEYRTYKIMA---GTPN 116
           YK    I  GSF  +++G N      VA+K  P+ K     + +EY   K+++   G P 
Sbjct: 8   YKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPF 67

Query: 117 VPQAYYFGQEGLHNILVIDLLGP-SLEDLFDWCGRK--FSVKTVVQVAVQMITL-----I 168
           +     F ++  +  LV +        D  +   +K   +  +++++  Q + L     I
Sbjct: 68  ICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAI 127

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHI---PYRERK 225
           +  H+  + +RDIKP+N LI   G      I L D+G A          +I    YR  +
Sbjct: 128 KYAHSMGIAHRDIKPENILINYHGD-----IKLADWGHAIS-ASSSNDNNIGTDNYRGPE 181

Query: 226 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 282
           + S    Y   NT+       R D  ++G    Y L    P++     N K  Y+++
Sbjct: 182 TFSAKVSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 95/217 (43%), Gaps = 19/217 (8%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTPNVPQA 120
           +K  + IG G FGV+++  +       A+K         +++D  +  + +A    VP  
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNI 84

Query: 121 YYFGQEGLHN----ILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 176
             +    L++    +++    G SL  L      K   K +  +  +++  +  +H  ++
Sbjct: 85  TRYYGSYLYDTKLWVIMEYCAGGSLRTLLR--PGKIDEKYLGVIVRKLLIALVYIHKDNV 142

Query: 177 IYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSI 236
           I+RDIK  N LI      +E  + L DFG+A Q      K       R++++GT  +M+ 
Sbjct: 143 IHRDIKAANVLIT-----NEGHVKLCDFGVAAQLTAANHK-------RQTMAGTPYWMAP 190

Query: 237 NTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 272
              + G   + + D+ +LG   +    G  P+  ++A
Sbjct: 191 EVIMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEA 227

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 128/329 (38%), Gaps = 88/329 (26%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKF---------------EPRKTEAPQLKDEY 105
           Y+I K++G G  G +  G +++    VAIK                +P KTE  ++K E 
Sbjct: 141 YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFFSFKKPGKTENDKIKREI 200

Query: 106 RTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--------------- 150
              K         + ++     L  +L  DL    +  + ++C R               
Sbjct: 201 AIMK---------KCHHKHVVKLIEVL-DDLKSRKIYLVLEYCSRGEVKWCPPDCLETEA 250

Query: 151 ----KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGM 206
                 S +   ++   ++  +E LH   +I+RDIKP N L+   G      + + DFG+
Sbjct: 251 KGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGI-----VKISDFGV 305

Query: 207 ---AKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLG----------REQ-------SR 246
              A       + + I   E    +GT  + +    LG          RE+       S 
Sbjct: 306 SLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCISF 365

Query: 247 RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSNGYPVQFGRYL 306
           + D+ ALG   +  + G LP+    +    + +EKI        V D     PV+F +Y 
Sbjct: 366 KIDIWALGVTLYCLVFGMLPFV---SSFELELFEKI--------VND-----PVKFPKYS 409

Query: 307 EIVRS---LSFEETPDYQGYRKLLLSVLD 332
           +++++   L   E  +Y+  + LL  +L+
Sbjct: 410 DMLKNNQVLQMTEEAEYEAAKDLLTRLLE 438

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 15/119 (12%)

Query: 152 FSVKTVVQVAVQMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQY 210
           F+  T+ ++A  ++  ++ L+  + +I+RDIKP N LI   GQ     I L DFG++K+ 
Sbjct: 302 FNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQ-----IKLCDFGVSKKL 356

Query: 211 RDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 269
            +      +         GT+ YMS     G   S + D+ +LG +    + G+ P  G
Sbjct: 357 INSIADTFV---------GTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGG 406

>Scas_627.7
          Length = 349

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 17/113 (15%)

Query: 160 VAVQMITLIED----LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKT 215
           +A + +  I D    LH   +I+RD+KP+N LIG       N I L DFG +    +P+ 
Sbjct: 190 IASRFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWS--IINPRG 242

Query: 216 KQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
            +      RK+L GT  Y+S      RE   + D+ ALG + +  + G  P++
Sbjct: 243 VK------RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (43%), Gaps = 26/189 (13%)

Query: 115 PNVPQAYY-FGQEGLHNILVIDLLGPSLEDLFDW-----CGRKFSVKTVVQVAVQMITLI 168
           PN+ + Y+ F     H  +  DL+     DLF +     C    S    + +  Q++  +
Sbjct: 221 PNIIKVYHTFCDRNNHLYIFQDLIPGG--DLFSYLAKGDCLTSMSETESLLIVFQILQAL 278

Query: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH---------- 218
             LH  D+++RD+K DN L+  P +P   +I L DFG+AK     K + H          
Sbjct: 279 NYLHDQDIVHRDLKLDNILLCTP-EP-CTRIVLADFGIAKDLNSNKERMHTVVGTPEYCA 336

Query: 219 --IPYRE-RKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 275
             + +R  RK+    +R  ++     R    + D+ +LG +    L G  P+ G  +  +
Sbjct: 337 PEVGFRANRKAYQSFSRAATLEQ---RGYDSKCDLWSLGVITHIMLTGISPFYGDGSERS 393

Query: 276 KQKYEKIGE 284
             +  KIG+
Sbjct: 394 IIQNAKIGK 402

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 89/181 (49%), Gaps = 29/181 (16%)

Query: 115 PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAVQMITLIEDLH 172
           PNV + Y       H  +  + +  S   L D+  +  S+K     +V+  +++ ++ LH
Sbjct: 151 PNVCKLYEMQTLSNHYYMFFEFI--SGGQLLDYIIQHGSLKENHARKVSRGILSALQYLH 208

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
           A+++++RD+K +N ++ + G+     I LIDFG++  Y DP+       +  ++  G+  
Sbjct: 209 ANNIVHRDLKIENIMLSKTGE-----IKLIDFGLSNMY-DPR-------KSLQTFCGSLY 255

Query: 233 Y-----MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR 287
           +     +  + +LG E     D+ + G V +  + G++P+      N+   +EKI + K 
Sbjct: 256 FAAPELLKAHPYLGPEV----DVWSFGVVLYVLVCGKVPFDD---ENSSALHEKIKKGKV 308

Query: 288 T 288
           T
Sbjct: 309 T 309

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 143 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHL 201
           DLF      K S + +     Q++T ++ LH+  L +RD+K DN +I   G      + L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 577

Query: 202 IDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 260
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 261 LRGQLPWQGLKAPNNKQK 278
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 96/235 (40%), Gaps = 41/235 (17%)

Query: 64  GKKIGEGSFGVLFEGTNMINGMPVAIK--------------------FEPRKTEAPQ--- 100
           G +IG GSFG ++ G N   G  +A+K                     E    +AP    
Sbjct: 392 GARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNL 451

Query: 101 -------LKDEYRTYKIMAGTPNVPQAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRKF 152
                  L+ E    K +    N+   Y   QEG + NI +  + G S+  +    G  F
Sbjct: 452 HRKMIDALQHEMSLLKELQH-ENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYG-PF 509

Query: 153 SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRD 212
               +V    Q++  +  LH  ++I+RDIK  N LI   G      + + DFG++K+   
Sbjct: 510 EEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGC-----VKITDFGISKKL-S 563

Query: 213 PKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           P  +++    +R SL G+  +MS         + + D+ + G V      G+ P+
Sbjct: 564 PLNQEN--QDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPY 616

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 16/215 (7%)

Query: 62  KIGKKIGEGSFGVLFEGTNMIN-GMPVAIKF---EPRKTEAPQLKDEYRTYKIMAGTPNV 117
           ++G+ IG+GSF  +   +  ++    +A+KF      + +    +D  R  K+ +   N 
Sbjct: 16  QLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVKLHSRCSNF 75

Query: 118 PQAYYFGQEGLHN-ILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLIEDLH-A 173
                     L +  L I +      DLFD       V + V      Q+I  I  LH  
Sbjct: 76  VNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDT 135

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
             + +RDIKP+N L+ + G      + L DFG+A  ++     + I   +R SL   A  
Sbjct: 136 CGVAHRDIKPENILLDKDGN-----LKLADFGLASLFKRKDGSKRISRDQRGSLPYMAPE 190

Query: 234 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +    +     +   D+ ++G + F  L G+ PW+
Sbjct: 191 I---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 138 GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN 197
           G SL D+   C    S   +  V  + +  ++ LH+  +++RDIK DN L+   G     
Sbjct: 699 GGSLTDVVTHC--LLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKGN---- 752

Query: 198 KIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 257
            I L DFG   Q  +   K       R ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 753 -IKLTDFGFCAQINENNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 804

Query: 258 FYFLRGQLPW 267
              + G+ P+
Sbjct: 805 IEMIEGEPPY 814

>Kwal_23.3590
          Length = 499

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 103/240 (42%), Gaps = 39/240 (16%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKF-------EPRKTEAPQLKDEYRTYKIMAG 113
           Y  GK++G G + ++ E  +  +G  VA+K        + +KT+  Q ++E +    +  
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTK--QFREETKILMSIQH 243

Query: 114 TPNVPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITL 167
              V     F     +  +   LV++ +     +LFD   RK  ++     A+  Q++  
Sbjct: 244 KNIVKLIDRFVEPVSKAQIQTFLVLEKVSDG--ELFDRIVRKTRLREDETNAIFKQILNG 301

Query: 168 IEDLHAHDLIYRDIKPDNFL--IGRPGQPDENK------------IHLIDFGMAKQYRDP 213
           +  LHA ++I+RDIKP+N L  I +    DE +            I + DFG+AK   + 
Sbjct: 302 LRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIGEM 361

Query: 214 KTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 273
           +           +L GT  Y++         + R DM + G + +  L G  P+    AP
Sbjct: 362 QFTN--------TLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAP 413

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
           +V+   Q +  + D H   +I+RDIK DN L+   G     ++ + DFG   +  D ++K
Sbjct: 624 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTHG-----RVKITDFGFCAKLTDKRSK 675

Query: 217 QHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
                  R ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 676 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 149 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
           G + S + + ++A  ++  +  LH   +I+RDIKP N L+   G+     I L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGE-----IKLCDFGVSG 365

Query: 209 QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +  +             + +GT+ YM+     G+  S   D+ +LG        G+ P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 269 GLKAPNN 275
             K   N
Sbjct: 417 SDKITQN 423

>Scas_593.14d
          Length = 495

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 115/261 (44%), Gaps = 39/261 (14%)

Query: 67  IGEGSFGVLF----EGTNMINGMPVAIKFEPRKTEAPQLKDE---------YRTY---KI 110
           +G+G++G +     + TN +  M    K E   TE+P+  +E          RT+    I
Sbjct: 142 LGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKRIERTFAEKSI 201

Query: 111 MAGT--PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR-KFSVKTVVQVAVQMITL 167
           +A    PN+ + +Y   +     L++  + P  E  F    +      TV   A ++   
Sbjct: 202 LAELEHPNIVKLFYSFHDNSKLYLLLQYI-PGGELFFHLKEQGTLDEDTVAFYAAEISCA 260

Query: 168 IEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-----YRDPK--TKQHIP 220
           ++ LH   ++YRD+KP+N L+      D+  + L DFG++K+       +P   T  + P
Sbjct: 261 LKFLHDKGIVYRDLKPENCLLN-----DKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEP 315

Query: 221 YRERKSLS---GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 277
             +  +L    GT  Y +     G   ++  D  +LG + +  L G+ P+ G    N+K 
Sbjct: 316 SEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTG---ANHKV 372

Query: 278 KYEKIGEKKRTTNV-YDLSNG 297
              KI + K+   + Y LS G
Sbjct: 373 ILNKIQKDKQGPKIPYYLSEG 393

>YPL031C (PHO85) [5407] chr16
           complement(492014..492914,493017..493033)
           Cyclin-dependent protein kinase that interacts with
           cyclin Pho80p to regulate phosphate pathway and with
           cyclin Pcl5p to regulate Gcn4p stability, also interacts
           with other Pho80p-like cyclins [918 bp, 305 aa]
          Length = 305

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 20/212 (9%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGT--PNVP 118
           +K  +K+G G++  +++G N   G+ VA+K     +E        R   +M      N+ 
Sbjct: 7   FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIV 66

Query: 119 QAYYFGQEGLHNILVIDLLGPSLEDLFDW-----CGRKFSVKTVVQVAVQMITLIEDLHA 173
           + Y          LV + +   L+   D        R   +  V     Q++  +   H 
Sbjct: 67  RLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHE 126

Query: 174 HDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARY 233
           + +++RD+KP N LI + GQ     + L DFG+A+ +        IP     S   T  Y
Sbjct: 127 NKILHRDLKPQNLLINKRGQ-----LKLGDFGLARAF-------GIPVNTFSSEVVTLWY 174

Query: 234 MSINTHLG-REQSRRDDMEALGHVFFYFLRGQ 264
            + +  +G R  S   D+ + G +    + G+
Sbjct: 175 RAPDVLMGSRTYSTSIDIWSCGCILAEMITGK 206

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 163 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYR 222
           QM   +  +H  ++++RDIKP+N LIG      +N + L DFG +               
Sbjct: 246 QMADALNYMHDRNVLHRDIKPENILIG-----FQNTLKLTDFGWSVISTTGA-------- 292

Query: 223 ERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 268
           +RK+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 293 KRKTLCGTLDYLSPELVKYREYDEKVDVWALGVLAYELLVGTPPFE 338

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIK--FEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYY 122
           +G G+FG++   T+ +   PVAIK   +P  T A   K  YR  K++      N+     
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 123 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 181
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 182 KPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYR 222
           KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 146 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>Kwal_23.5290
          Length = 819

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
           +V+   Q +  + D H   +I+RDIK DN L+      +  ++ + DFG   +  D ++K
Sbjct: 650 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----NRARVKITDFGFCAKLTDKRSK 701

Query: 217 QHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
                  R ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 702 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 99/240 (41%), Gaps = 46/240 (19%)

Query: 64  GKKIGEGSFGVLFEGTNMINGMPVAIKF-----------------EPRKTEAP-----QL 101
           G +IG GSFG ++ G N   G  +A+K                  E +K  +P      +
Sbjct: 442 GARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTAV 501

Query: 102 KDEYRTYKIMAGT-------------PNVPQAYYFGQEGLH-NILVIDLLGPSLEDLFDW 147
           K+  + ++ M                 N+   Y   QEG + NI +  + G S+  + + 
Sbjct: 502 KNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNN 561

Query: 148 CGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMA 207
            G  F    V     Q++  +  LH  ++I+RDIK  N LI   G      + + DFG++
Sbjct: 562 YG-PFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKG-----GVKITDFGIS 615

Query: 208 KQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           K+   P  KQ     +R SL G+  +M+         + + D+ ++G V      G+ P+
Sbjct: 616 KKL-SPLNKQQ---NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTGKHPF 671

>Scas_700.34
          Length = 864

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 98/230 (42%), Gaps = 41/230 (17%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMP-----------VAIKFEPRKTEAPQLKDEYRTYK 109
           Y IG  +GEG FG +  G    N +P           VAIK   R T +     E + Y+
Sbjct: 48  YIIGSTLGEGEFGKVKLGWPK-NSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYR 106

Query: 110 IMAGT-----PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAV 162
            +        PN+ +     Q   +  +V++    S  + + +  RK  +K     ++  
Sbjct: 107 EINALKHLTHPNIVKLEEVLQNSKYIGIVLEYA--SGGEFYKYIQRKKRLKEGPACRLFA 164

Query: 163 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYR 222
           Q+I  +  +H+  L++RD+K +N L+ +     EN I + DFG   ++          Y 
Sbjct: 165 QLINGVHYIHSKGLVHRDLKLENLLLDK----HENLI-ITDFGFVSEF----------YS 209

Query: 223 E---RKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 267
                K+  G+  Y +    +  +  ++++ D+ + G + +  L G LPW
Sbjct: 210 HGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPW 259

>AEL120W [2386] [Homologous to ScYKL171W - SH]
           complement(396394..398715) [2322 bp, 773 aa]
          Length = 773

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 154 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
            K  + +A+Q+I+ ++ +H+  +++ D+K +N L+ + G     K++L DFGM+ QY  P
Sbjct: 477 CKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGS-QSWKLYLCDFGMSCQYGKP 535

Query: 214 K 214
           +
Sbjct: 536 R 536

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 100/239 (41%), Gaps = 23/239 (9%)

Query: 60  HYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTP--NV 117
            +K  +K+G G++  +++G N   G+ VA+K     +E        R   +M      N+
Sbjct: 5   QFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 64

Query: 118 PQAYYFGQEGLHNILVIDLLGPSLEDLFDW-----CGRKFSVKTVVQVAVQMITLIEDLH 172
            + Y          LV + +   L+   D        R   +  V     Q++  +   H
Sbjct: 65  VRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFCH 124

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTAR 232
            + +++RD+KP N LI + GQ     + L DFG+A+ +        IP     S   T  
Sbjct: 125 ENKILHRDLKPQNLLITKRGQ-----LKLGDFGLARAF-------GIPVNTFSSEVVTLW 172

Query: 233 YMSINTHLG-REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 290
           Y + +  +G R  S   D+ + G +    + G+  + G    N++++ + I +K  T N
Sbjct: 173 YRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPG---TNDEEQLKLIFDKMGTPN 228

>Scas_613.13*
          Length = 312

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (44%), Gaps = 20/175 (11%)

Query: 48  MTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD---- 103
           M++   + I    Y  GKK+GEG++ V++ GT    G  +A+K    + +  + KD    
Sbjct: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVK----EIKTSEFKDGLDM 56

Query: 104 -EYRTYKIMAGTP--NVPQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV 158
              R  K +      NV +    +   + L+  LV++ L   LE +       F+   + 
Sbjct: 57  SAIREVKYLQEIQHDNVIELVDIFMAYDNLN--LVLEFLPSDLEVIIKDRSILFTPADIK 114

Query: 159 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
              +  +  +   H + +++RD+KP+N L+   G      I + DFG+A+    P
Sbjct: 115 SWMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGV-----IKVADFGLARAVPSP 164

>Kwal_55.22001
          Length = 363

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 106/252 (42%), Gaps = 55/252 (21%)

Query: 45  SSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEG-----TNMINGMPVAIKFEPRKTEAP 99
           ++++TS   S+   +  K  KKIG G+FG + +       N   G P AIK  P +TE  
Sbjct: 10  ANDVTSNRSSSTRPMLVKEYKKIGHGAFGTVVQAFLTPDNNKWYG-PFAIKKVPAQTEYK 68

Query: 100 QLKDEYRTYKIMAGTPNVPQAYYFGQEG------LHNILVIDLLGPSLE-DLFDWCGRKF 152
             + E      +A  PNV +  YF          L+  L ++ L  +L+ ++  +   K 
Sbjct: 69  SRELEILR---IADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKL 125

Query: 153 SVKT------VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGM 206
            +          Q+A  M+ L    HA  + +RDIKP N L+     P+   + + DFG 
Sbjct: 126 ELPLKHTKLYTYQIARGMLYL----HALGICHRDIKPSNVLV----DPNTGVLKICDFGS 177

Query: 207 AKQYRDPKTKQHIP---------YRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 257
           AK     K +Q+ P         YR  + + G  +Y +           + D+  LG V 
Sbjct: 178 AK-----KLEQNQPSISYICSRFYRAPELIVGCTQYTT-----------QIDIWGLGCVM 221

Query: 258 FYFLRGQLPWQG 269
              L G+  +QG
Sbjct: 222 GEMLIGKAVFQG 233

>Kwal_14.2497
          Length = 418

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 14/124 (11%)

Query: 163 QMITLIEDLHAHD-LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
           Q+I  I+ LH    + +RDIKP+N L+   G      + L DFG+A Q++     + I  
Sbjct: 30  QLINAIDHLHNRCGVAHRDIKPENLLLDERGN-----LKLADFGLASQFKRKDGSKRIMS 84

Query: 222 RERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 280
             R SL     YM+      +   +   D+ + G + F  L G+ PW    +P++  +++
Sbjct: 85  DTRGSLP----YMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWD---SPSDDSRFD 137

Query: 281 KIGE 284
              E
Sbjct: 138 DFLE 141

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGTPNVPQ 119
           Y +   +G+G+FG + +  N+I    +A+K    K+E   Q   E +  +++    +   
Sbjct: 332 YLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNN 391

Query: 120 AYYFGQ------EGLHNILVIDLLGPSLEDLF---DWCGRKFSVKTVVQVAVQMITLIED 170
            ++F +         H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  
Sbjct: 392 EHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCV 449

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKTKQ 217
           L    LI+ D+KP+N L+    +PD   + +IDFG A +             YR P+   
Sbjct: 450 LKDSKLIHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLL 506

Query: 218 HIPY 221
            IPY
Sbjct: 507 GIPY 510

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 14/94 (14%)

Query: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235
           +I+RDIKP N LI   G     +I L DFG++++  +      +         GT+ YMS
Sbjct: 250 IIHRDIKPSNVLINSKG-----RIKLCDFGVSRKLNNSIADTFV---------GTSTYMS 295

Query: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 269
                G + + + D+ +LG +    L G+ P  G
Sbjct: 296 PERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGG 329

>Scas_705.23
          Length = 553

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 71/183 (38%), Gaps = 41/183 (22%)

Query: 163 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMA--------------- 207
           +M   +  LH     +RD+KP+NFLI   G      I L DFG+A               
Sbjct: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGH-----IKLTDFGLAAGTISTERIQSMKIR 318

Query: 208 ----KQYRDPK-TKQHIPYRER-------------KSLSGTARYMSINTHLGREQSRRDD 249
               K    P  T++ I  R +              S+ G+  YM++    G++     D
Sbjct: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378

Query: 250 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSNGYPVQFGRYLEIV 309
             +LG + F  L G  P+ G    +  + YE +   K+T     L NG P    R  +I+
Sbjct: 379 YWSLGCMLFESLVGYTPFSG---SSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435

Query: 310 RSL 312
             L
Sbjct: 436 TRL 438

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 15/114 (13%)

Query: 154 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
           +  +V+   Q +  + D H   +I+RDIK DN L+         ++ + DFG   +  D 
Sbjct: 670 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----TRARVKITDFGFCARLTDK 721

Query: 214 KTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           ++K       R ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 722 RSK-------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>Scas_640.14*
          Length = 728

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 32/225 (14%)

Query: 61  YKIGKKIGEGSFGVL---------FEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIM 111
           Y +G  +GEG FG +           G    +   VAIK   R       + E + ++ +
Sbjct: 38  YIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREI 97

Query: 112 AGT-----PNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVK--TVVQVAVQM 164
                   PN+ +     Q   +  +V++    S  + + +  RK  +K  T  ++  Q+
Sbjct: 98  NSLKHLTHPNIVRLEEVLQNSKYIGIVLEY--ASGGEFYKYVQRKRRLKEATACRLFAQL 155

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRER 224
           I+ +  +H+  +++RD+K +N L+ +     EN I + DFG   ++       +      
Sbjct: 156 ISGVSYMHSKGIVHRDLKLENLLLDK----HENLI-ITDFGFVNEF-------YADNELM 203

Query: 225 KSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 267
           K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW
Sbjct: 204 KTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPW 248

>Scas_651.3
          Length = 793

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 79/182 (43%), Gaps = 24/182 (13%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTE-APQLKDEYRTYKIMAGTPNVPQ 119
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E +  +++    +   
Sbjct: 380 YLVLDILGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQSITEAKILELINNKIDPEN 439

Query: 120 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCG-RKFSVKTVVQVAVQMITLIEDLH 172
            ++F +         H  LV +LL  +L +L         S++ +     QM+  +  L 
Sbjct: 440 KHHFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLK 499

Query: 173 AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQ-------------YRDPKTKQHI 219
              LI+ D+KP+N L+  P +P    + +IDFG + +             YR P+    I
Sbjct: 500 DSKLIHCDLKPENILLCSPDKP---ALKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGI 556

Query: 220 PY 221
           PY
Sbjct: 557 PY 558

>Scas_667.18
          Length = 437

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 38/170 (22%)

Query: 61  YKIGKKIGEGSFGVL---FEGTNMINGMPVAIKFEPRKTEAPQ----LKDEYRTYKIMAG 113
           YKI K +G+GS+GV+    +  N  N  PVAIK   + T   Q    LK   R  K M  
Sbjct: 78  YKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIK---KVTNIFQKEILLKRAIRELKFMN- 133

Query: 114 TPNVPQAYYFGQEGLHNILVIDLLGP--------SLEDLFDWCGRKF---SVKT----VV 158
                  ++ G + + N++ ++++            ++L D+   K    S+K     + 
Sbjct: 134 -------FFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHSSIKLTEFHIQ 186

Query: 159 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
               Q+++ ++ +H+ D+I+RD+KP N L    G      + + DFG+A+
Sbjct: 187 YFMYQILSGLKYIHSADVIHRDLKPGNILCTLNGN-----LKICDFGLAR 231

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 88/203 (43%), Gaps = 22/203 (10%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIK--FEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYY 122
           +G G+FG++   T+ +   PVAIK   +P  T     K  YR  K++      N+     
Sbjct: 28  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSV-LAKRTYRELKLLKHLRHENLICLED 86

Query: 123 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 181
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 87  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 144

Query: 182 KPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLG 241
           KP N LI      +   + + DFG+A+  +DP+   ++  R  ++      +   N  + 
Sbjct: 145 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 197

Query: 242 REQSRRDDMEALGHVFFYFLRGQ 264
                  D+ + G +F   + G+
Sbjct: 198 -------DIWSAGCIFAEMIEGK 213

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 163 QMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPY 221
           Q++  I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R     + +  
Sbjct: 68  QLLRAIHHLHEVCGIAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTKRLAR 122

Query: 222 RERKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 268
            +R    G+  YM+       E  +   D+ + G + F  L G+ PW+
Sbjct: 123 DQR----GSPPYMAPEIIYSSEYYADTTDIWSCGILVFVLLTGETPWE 166

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 57  VGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD-----EYRTYKIM 111
           V + Y   KK+GEG++ V++ G     G  +AIK    + +  + KD       R  K +
Sbjct: 3   VNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIK----EIKTSEFKDGLDMSAIREVKYL 58

Query: 112 AGT--PNVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITL 167
                PNV +    +   + L+  LV++ L   LE +       F+   +    +  +  
Sbjct: 59  QEMQHPNVIELIDIFMAYDNLN--LVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRG 116

Query: 168 IEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDP 213
           +   H + +++RD+KP+N L    GQ     I + DFG+A+    P
Sbjct: 117 VYHCHRNFILHRDLKPNNLLFSPDGQ-----IKVADFGLARAIPAP 157

>Scas_713.38
          Length = 432

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIK--FEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYY 122
           +G G+FG++   T+ +   PVAIK   +P  T A   K  YR  K++      N+     
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 123 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 181
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSVGVIHRDL 145

Query: 182 KPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYR 222
           KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 146 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 171 LHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGT 230
           LH  ++I+RDIK DN L+       + ++ + DFG   +  D ++K       R ++ GT
Sbjct: 703 LHDKNIIHRDIKSDNVLLD-----TKARVKITDFGFCAKLTDQRSK-------RATMVGT 750

Query: 231 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
             +M+      +E   + D+ +LG +    L G+ P+
Sbjct: 751 PYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPY 787

>Scas_640.16
          Length = 505

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 149 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK 208
           G + S K + +++  ++  +  LH   +I+RDIKP N L    GQ     + L DFG++ 
Sbjct: 307 GGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQ-----VKLCDFGVSG 361

Query: 209 QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
           +  +             + +GT+ YM+     G+  S   D+ +LG       +G+ P+
Sbjct: 362 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTILEVAQGRFPF 411

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 138 GPSLEDLFDWC---GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQP 194
           G SLE ++      G + S K + +++  ++  +  LH   +I+RDIKP N L+   GQ 
Sbjct: 263 GKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQ- 321

Query: 195 DENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALG 254
               + L DFG++ +  +             + +GT+ YM+     G+  S   D+ +LG
Sbjct: 322 ----VKLCDFGVSGEAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTCDVWSLG 368

Query: 255 HVFFYFLRGQLPW 267
                  +G  P+
Sbjct: 369 LTILEVAQGHFPF 381

>Kwal_27.9804
          Length = 473

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 27/175 (15%)

Query: 61  YKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRK---------------TEAPQ-LKDE 104
           YK+  KIGEG+F  +++  ++   +  A      K               T +PQ + +E
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 105 YRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 164
                ++ G+  V           H   VI +L     + F    R   +K + +   ++
Sbjct: 86  LNLLYMLCGSTRVAP---LCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSEL 142

Query: 165 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAK----QYRDPKT 215
           +  +  +H+  +I+RDIKP NFL      P   +  L+DFG+A+      RDP+T
Sbjct: 143 LQALSFVHSKAIIHRDIKPTNFLYS----PQLGRGVLVDFGLAETEVSHARDPET 193

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 20/180 (11%)

Query: 51  RDDSTIVGLHYKIGKKIGEGSFGVLFEG----------TNMINGMPVAIKFEPRKTEAPQ 100
           RDD     L +++GK IG G++G++ E            N        IKF+  ++   Q
Sbjct: 400 RDDKGSFILGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKFKDNRSVKRQ 459

Query: 101 LKDEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDW--CG-RKFSVK 155
           +  E   +  ++    +P   +   + L    + D +  G   + +  W  CG  K S++
Sbjct: 460 VLREISIWSKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSWGECGNSKISLR 519

Query: 156 TVVQ----VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDEN-KIHLIDFGMAKQY 210
              Q    +A+Q+I  ++ +H+  + + DIK +N L+ +  +  ++ K+ L DFGM+  Y
Sbjct: 520 ERCQATSALALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDWKLVLCDFGMSHFY 579

>Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement
          Length = 434

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 22/203 (10%)

Query: 67  IGEGSFGVLFEGTNMINGMPVAIK--FEPRKTEAPQLKDEYRTYKIMAGT--PNVPQAYY 122
           +G G+FG++   T+     PVAIK   +P  T A   K  YR  K++      N+     
Sbjct: 29  VGMGAFGLVCSATDTYTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLED 87

Query: 123 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 181
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 182 KPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLG 241
           KP N LI      +   + + DFG+A+  +DP+   ++  R  ++      +   N  + 
Sbjct: 146 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 198

Query: 242 REQSRRDDMEALGHVFFYFLRGQ 264
                  D+ + G +F   + G+
Sbjct: 199 -------DIWSAGCIFAEMIEGK 214

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 23/157 (14%)

Query: 113 GTPNVPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRK-----FSVKTVVQVAVQMIT 166
           G PNV + +  F  E  +  +  DL+     DLF +  +K      S    + +  Q++ 
Sbjct: 214 GQPNVIKVHDTFVDENDNIYIFEDLVAGG--DLFSYLAKKDCLAPISETEALVIVYQILQ 271

Query: 167 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKS 226
            ++ LH+  +++RD+K DN L+  P +P  ++I L DFG+AK     + + H       +
Sbjct: 272 ALKFLHSKGIVHRDLKLDNILLCTP-EPC-SRIVLADFGIAKDLPSTRVRMH-------T 322

Query: 227 LSGTARYMS------INTHLGREQSRRDDMEALGHVF 257
           + GT  Y +      ++ +  R  SR   ME  G+ F
Sbjct: 323 IVGTPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDF 359

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 157 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTK 216
           +V+   Q +  + D H   +I+RDIK DN L+   G     ++ + DFG   +  D ++K
Sbjct: 710 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTRG-----RVKITDFGFCAKLTDKRSK 761

Query: 217 QHIPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 267
                  R ++ GT  +M+      RE   + D+ +LG +    L  + P+
Sbjct: 762 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPY 805

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,620,560
Number of extensions: 725339
Number of successful extensions: 2154
Number of sequences better than 10.0: 567
Number of HSP's gapped: 1897
Number of HSP's successfully gapped: 582
Length of query: 531
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 425
Effective length of database: 12,926,601
Effective search space: 5493805425
Effective search space used: 5493805425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)