Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06116g29929513790.0
YHR134W (WSS1)2692405668e-72
KLLA0F27863g2431725394e-68
Scas_697.132571375051e-62
Sklu_1881.22562425032e-62
Kwal_33.146052411554552e-55
AFR042C2241274228e-51
Scas_703.858560653.5
Scas_720.49142480645.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06116g
         (295 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces c...   535   0.0  
YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in ...   222   8e-72
KLLA0F27863g complement(2579510..2580241) some similarities with...   212   4e-68
Scas_697.13                                                           199   1e-62
Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement        198   2e-62
Kwal_33.14605                                                         179   2e-55
AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH] (510151..51...   167   8e-51
Scas_703.8                                                             30   3.5  
Scas_720.49                                                            29   5.2  

>CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces
           cerevisiae YHR134w WSS1, start by similarity
          Length = 299

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/295 (90%), Positives = 266/295 (90%)

Query: 1   MQHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMN 60
           MQHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMN
Sbjct: 1   MQHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMN 60

Query: 61  VNHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCI 120
           VNHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCI
Sbjct: 61  VNHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCI 120

Query: 121 QQLGLKDNFMTSGNRLGGRGFRDGPTPRTTNSRGNKIEKIRNKGVRXXXXXXXXXXXXXX 180
           QQLGLKDNFMTSGNRLGGRGFRDGPTPRTTNSRGNKIEKIRNKGVR              
Sbjct: 121 QQLGLKDNFMTSGNRLGGRGFRDGPTPRTTNSRGNKIEKIRNKGVRLGSLSDNLNGSLNT 180

Query: 181 XRMLKPXXXXXXXXXXXXXXDKKWCVETNQEEKIPDDSSLEIIVLDGDEKEDMGSTGDVG 240
            RMLKP              DKKWCVETNQEEKIPDDSSLEIIVLDGDEKEDMGSTGDVG
Sbjct: 181 SRMLKPAQMAAMAATRRAEADKKWCVETNQEEKIPDDSSLEIIVLDGDEKEDMGSTGDVG 240

Query: 241 SFTDKSKKQLEHKQALTIIELNDDQDNNDVRKVDEPFQAKKKSTFEGEDVLLIDL 295
           SFTDKSKKQLEHKQALTIIELNDDQDNNDVRKVDEPFQAKKKSTFEGEDVLLIDL
Sbjct: 241 SFTDKSKKQLEHKQALTIIELNDDQDNNDVRKVDEPFQAKKKSTFEGEDVLLIDL 295

>YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in
           sensitivity to UV irradiation, has low similarity to
           uncharacterized C. albicans Orf6.4302p [810 bp, 269 aa]
          Length = 269

 Score =  222 bits (566), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 153/240 (63%), Gaps = 8/240 (3%)

Query: 2   QHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNV 61
           ++PHI+ +AVLQ KP KEDAL L+K+IA  VS LM+EN FKV  LVEFYPRD+ LLGMNV
Sbjct: 25  KNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNV 84

Query: 62  NHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQ 121
           NHG KIMLRLR   DEF+FLP E ++GTMLHELTHNL GPHD+KFY+KLDEL GRQW I+
Sbjct: 85  NHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIE 144

Query: 122 QLGLKDNFMTSGNRLGGRG-FRDGPTPRTTNSRGNKIEKIRNKGVRXXXXXXXXXXXXXX 180
           Q GL D F+ +G RLGGR   R    P T  S    I + R KGV+              
Sbjct: 145 QRGLYDTFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVK--LGSLHPEGISSI 202

Query: 181 XRMLKPXXXXXXXXXXXXXXDKKWCVET--NQEEKIPDD--SSLEIIVLDGDEKEDMGST 236
            R   P              D +WC ET  N+++ I D+  SSLE+++LD D++   G T
Sbjct: 203 DRGNSP-RELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVILDDDDEVLPGDT 261

>KLLA0F27863g complement(2579510..2580241) some similarities with
           sp|P38838 Saccharomyces cerevisiae YHR134w WSS1
           singleton, hypothetical start
          Length = 243

 Score =  212 bits (539), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 106/172 (61%), Positives = 127/172 (73%), Gaps = 15/172 (8%)

Query: 2   QHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNV 61
           ++PH+ +IAVLQ KPGK DAL +LK +A  VS LM+E +FKV  LVEFYPR+RSLLGMNV
Sbjct: 7   KNPHVGSIAVLQTKPGKNDALNILKRVAHNVSYLMKEERFKVRQLVEFYPRNRSLLGMNV 66

Query: 62  NHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQ 121
           N G KIMLRLRDPLDE++FLP ES++GTMLHELTHNLHGPHD+KFY KLD+LSGRQW I+
Sbjct: 67  NKGMKIMLRLRDPLDEYKFLPIESIMGTMLHELTHNLHGPHDRKFYEKLDQLSGRQWTIE 126

Query: 122 QLGLKDNFMTSGNRLG---------------GRGFRDGPTPRTTNSRGNKIE 158
           Q+GL D+F+ +G RLG               G+G R G T   T  R N  E
Sbjct: 127 QMGLYDSFLGTGKRLGSKPMGSIIIGKTLERGKGRRLGGTTPGTGPRRNARE 178

>Scas_697.13
          Length = 257

 Score =  199 bits (505), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 93/137 (67%), Positives = 111/137 (81%)

Query: 2   QHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNV 61
           ++PHI  +AVLQRKP  E AL++L+DI   VS LM+E KFKV TLVEFYP+D+ LLGMNV
Sbjct: 3   ENPHITKVAVLQRKPNNEYALQILQDITKQVSYLMKEEKFKVQTLVEFYPKDKRLLGMNV 62

Query: 62  NHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQ 121
           N GQKIMLRLR P DEF+FL  E+++GTMLHELTHNL GPHD++FY KLD+LS RQW I+
Sbjct: 63  NAGQKIMLRLRTPGDEFQFLNREAILGTMLHELTHNLFGPHDRRFYEKLDQLSARQWVIE 122

Query: 122 QLGLKDNFMTSGNRLGG 138
           Q GL D F+ SG RLGG
Sbjct: 123 QQGLFDTFLGSGRRLGG 139

>Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement
          Length = 256

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 142/242 (58%), Gaps = 30/242 (12%)

Query: 2   QHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNV 61
           ++PHI  IA LQ KP K+DAL LL+DIA  VS LMRENKFKVG LVEFYPRD+ LLGMNV
Sbjct: 6   KNPHIGRIASLQGKPNKDDALALLEDIAHRVSYLMRENKFKVGELVEFYPRDKRLLGMNV 65

Query: 62  NHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQ 121
           N G KIMLRLR P DE +FL  ES++GTMLHELTHNL GPHD KFY KLD+LSG QW I+
Sbjct: 66  NGGAKIMLRLRHPNDESQFLARESILGTMLHELTHNLFGPHDAKFYRKLDDLSGTQWVIE 125

Query: 122 QLGLKDNFMTSGNRLGGRGFRDGPTPRT----TNSRGNKIEKIRNKGVRXXXXXXXXXXX 177
           Q GL D+F+       GRG R G TPR+    T  R   IE + +               
Sbjct: 126 QRGLFDSFV-------GRGRRLGCTPRSRIPPTERRLGTIEVVSSNNRDKSPKRMAAAAA 178

Query: 178 XXXXRMLKPXXXXXXXXXXXXXXDKKWCVETNQEEKI-PDDSSLEIIVLDGDEKEDMGST 236
               R                  D  WC +  + + + PD + LE I+LD ++K+     
Sbjct: 179 EKRAR------------------DTMWCGDLKRNKHVEPDAAELEYIILDDEDKDQAREN 220

Query: 237 GD 238
           G+
Sbjct: 221 GN 222

>Kwal_33.14605
          Length = 241

 Score =  179 bits (455), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 88/155 (56%), Positives = 111/155 (71%)

Query: 5   HIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNVNHG 64
           HI  +AV+Q+KP ++ AL++LKDIA  VS LMRE KFKVG LVEFYP+++ LLGMNVN G
Sbjct: 8   HIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGMNVNRG 67

Query: 65  QKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQQLG 124
            KIMLRLRDP +E  FL  E+++GTMLHELTHN++GPH+  FY KLDEL+ R W I+Q G
Sbjct: 68  AKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWVIKQQG 127

Query: 125 LKDNFMTSGNRLGGRGFRDGPTPRTTNSRGNKIEK 159
           L D F+  G +LG +     P  R     G+K  K
Sbjct: 128 LFDGFVGRGRKLGVKPKAAIPPQRLGTLSGSKSTK 162

>AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH]
           (510151..510825) [675 bp, 224 aa]
          Length = 224

 Score =  167 bits (422), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%)

Query: 3   HPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNVN 62
           +PHI   AVLQ KPGKE AL++L+DIA  VS LMRE  F+VG L EFYPR+R LLG+NVN
Sbjct: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67

Query: 63  HGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQQ 122
            G +I+LRLR+P DE +FL  E+++  MLHELTHN+ GPHD +F  KLDEL GRQW + Q
Sbjct: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127

Query: 123 LGLKDNF 129
            G+ D+F
Sbjct: 128 RGIVDSF 134

>Scas_703.8
          Length = 585

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 237 GDVGSFTDKSKK-QLEHKQALTIIELNDDQDNNDVRKVDEPFQAKKKSTFEGEDVLLIDL 295
           GD  SF D  KK +L +KQ L +I+  D +D N +     P      + F  +D  L+ L
Sbjct: 65  GDFISFVDLFKKNRLTNKQDLLVIDTGDKRDGNGLSDATSPSGIATTALFNEQDYDLLTL 124

>Scas_720.49
          Length = 1424

 Score = 29.3 bits (64), Expect = 5.2,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 12  LQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNVNH-------- 63
           L+++ G  +ALK LK+  +     +++ K KV  +      D    G++ N         
Sbjct: 382 LKKQEGTPEALKNLKEEQELDQKFIQDTKLKVNQVA----MDAIHSGIDHNKDNCWFQYL 437

Query: 64  GQKIMLRLRDPLDEFRFLPW 83
           GQ ++ R+ D LDE  FLP+
Sbjct: 438 GQHMVSRMEDVLDESLFLPY 457

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,533,893
Number of extensions: 417753
Number of successful extensions: 1455
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1453
Number of HSP's successfully gapped: 36
Length of query: 295
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 194
Effective length of database: 13,099,691
Effective search space: 2541340054
Effective search space used: 2541340054
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)