Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G06094g1381366305e-86
YHR132W-A1311263806e-48
Sklu_1881.41301313346e-41
Kwal_33.146121291323242e-39
Scas_697.151421013182e-38
AFR044C1261292963e-35
KLLA0F27907g150732644e-30
YNL157W168982552e-28
Scas_570.1363665603.2
Scas_720.593131578.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G06094g
         (136 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...   247   5e-86
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...   150   6e-48
Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      133   6e-41
Kwal_33.14612                                                         129   2e-39
Scas_697.15                                                           127   2e-38
AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   118   3e-35
KLLA0F27907g complement(2581760..2582212) some similarities with...   106   4e-30
YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...   102   2e-28
Scas_570.13                                                            28   3.2  
Scas_720.5                                                             27   8.3  

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score =  247 bits (630), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 124/136 (91%)

Query: 1   MSNLRNEIKEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKH 60
           MSNLRNEIKEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKH
Sbjct: 1   MSNLRNEIKEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKH 60

Query: 61  RMAGRKYFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLXXXXXXXXXXXXAGDH 120
           RMAGRKYFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGL            AGDH
Sbjct: 61  RMAGRKYFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLRESIIRRRMSSSAGDH 120

Query: 121 VSRQDSISSGPPPRSP 136
           VSRQDSISSGPPPRSP
Sbjct: 121 VSRQDSISSGPPPRSP 136

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
           cAMP-regulated phosphoprotein or endosulfine conserved
           region containing family, has high similarity to
           uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score =  150 bits (380), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (77%), Gaps = 3/126 (2%)

Query: 13  ISPTNSELEL-DKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSG 71
           +SPT+S ++L + HG  K GVD+S+LS QELKLYKMYGKLPSKKD+ +H+M  R+YFDSG
Sbjct: 5   LSPTSSRVDLSNPHGFTKEGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYFDSG 64

Query: 72  DYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLXXX-XXXXXXXXXAGDHVSRQDSISSG 130
           DYALKKAGVI+SDDVI  NNSSNNLPVTNPSGL              GD +SRQ SISSG
Sbjct: 65  DYALKKAGVIKSDDVI-VNNSSNNLPVTNPSGLRESIIRRRMSSSSGGDSISRQGSISSG 123

Query: 131 PPPRSP 136
           PPPRSP
Sbjct: 124 PPPRSP 129

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  133 bits (334), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 91/131 (69%), Gaps = 14/131 (10%)

Query: 13  ISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGD 72
           ISPT+S ++L      KN VD S+L+ QELKLYK+YGKLPSKKD+FKH++  RKYFDSGD
Sbjct: 5   ISPTSSNIDL------KNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGD 58

Query: 73  YALKKAGVIRSDDVIDENNSSNNLPVTNPSGLXXXXXXXXXXXXAG-------DHVSRQD 125
           YAL KAGV +SDD+  ++  S++LPVTNPSGL            AG         ++RQ 
Sbjct: 59  YALSKAGV-KSDDLQSDSIGSSHLPVTNPSGLRESIIRRRMSSSAGSVDAAASQQLNRQG 117

Query: 126 SISSGPPPRSP 136
           SISSGPPPRSP
Sbjct: 118 SISSGPPPRSP 128

>Kwal_33.14612
          Length = 129

 Score =  129 bits (324), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/132 (53%), Positives = 92/132 (69%), Gaps = 11/132 (8%)

Query: 9   KEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYF 68
           K++ +SPT+S + L++       VD S+++ QELKLYKMYGKLPSKKD+FKH++  RKYF
Sbjct: 3   KDNDLSPTSSSVNLNEK------VDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYF 56

Query: 69  DSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLXXXXXXXXXXXXAG----DHVSRQ 124
           DSGDYAL KAGV +SDD+  ++  +++LPVTNPSGL            AG      + RQ
Sbjct: 57  DSGDYALNKAGV-KSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQELRRQ 115

Query: 125 DSISSGPPPRSP 136
            SISSGPPPRSP
Sbjct: 116 GSISSGPPPRSP 127

>Scas_697.15
          Length = 142

 Score =  127 bits (318), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 82/101 (81%), Gaps = 5/101 (4%)

Query: 8   IKEDSISPTNSELELD--KHGVDKNG--VDVSRLSEQELKLYKMYGKLPSKKDIFKHRMA 63
           + E+ +SPT S ++L    H  DK+G  VD+S+L+ QELKL+KMYGKLPSK+D+ KH+M 
Sbjct: 1   MAEEQLSPTTSRVDLKNLAHTKDKDGNMVDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQ 60

Query: 64  GRKYFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGL 104
            RKYFDSGDYAL+KAGVI+ DDV+  +NSSNN+PVTNPSGL
Sbjct: 61  ERKYFDSGDYALRKAGVIKKDDVM-SSNSSNNMPVTNPSGL 100

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
           (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  118 bits (296), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (65%), Gaps = 12/129 (9%)

Query: 12  SISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSG 71
           S SPTNS L       D   VD+S L+ QELKLYK+YGKLP KKD+FKH++  RKYFDSG
Sbjct: 4   SPSPTNSTL------ADTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSG 57

Query: 72  DYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLXXXXXXXXXXXXAG----DHVSRQDSI 127
           DYAL KAGV +S+D+      S++LPVTNPSGL            AG     +++RQ SI
Sbjct: 58  DYALSKAGV-KSEDLGSAAVGSSHLPVTNPSGLRESIIRRRMSSSAGGLDSQNLNRQSSI 116

Query: 128 SSGPPPRSP 136
           SSG PPRSP
Sbjct: 117 SSG-PPRSP 124

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score =  106 bits (264), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (87%), Gaps = 1/73 (1%)

Query: 32  VDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGDYALKKAGVIRSDDVIDENN 91
           VD+S+LS QELK+YKMYGKLPSKKD+F+H++  RKYFDSGDYAL++AGV +SDD+     
Sbjct: 37  VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGV-KSDDLQSSPV 95

Query: 92  SSNNLPVTNPSGL 104
           ++NNLP+TNPSGL
Sbjct: 96  ANNNLPLTNPSGL 108

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
           similarity to Yhr132w-ap and with weak similarity to
           human ENSA alpha-endosulfine and human ARPP-19
           cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score =  102 bits (255), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 4/98 (4%)

Query: 8   IKEDSISPTNSELELDKHGVDKNG-VDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRK 66
           +  +++SP +S  +L K    ++G +D S+ S  E+KLYKMYGKLPSKKDIFKH M  RK
Sbjct: 1   MSNENLSPNSSNPDLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRK 60

Query: 67  YFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPSGL 104
           YFDSGDYAL+KAG+  +D +   N   NNLP+TNPS L
Sbjct: 61  YFDSGDYALQKAGIQNNDPI---NYGKNNLPLTNPSKL 95

>Scas_570.13
          Length = 636

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 22  LDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGDYALKKAGVI 81
           ++K  VD+  +D+ RL  Q+L    M+G+    +   + +M  RK F  GDY LK    +
Sbjct: 149 VEKASVDEVFLDLGRLCFQDL----MFGENEEFESCDQLKML-RKMFIEGDYDLKSRLPV 203

Query: 82  RSDDV 86
             DD+
Sbjct: 204 VPDDL 208

>Scas_720.5
          Length = 931

 Score = 26.6 bits (57), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 31  GVDVSRLSEQELKLYKMYGKLPSKKDIFKHR 61
           G ++ +L  ++L+L K Y KL +KK  ++ R
Sbjct: 560 GGEIKKLMNEQLQLVKQYSKLEAKKAWYEWR 590

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,813,256
Number of extensions: 203996
Number of successful extensions: 524
Number of sequences better than 10.0: 20
Number of HSP's gapped: 510
Number of HSP's successfully gapped: 20
Length of query: 136
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 45
Effective length of database: 13,445,871
Effective search space: 605064195
Effective search space used: 605064195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 56 (26.2 bits)