Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G04015g1019100450100.0
Scas_604.61011100935450.0
YLL031C (GPI13)1017101635120.0
KLLA0C17534g1005100832620.0
AGR126C1013100631700.0
Kwal_55.206641791677303e-90
KLLA0F01705g7874265394e-57
Scas_711.508313785061e-52
AEL166C8063845041e-52
Kwal_14.25878083504821e-49
YJL062W (LAS21)8303864614e-47
CAGL0J05236g8424004223e-42
CAGL0M08448g9211781448e-09
KLLA0B07249g9192201439e-09
AEL113C9251971412e-08
YKL165C (MCD4)9192201351e-07
Kwal_33.138569222161313e-07
Scas_689.289242261286e-07
YCR026C74266741.2
KLLA0A11374g62148722.5
AFR684C109466694.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G04015g
         (1004 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G04015g 379330..382389 highly similar to tr|Q07830 Saccharo...  1934   0.0  
Scas_604.6                                                           1370   0.0  
YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein in...  1357   0.0  
KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomy...  1261   0.0  
AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH] (989241..9...  1225   0.0  
Kwal_55.20664                                                         285   3e-90
KLLA0F01705g complement(159469..161832) similar to sp|P40367 Sac...   212   4e-57
Scas_711.50                                                           199   1e-52
AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH] (322853..3...   198   1e-52
Kwal_14.2587                                                          190   1e-49
YJL062W (LAS21) [2849] chr10 (317200..319692) Protein required f...   182   4e-47
CAGL0J05236g complement(502420..504948) similar to sp|P40367 Sac...   167   3e-42
CAGL0M08448g complement(841439..844204) highly similar to sp|P36...    60   8e-09
KLLA0B07249g complement(630336..633095) similar to sp|P36051 Sac...    60   9e-09
AEL113C [2393] [Homologous to ScYKL165C (MCD4) - SH] (409096..41...    59   2e-08
YKL165C (MCD4) [3105] chr11 complement(137937..140696) Protein r...    57   1e-07
Kwal_33.13856                                                          55   3e-07
Scas_689.28                                                            54   6e-07
YCR026C (YCR026C) [560] chr3 complement(164106..166334) Protein ...    33   1.2  
KLLA0A11374g complement(985471..987336) some similarities with s...    32   2.5  
AFR684C [3877] [Homologous to ScYNL278W (CAF120) - SH; ScYLR187W...    31   4.9  

>CAGL0G04015g 379330..382389 highly similar to tr|Q07830 Saccharomyces
            cerevisiae YLL031c GPI13, start by similarity
          Length = 1019

 Score = 1934 bits (5010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1004 (94%), Positives = 950/1004 (94%)

Query: 1    MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS 60
            MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS
Sbjct: 1    MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS 60

Query: 61   RTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYN 120
            RTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYN
Sbjct: 61   RTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYN 120

Query: 121  TWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIE 180
            TWLSTRH            ILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIE
Sbjct: 121  TWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIE 180

Query: 181  EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSH 240
            EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSH
Sbjct: 181  EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSH 240

Query: 241  LLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLVV 300
            LLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLVV
Sbjct: 241  LLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLVV 300

Query: 301  MGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQNGNYDIENLAQNYHSVNQIDLVP 360
            MGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQNGNYDIENLAQNYHSVNQIDLVP
Sbjct: 301  MGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQNGNYDIENLAQNYHSVNQIDLVP 360

Query: 361  TLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEELEETMS 420
            TLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEELEETMS
Sbjct: 361  TLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEELEETMS 420

Query: 421  ALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWXXXXXXXXXXXXXXXXXXXXXXXXXX 480
            ALWRNSTADVFAASQYQQKFLEVCKDKWARFDYW                          
Sbjct: 421  ALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWSIASGTILLTISLILLLSITKLIPSI 480

Query: 481  VVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGCSISI 540
            VVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGCSISI
Sbjct: 481  VVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGCSISI 540

Query: 541  FDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITFGMLT 600
            FDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITFGMLT
Sbjct: 541  FDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITFGMLT 600

Query: 601  LYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSIVLIV 660
            LYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSIVLIV
Sbjct: 601  LYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSIVLIV 660

Query: 661  STRVASVITICREEQGEYCTPTFTTKNNYAWWXXXXXXXXXXXXXXXXKGYYNLSSSYQA 720
            STRVASVITICREEQGEYCTPTFTTKNNYAWW                KGYYNLSSSYQA
Sbjct: 661  STRVASVITICREEQGEYCTPTFTTKNNYAWWCLGLCLLIVILLPICIKGYYNLSSSYQA 720

Query: 721  AAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIATNVGW 780
            AAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIATNVGW
Sbjct: 721  AAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIATNVGW 780

Query: 781  MMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLM 840
            MMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLM
Sbjct: 781  MMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLM 840

Query: 841  VNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIF 900
            VNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIF
Sbjct: 841  VNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIF 900

Query: 901  PFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVLCL 960
            PFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVLCL
Sbjct: 901  PFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVLCL 960

Query: 961  SSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004
            SSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF
Sbjct: 961  SSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004

>Scas_604.6
          Length = 1011

 Score = 1370 bits (3545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1009 (65%), Positives = 808/1009 (80%), Gaps = 18/1009 (1%)

Query: 1    MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS 60
            MDERV++Q++LSTS+DEKRIYRSR+QKF KSH LYV+LLG+LA LQF+AIAFF KGFLL+
Sbjct: 1    MDERVIKQSILSTSADEKRIYRSRIQKFRKSHTLYVLLLGSLAALQFIAIAFFLKGFLLT 60

Query: 61   RTVLDNVSTTSD-NPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLY 119
            R VLDNV+T +D   +    KF+K V+LVVDALRFDFV+PV+ S+P+YN+ +HNNL VLY
Sbjct: 61   RNVLDNVATLADYQSIENYGKFNKSVILVVDALRFDFVIPVNQSNPDYNDYYHNNLKVLY 120

Query: 120  NTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVI 179
              +                 +LLKF+ADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVI
Sbjct: 121  EKF---------EDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVI 171

Query: 180  EEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKS 239
            EEDN+IKQ+FL +K V FVGDDTWDALF+PFL+  S+P+ SLNVWDLDTVDNGVIS+F  
Sbjct: 172  EEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWDLDTVDNGVISFFND 231

Query: 240  HLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLV 299
            HLL+ + D++W++L+GHMLG+DHVGHK+GPNHFTM++KQ Q+++FI+EI++SID+DTLLV
Sbjct: 232  HLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKFIREIMDSIDDDTLLV 291

Query: 300  VMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQN-GNYDIENLAQNYHSVNQIDL 358
            +MGDHGMDHTGNHGGDS+DELESTLF Y+KR N W  Q+  NYD  N    Y SVNQIDL
Sbjct: 292  IMGDHGMDHTGNHGGDSKDELESTLFLYSKRNNAWNLQDTSNYDTRNQGDRYRSVNQIDL 351

Query: 359  VPTLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEE--LE 416
            V TLS LL +P+PFNNLGWPI+E F  EKE  +  N  L+QL+ Y + + +    E  LE
Sbjct: 352  VSTLSFLLGLPIPFNNLGWPINEIFCTEKEASSFTNAALKQLRTYTEAIGIKINNESLLE 411

Query: 417  ETMSALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWXXXXXXXXXXXXXXXXXXXXXX 476
            E    L++   A+   A +YQ + L++ K  W  FDY+                      
Sbjct: 412  E----LYQIGLANHERAQKYQIQLLQIFKTLWTNFDYYSIATGVCLLTVSVILLISVTNL 467

Query: 477  XXXXVVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGC 536
                VVNQMVPEF PWI+IMSL +NVCFHG +YVFHQP+F++N  WCTLFA+A+GII GC
Sbjct: 468  IPSIVVNQMVPEFAPWIVIMSLTTNVCFHGFYYVFHQPLFINNWIWCTLFATAIGIIIGC 527

Query: 537  SISIFDRYSFVWLVMKMVE-ILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLIT 595
             I IFDRY+  WL+ ++ + +LSDYWSR+GA+F+++H++LFTSNSFTIWED+IV  +LIT
Sbjct: 528  CIPIFDRYTLKWLISRVFQDLLSDYWSRVGALFLILHSLLFTSNSFTIWEDKIVTFLLIT 587

Query: 596  FGMLTLYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHS 655
            FG+LTLYEF FLP RQ TS LLTA I E +GTTSGV+ STANSN+LPLTRFARLLG YHS
Sbjct: 588  FGVLTLYEFVFLPNRQYTSRLLTATISENEGTTSGVNSSTANSNSLPLTRFARLLGGYHS 647

Query: 656  IVLIVSTRVASVITICREEQGEYCTPTFTTKNNYAWWXXXXXXXXXXXXXXXXKGYYNLS 715
            I+LIV TR+AS+ITICREEQG+YCTPTFTTKNNY+ W                KGYYNLS
Sbjct: 648  IMLIVCTRLASLITICREEQGDYCTPTFTTKNNYSLWCLSICFLLIFMIPACIKGYYNLS 707

Query: 716  SSYQAAAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIA 775
            SSYQAAAPIW+D+FLKG LF+NF YW+ T++EN+     +D    K TIARI+ GFSLIA
Sbjct: 708  SSYQAAAPIWIDIFLKGVLFINFAYWTATSLENTLPEWSYDLTIFKFTIARIVTGFSLIA 767

Query: 776  TNVGWMMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQL 835
            +NVGW+MGPLCIKLN+ N D+KS+QATILGYTNIYGSE+FLLVIN +M+I++F KPLAQ+
Sbjct: 768  SNVGWLMGPLCIKLNIHNTDVKSHQATILGYTNIYGSEYFLLVINWIMSIIIFMKPLAQI 827

Query: 836  SLFLMVNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILS 895
            S+FLM NQILSI EIIDLLKLKENI+GPI L L++YQQ+FSTGHQATIPS+QWDVGFILS
Sbjct: 828  SIFLMCNQILSILEIIDLLKLKENIIGPIVLALLSYQQYFSTGHQATIPSIQWDVGFILS 887

Query: 896  DKIIFPFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYN 955
            DKI FP TH+ + LNTFGP I+++LSVALLTLW QPPDVLKPQT+LGRIVSNCGVL+ YN
Sbjct: 888  DKITFPLTHISLALNTFGPQILIALSVALLTLWKQPPDVLKPQTILGRIVSNCGVLILYN 947

Query: 956  TVLCLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004
            ++LCLSSFIWVTHFRRHLMVWKIFCPRF+FAC+SLIV Q+++TF TI F
Sbjct: 948  SILCLSSFIWVTHFRRHLMVWKIFCPRFLFACMSLIVTQIIVTFVTIAF 996

>YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein
            involved in glycosylphosphatidylinositol biosynthesis,
            probably responsible for adding phosphoethanolamine to
            the third mannose [3054 bp, 1017 aa]
          Length = 1017

 Score = 1357 bits (3512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1016 (64%), Positives = 804/1016 (79%), Gaps = 26/1016 (2%)

Query: 1    MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS 60
            MDE+ +++++LS+S+DEK IY+SR++KF K+H  Y+ILL  +A LQF++IAFF +GFLLS
Sbjct: 1    MDEKTIKKSILSSSNDEKIIYKSRIKKFQKNHKFYIILLVFIAILQFISIAFFTRGFLLS 60

Query: 61   RTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYN 120
            R VLDN+S+ ++    +  +F+K V+LV+DALRFDF +PV+ SH NYN N+HNN+  LY+
Sbjct: 61   RHVLDNISSQNETS-KLPPRFNKAVILVIDALRFDFAIPVNESHSNYNLNYHNNILSLYD 119

Query: 121  TWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIE 180
            ++ S +             +LLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDG+VIE
Sbjct: 120  SFASDKDASS---------LLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGTVIE 170

Query: 181  EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSH 240
            EDN +KQL LANK+V F GDDTW ALFHPFL+N+S P  SLNVWDLDTVDNGV+ YF  H
Sbjct: 171  EDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDH 230

Query: 241  LLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLVV 300
            L     D+ WD+++GHMLG+DHVGHKYGP+HFTMREKQ QV++FI  I++SID+DTLLV+
Sbjct: 231  L---QQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSIDDDTLLVI 287

Query: 301  MGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWK-NQNGNYDIENLAQNYHSVNQIDLV 359
            +GDHGMDHTGNHGGDS DELESTLF Y+K+ + W+  +  NY+I+NL  +Y SV QIDLV
Sbjct: 288  LGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKETSNYNIDNLGHDYRSVRQIDLV 347

Query: 360  PTLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTY-TEELEET 418
             +L+LL+  P+PFNNLGWPI E   N++E     N  + QL+ Y D MQ+ +  +E+ E 
Sbjct: 348  SSLALLMGQPIPFNNLGWPIDEIARNDREWSQFVNSAISQLQLYKDTMQIHHGNDEILEP 407

Query: 419  MSALWRNS--TAD----VFAASQYQQKFLEVCKDKWARFDYWXXXXXXXXXXXXXXXXXX 472
            ++    N+  T+D    V    +YQ+ FL+ C++ WA+FDY+                  
Sbjct: 408  LAKNISNTPPTSDPEKFVKLGHKYQKVFLQTCEELWAKFDYYSIATGITLLATSLVLLIS 467

Query: 473  XXXXXXXXVVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGI 532
                    VVNQMVPEFVP IIIM L++N+CFHGIFYV+ QP F+D  +W TL A+A+GI
Sbjct: 468  ITKLIPSIVVNQMVPEFVPGIIIMVLVTNLCFHGIFYVYQQPSFVDQ-FWGTLLATAIGI 526

Query: 533  ITGCSISIFDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIM 592
            I GC I+IFDRY+F+W+ M++ E L+DYWSRI  MF++IHA+LFTSNSFTIWEDRIVA +
Sbjct: 527  IIGCYITIFDRYNFIWIAMRLGETLADYWSRIAVMFMIIHALLFTSNSFTIWEDRIVAFL 586

Query: 593  LITFGMLTLYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGS 652
            L TFGMLTLYEF FLP RQST+ALLTA I EK+GTTSGV+ STANSN LPLTRFARLLG 
Sbjct: 587  LSTFGMLTLYEFVFLPKRQSTTALLTATISEKEGTTSGVNPSTANSNYLPLTRFARLLGG 646

Query: 653  YHSIVLIVSTRVASVITICREEQGEYCTPTFTTKNNYAWWXXXXXXXXXXXXXXXXKGYY 712
            YHS VLI+ TR+AS+ITICREEQGEYC PTF  +NN +WW                 GYY
Sbjct: 647  YHSAVLIIFTRLASMITICREEQGEYCIPTFNNQNNSSWWVLGLCFLMIFILPACITGYY 706

Query: 713  NLSSSYQAAAPIWVDMFLKGALFVNFLYWSITAVENSTESLE----WDTKTVKITIARII 768
            NL+SSYQAAAPIW+++FLKG L +NF+YWS+T++EN++  +      D    K T+ARII
Sbjct: 707  NLTSSYQAAAPIWINVFLKGILGLNFVYWSLTSLENNSAVIAIPFLRDVTIFKFTLARII 766

Query: 769  AGFSLIATNVGWMMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLF 828
            AGFSLIA+NVGW+MGPLCIKLN+ N D+KS++ATILGYTNIYGSEFFLLVIN L++I+LF
Sbjct: 767  AGFSLIASNVGWLMGPLCIKLNIHNTDVKSHEATILGYTNIYGSEFFLLVINVLISILLF 826

Query: 829  NKPLAQLSLFLMVNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQW 888
            NKPLAQLS FLM NQ+LSI EIIDLLKLKENI+GPIALGL++YQ FF+TGHQATIPSVQW
Sbjct: 827  NKPLAQLSYFLMCNQLLSILEIIDLLKLKENIIGPIALGLLSYQHFFTTGHQATIPSVQW 886

Query: 889  DVGFILSDKIIFPFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNC 948
            D+GF+LS+K+ FPFT + I+LNTFGPHI+VSLSVALLTLWSQPPDVLKPQTLLGRIVSNC
Sbjct: 887  DIGFMLSEKVTFPFTQIAIILNTFGPHILVSLSVALLTLWSQPPDVLKPQTLLGRIVSNC 946

Query: 949  GVLLTYNTVLCLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004
            G+LLTYNT+LCLSSFIWVTHFRRHLMVWKIFCPRFIFA LSLIV QLV+TFGTI F
Sbjct: 947  GILLTYNTILCLSSFIWVTHFRRHLMVWKIFCPRFIFASLSLIVTQLVVTFGTIAF 1002

>KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomyces
            cerevisiae YLL031c GPI13 protein involved in
            glycosylphosphatidylinositol biosynthesis, start by
            similarity
          Length = 1005

 Score = 1261 bits (3262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1008 (61%), Positives = 750/1008 (74%), Gaps = 29/1008 (2%)

Query: 2    DER----VVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGF 57
            DER     +R +++   +   R+   R+ +F  +H LY++LL +LA LQF++IAFFAKGF
Sbjct: 7    DERDRAERIRLSIMGPQTRSSRM-SYRISRFKSTHTLYILLLASLAVLQFISIAFFAKGF 65

Query: 58   LLSRTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDV 117
            LL+RTVLDNV+   D  L  + K+DKMVLL+VDALRFDFV+PV  +H  YN N+HNNL V
Sbjct: 66   LLTRTVLDNVAEL-DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHNNLKV 124

Query: 118  LYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGS 177
            LY T                  +LLKF+ADPPTTTLQRLKGLTTGSLPTFIDAGSNF+G 
Sbjct: 125  LYET-----------AHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGD 173

Query: 178  VIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYF 237
            VI+EDNLIKQL+L NK + F GDDTWDALF+P+LA  S PY SLNVWDLDTVDNGVISY 
Sbjct: 174  VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYL 233

Query: 238  KSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTL 297
            + +  ++     +DIL+GHMLGVDHVGHKYGPNHFTM+EKQ QV+  +++II + D++TL
Sbjct: 234  EEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTL 293

Query: 298  LVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQNGNYDIENLAQNYHSVNQID 357
             VVMGDHGMDHTGNHGGDSQDELES L+ Y K  N W     +Y+  +L  +Y  +NQID
Sbjct: 294  YVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNAN-WSKDYDSYNTTDLGTSYKQMNQID 352

Query: 358  LVPTLSLLLDIPVPFNNLGWPISEAFENEKEELAC-DNVVLQQLKRYADVMQLTYTEELE 416
            LVPTLSLLL IP+PFNNLGWP+ E   N+ EEL    N+   QL++Y  V  +       
Sbjct: 353  LVPTLSLLLGIPIPFNNLGWPLDE-IANDPEELTLYHNICRNQLEKYLSVSNII------ 405

Query: 417  ETMSALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWXXXXXXXXXXXXXXXXXXXXXX 476
               +   R++   V    ++QQ FLE+CKD WARFD+                       
Sbjct: 406  --GATARRDALISVENHPEFQQMFLEICKDLWARFDFTSICVGIALMAFSLILLLIIIKL 463

Query: 477  XXXXVVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGC 536
                VV QMV +FV  ++++S ISNV F GI+ V HQP FLDN  WC+ FA++VGII G 
Sbjct: 464  IPSIVVGQMVGDFVGCVVVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGV 523

Query: 537  SISIFDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITF 596
             I IFDRYS  WL +++VE LSDYWSRI  +F+ +HA+LFTSNSFTIWEDRIVA +L TF
Sbjct: 524  FIPIFDRYSVQWLCLRLVEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTF 583

Query: 597  GMLTLYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSI 656
            GMLTLYEF FLP R ST+A+L+ A GEKQGT SG S   +NS++LPL RFAR+LG YHSI
Sbjct: 584  GMLTLYEFAFLPQRHSTAAILSGA-GEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSI 642

Query: 657  VLIVSTRVASVITICREEQGEYCTPTFTTKNNYAWWXXXXXXXXXXXXXXXXKGYYNLSS 716
            VL++ TR++S+ITICREEQG YCTPTFT  NNY+++                KGYYN+ S
Sbjct: 643  VLVLCTRLSSMITICREEQGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCS 702

Query: 717  SYQAAAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIAT 776
            SYQAAAPIW+ + LKG+LF +F YWS+  +EN  E L WD    K TI+RII G SLIA 
Sbjct: 703  SYQAAAPIWIGLILKGSLFASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIAC 762

Query: 777  NVGWMMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLS 836
            N+GWM GPLC+KLN+ N DLKS QATILGY+N+YGS++FLLVIN LMAIMLFNKPL QLS
Sbjct: 763  NIGWMKGPLCVKLNIHNTDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLS 822

Query: 837  LFLMVNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSD 896
            +FLM NQ+LSI EI DLLK+KE+++GP+ALGL+AYQQFFSTGHQATIPSVQWD+GFIL++
Sbjct: 823  IFLMCNQLLSIIEICDLLKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTE 882

Query: 897  KIIFPFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNT 956
            KIIFP+THLGI+LNTFGP I+V+LSVALLTLW QPP VL+PQT+L RIVSN G LL YN+
Sbjct: 883  KIIFPWTHLGIVLNTFGPFILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNS 942

Query: 957  VLCLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004
            VLCLSSF+WVTHFRRHLMVWKIFCPRF+FA L LIV QLV+TF TIGF
Sbjct: 943  VLCLSSFVWVTHFRRHLMVWKIFCPRFLFASLCLIVSQLVVTFITIGF 990

>AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH]
            (989241..992282) [3042 bp, 1013 aa]
          Length = 1013

 Score = 1225 bits (3170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1006 (59%), Positives = 744/1006 (73%), Gaps = 18/1006 (1%)

Query: 1    MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGFLLS 60
            +DE +++Q+VL+   D++R+ + R+++F  +H LY+ L  ALA LQF+AIAFF +GFLLS
Sbjct: 9    VDEELLKQSVLNNDEDDRRLTKLRIERFRTTHTLYIFLYSALAALQFIAIAFFTRGFLLS 68

Query: 61   RTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYN 120
            R VLD+V+   ++      KFD++VLLVVDALRFDFV+PV  +   YN ++HN+L  LY 
Sbjct: 69   RKVLDDVANRDES--TAPAKFDRLVLLVVDALRFDFVIPVDVAAEGYNSHYHNHLRALYE 126

Query: 121  TWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIE 180
             W  +              ILLKF+ADPPTTTLQRLKGLTTGSLPTFIDAGSNF+G VI+
Sbjct: 127  RWDES--------------ILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGIVID 172

Query: 181  EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSH 240
            E  +IKQ+ L NK++ F GDDTWDALFHP+L+N S PY SLNVWDLDTVDNGVIS+F+ H
Sbjct: 173  EGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLNVWDLDTVDNGVISFFEDH 232

Query: 241  LLDKSADRN-WDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTLLV 299
            LL+   ++  WD+LVGHMLG+DHVGHKYGP+HF+M EKQ+QV+ FI++II+++D DTLLV
Sbjct: 233  LLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQVDGFIRQIIDAVDEDTLLV 292

Query: 300  VMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQN-GNYDIENLAQNYHSVNQIDL 358
            VMGDHGMDHTGNHGGDS  ELESTL+ YTKR  TW+ Q    Y+   L + Y +VNQIDL
Sbjct: 293  VMGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQAPAAYNTTELGRYYRAVNQIDL 352

Query: 359  VPTLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEELEET 418
            VP+LSLLL +P+PFNNLGWPI E   ++ E        L QL+ Y +           + 
Sbjct: 353  VPSLSLLLGLPIPFNNLGWPIEELAHDDDEWRLFTRQTLMQLETYRNTSNSITDSSKLKI 412

Query: 419  MSALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWXXXXXXXXXXXXXXXXXXXXXXXX 478
            +  L  N+ ++   A  YQ   LE+ KD WARFDY+                        
Sbjct: 413  LEELKINANSNSSDAGNYQAILLEMYKDLWARFDYYSIGTGIILLIISLAMLITITRLIP 472

Query: 479  XXVVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGCSI 538
              VV QM+ E VP II+M L+SNVCF G+FYV  QP FL N  W +L A+AVGII G  +
Sbjct: 473  SIVVGQMLSELVPTIIVMPLVSNVCFLGVFYVLRQPAFLQNWLWASLLATAVGIIIGFYV 532

Query: 539  SIFDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITFGM 598
             IFDRY+  WLV++  E LSDYWSR+ A  + +HA++FTSNSFTIWED+IV+  L T GM
Sbjct: 533  PIFDRYNLTWLVLRFGEELSDYWSRVAAFLITLHALIFTSNSFTIWEDKIVSFSLTTLGM 592

Query: 599  LTLYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSIVL 658
            LTLYEF FLP R STSA+L AA+GEK+GT SG+S   ANS++LPL RFAR++G YHSIVL
Sbjct: 593  LTLYEFVFLPKRHSTSAILAAALGEKEGTVSGISSGQANSDSLPLGRFARIVGGYHSIVL 652

Query: 659  IVSTRVASVITICREEQGEYCTPTFTTKNNYAWWXXXXXXXXXXXXXXXXKGYYNLSSSY 718
            IV TR+AS+ITICREEQG YCTPTFT  NNY++                 KGYYN+SSSY
Sbjct: 653  IVCTRLASLITICREEQGAYCTPTFTLTNNYSFSVMLGCLFLVFATPACIKGYYNVSSSY 712

Query: 719  QAAAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIATNV 778
            QAAAPIW+ M +K  LFVNF+YW +   EN++++   +     +TI+RI+ G SL+A N+
Sbjct: 713  QAAAPIWIGMLMKSILFVNFIYWELKTFENTSDTHGLNLTIFNLTISRIVVGVSLVAANI 772

Query: 779  GWMMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLF 838
            GWMMGPLCIKLNV N D +S QATILGY N YG+++FLLVIN  M I+LFNKPLAQLSLF
Sbjct: 773  GWMMGPLCIKLNVHNNDRRSQQATILGYANAYGAQYFLLVINFFMCILLFNKPLAQLSLF 832

Query: 839  LMVNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKI 898
            LM NQ+LSI EI DLLKLKEN++GP+ALGL++YQQFFSTGHQATIP+VQWD+GFIL+++I
Sbjct: 833  LMCNQLLSILEIFDLLKLKENLIGPVALGLLSYQQFFSTGHQATIPAVQWDMGFILTERI 892

Query: 899  IFPFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVL 958
             FPFTHLGI+LNTFGPHI+  +SVALLTLW QPP +L+  TLL R+VSNCG+LL Y TVL
Sbjct: 893  TFPFTHLGIVLNTFGPHILCGISVALLTLWKQPPGILRANTLLARVVSNCGMLLIYQTVL 952

Query: 959  CLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004
            CLS+FIWVT+FRRHLMVWKIFCPRF+FA LSLIV QLV+TF TI F
Sbjct: 953  CLSTFIWVTNFRRHLMVWKIFCPRFMFAALSLIVTQLVLTFITIAF 998

>Kwal_55.20664
          Length = 179

 Score =  285 bits (730), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 154/167 (92%)

Query: 781 MMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLM 840
           MMGPLC+KLN++N D+KS QATILGY N+YGS+FFLLVIN LM IMLFNKP+AQ+SLFLM
Sbjct: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60

Query: 841 VNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIF 900
            NQ+LS+ EI DLLKLKEN++GP+A+GL+AYQQFFSTGHQATIP+VQWD+GF+L+++I F
Sbjct: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120

Query: 901 PFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSN 947
           PFTHLGI++NTFGPHI+V+LSVALLTLW QPP VLKPQTLL RIVS 
Sbjct: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVST 167

>KLLA0F01705g complement(159469..161832) similar to sp|P40367
           Saccharomyces cerevisiae YJL062w LAS21 required for
           addition of a side chain to the
           glycosylphospatidylinositol (GPI) core structure, start
           by similarity
          Length = 787

 Score =  212 bits (539), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 150/426 (35%), Positives = 215/426 (50%), Gaps = 59/426 (13%)

Query: 42  LAFLQFVAIAFFAKGFLLSRTVLDNVSTTSDNP---LAVDKKFDKMVLLVVDALRFDFVV 98
           LA LQ VA+  F  GF   + VL N S    NP   LA    F K+VL+V+DALR DF+ 
Sbjct: 9   LATLQLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLF 68

Query: 99  PVSTSHPNYNENFHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKG 158
              +S   +     N+ +     W  T +                  ++PPT TL RLKG
Sbjct: 69  QKDSSDFEFLHGLLNSGE----AWGYTAY------------------SNPPTVTLPRLKG 106

Query: 159 LTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLAN 213
           +TTGS P F+DA  N        ++ E+D+L+KQ    +  ++F GDDTW  LF     +
Sbjct: 107 ITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFS 166

Query: 214 NSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFT 273
             +   S  V D + VD  V  +    +      +NWD+L+ H LG+DH+GHK G     
Sbjct: 167 EYDGTNSFFVSDFEEVDFNVTRHVPYQM---EHQKNWDVLILHYLGLDHIGHKGGSKSHF 223

Query: 274 MREKQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNT 333
           M  K  +++  I++I E ID DTL+VV+GDHGM+  GNHGG S  E  + L F +KR   
Sbjct: 224 MPSKHREMDSVIKQIYEKIDGDTLMVVLGDHGMNDLGNHGGSSSGETSAALAFLSKRLKK 283

Query: 334 WKN----QNGNYDIENLAQNY---HSVNQIDLVPTLSLLLDIPVPFNNLGWPISEAFENE 386
           +++    Q+ N  +E+   +Y     V QID+VPTLS+L ++P+P N++G  I E  +  
Sbjct: 284 YQSSDIQQSSNVPVEDAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLL 343

Query: 387 KEELAC----DNVV-LQQLKRYADVMQL------TYTEELEETMSALWRNSTADVFAASQ 435
             +LA     DN + L +LK   +  QL      T  EE+ E  S+L         AA+ 
Sbjct: 344 PSKLAAIKVQDNYLQLTKLKPGYEA-QLEKKSAGTLLEEMREIQSSL-------AMAATN 395

Query: 436 YQQKFL 441
           Y   FL
Sbjct: 396 YNYTFL 401

>Scas_711.50
          Length = 831

 Score =  199 bits (506), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 201/378 (53%), Gaps = 45/378 (11%)

Query: 54  AKGFLLSRTVLDNVST---TSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNEN 110
           A GF   + VL  ++     S+        F K+VL+V+DALR DF+   + SH ++   
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHF--- 77

Query: 111 FHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTFIDA 170
            H+ L+     W  T +                  ++PPT TL RLKG+TTGS P F+DA
Sbjct: 78  IHSQLNE-GTAWGFTAY------------------SNPPTVTLPRLKGITTGSTPNFLDA 118

Query: 171 -----GSNFDGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWD 225
                  +   ++ ++D+L+ Q  L NK ++F GDDTW  LF     N  E   S  V D
Sbjct: 119 ILNVAEDDVSTTLADQDSLLAQFHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSD 178

Query: 226 LDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFI 285
            + VD  V  +    L     + +WD+L+ H LG+DH+GHK G +   M EK  +++  +
Sbjct: 179 FEVVDTNVSRHLTKQL---KHNHDWDVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIV 235

Query: 286 QEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYT----KRQNTWKNQNGNY 341
           +++ E+ID+DTLLVVMGDHGM+  GNHGG S  E  + L F +    K +   K ++ N 
Sbjct: 236 RQVYENIDDDTLLVVMGDHGMNEVGNHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNL 295

Query: 342 DIENLA-QNYH---SVNQIDLVPTLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVL 397
            I+    +N+    SV QIDLVPTL+ L +IP+P NN+G  I E      + L  D + +
Sbjct: 296 PIKRQTDENFQFLTSVQQIDLVPTLATLFNIPIPKNNVGIVIPEFL----QFLRKDMINI 351

Query: 398 QQLKRYADVMQLTYTEEL 415
           + ++ Y  ++QL+  ++L
Sbjct: 352 KLMENYHQLLQLSKGQDL 369

>AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH]
           (322853..325273) [2421 bp, 806 aa]
          Length = 806

 Score =  198 bits (504), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 126/384 (32%), Positives = 191/384 (49%), Gaps = 45/384 (11%)

Query: 41  ALAFLQFVAIAFFAKGFLLSRTVLDNVST---TSDNPLAVDKKFDKMVLLVVDALRFDFV 97
            L F Q +A+  FA GF   + VL   +     ++   A++  FDK+VL+V+DALR DF+
Sbjct: 7   GLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADFL 66

Query: 98  VPVSTSHPNYNENFHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLK 157
              + SH ++     N  +     W  T +                  ++PPT TL RLK
Sbjct: 67  FQQNVSHFDFVHELLNRGE----AWGFTAY------------------SNPPTVTLPRLK 104

Query: 158 GLTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLA 212
           G+TTGS P F+DA  N        ++ ++D+ I Q     K + F GDDTW  LF     
Sbjct: 105 GITTGSAPNFLDAILNVAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFF 164

Query: 213 NNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHF 272
              +   S  V D + VD  V      HL  +   ++WD+L+ H LG+DH+GHK G    
Sbjct: 165 QKHDGTNSFFVSDFEEVDTNV----TRHLPHELQHKDWDVLILHYLGLDHIGHKGGAASQ 220

Query: 273 TMREKQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQN 332
            M  K  +++  I++I + +DN TLL VMGDHGM+  GNHGG S  E  + + F +K  +
Sbjct: 221 FMPPKHREMDAVIRQIYDQVDNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLS 280

Query: 333 TWKN---QNGNYDIENLAQNYH---SVNQIDLVPTLSLLLDIPVPFNNLGWPISEAFENE 386
           ++     Q+G       A++Y     + Q+D VPT++ L +IP+P N+LG      F  E
Sbjct: 281 SYPRPAAQDGVSSPVTAAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLG-----VFVRE 335

Query: 387 KEELACDNVVLQQLKRYADVMQLT 410
              L   +   + ++ Y  +MQL 
Sbjct: 336 FSSLLGQHATTKIIENYHQLMQLA 359

>Kwal_14.2587
          Length = 808

 Score =  190 bits (482), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 179/350 (51%), Gaps = 40/350 (11%)

Query: 42  LAFLQFVAIAFFAKGFLLSRTVLDNVST---TSDNPLAVDKKFDKMVLLVVDALRFDFVV 98
           L   Q VAI  F+ GF   ++VL   +      D    +  KF+K+VL+V+DALR DFV 
Sbjct: 8   LVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVF 67

Query: 99  PVSTSHPNYNENFHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKG 158
               S    N  F + L      W  T +                  ++PPT TL RLKG
Sbjct: 68  QKDMS----NFEFVHGLLNRGQAWGYTAY------------------SNPPTVTLPRLKG 105

Query: 159 LTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLAN 213
           +TTGS P F+DA  N        ++ E+D+ ++Q  + NK + F GDDTW  LF     +
Sbjct: 106 ITTGSTPNFLDAILNVAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFD 165

Query: 214 NSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFT 273
            ++   S  V D + VD  V  +    L   +   +WD+L+ H LG+DH+GHK G     
Sbjct: 166 ETDGTNSFFVSDFEEVDFNVTRHLPKQL---ATQDSWDVLILHFLGLDHIGHKGGAFSHF 222

Query: 274 MREKQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNT 333
           M  KQ +++  I+++  S+  DTL+ VMGDHGM+  GNHGG S  E  + L F ++    
Sbjct: 223 MAPKQREMDEVIEQVYNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEG 282

Query: 334 WKN---QNGN-YDIENLAQNY---HSVNQIDLVPTLSLLLDIPVPFNNLG 376
           ++    QN   + I+    +Y     VNQIDLVP++S L + P+P N++G
Sbjct: 283 YEKPLAQNHETFPIKTKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIG 332

>YJL062W (LAS21) [2849] chr10 (317200..319692) Protein required for
           addition of a side chain to the
           glycosylphosphatidylinositol (GPI) core structure [2493
           bp, 830 aa]
          Length = 830

 Score =  182 bits (461), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 185/386 (47%), Gaps = 45/386 (11%)

Query: 41  ALAFLQFVAIAFFAKGFLLSRTVLDNVSTT---SDNPLAVDKKFDKMVLLVVDALRFDFV 97
            L+  Q +AI  F   F   + VL  +S      D  L  D+ F K+V +++DALR DF+
Sbjct: 8   CLSCAQLLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFL 67

Query: 98  VPVSTSHPNYNENFHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLK 157
                SH N   N H         WL+T                    A+PPT TL RLK
Sbjct: 68  FDSQISHFN---NVHQ--------WLNTGEAWGYTS-----------FANPPTVTLPRLK 105

Query: 158 GLTTGSLPTFID----AGSNFDGSVI-EEDNLIKQLFLANKSVSFVGDDTWDALFHPFLA 212
            +TTGS P+FID       + D + + E D+ ++Q    N ++ F+GDDTW  LF     
Sbjct: 106 SITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWF 165

Query: 213 NNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHF 272
           + ++P  S  V D   VDN V       L  + A   WD+ + H LG+DH+GHK GP+  
Sbjct: 166 DFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWA--QWDVAILHYLGLDHIGHKDGPHSK 223

Query: 273 TMREKQNQVNRFIQEIIESI-----DNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFY 327
            M  K  +++  ++ I + +     D+DTL+ V+GDHGM+  GNHGG S  E  + L F 
Sbjct: 224 FMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFL 283

Query: 328 TKR--QNTWKNQNGNYDIENLA------QNYHSVNQIDLVPTLSLLLDIPVPFNNLGWPI 379
           + +  Q        NY +   A      Q   +V QID+VPT++ L  +P+P N++G  I
Sbjct: 284 SPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIII 343

Query: 380 SEAFENEKEELACDNVVLQQLKRYAD 405
            +  +    +LA        L + +D
Sbjct: 344 PDFLQLLPNKLASMKENFMHLWKLSD 369

>CAGL0J05236g complement(502420..504948) similar to sp|P40367
           Saccharomyces cerevisiae YJL062w LAS21, hypothetical
           start
          Length = 842

 Score =  167 bits (422), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 191/400 (47%), Gaps = 56/400 (14%)

Query: 48  VAIAFFAKGFLLSRTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNY 107
           +A+  F  GF   + VLD  +   D   A D  FDK+V++VVDA+R DF+   S S  ++
Sbjct: 11  IAVLIFGCGFFPQKKVLDGHAAL-DGTHARDPVFDKLVVVVVDAMRSDFLFDASISKFHF 69

Query: 108 NENFHNNLDVLYNTWLSTRHXXXXXXXXXXXXILLKFIADPPTTTLQRLKGLTTGSLPTF 167
               H  L    + W  T H                  ++PPT TL RLKG+TTGS P F
Sbjct: 70  ---IHEKL-ADGSAWGFTAH------------------SNPPTVTLPRLKGITTGSTPNF 107

Query: 168 IDAGSNF-----DGSVIEEDNLIKQLFL-ANKSVSFVGDDTWDALFHPFLANNS-----E 216
           +DA  N        S++ +D+ + Q    A K + F GDDTW  LF P  AN       +
Sbjct: 108 LDAILNVAEDDTSSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFD 167

Query: 217 PYPSLN---VWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFT 273
            Y   N   V D   VD  V  +    L + S    WD+L+ H LG+DH+GHK GP    
Sbjct: 168 EYEGTNSFFVSDFTQVDLNVTRHIDRQLRETS---EWDVLILHYLGLDHIGHKDGPYSRF 224

Query: 274 MREKQNQVNRFIQEIIESID-NDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQN 332
           M  K  +++  I+++ + +D   TLLV+MGDHGM+  GNHGG S  E  + + F + +  
Sbjct: 225 MGPKHEEMDSIIRKLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLA 284

Query: 333 TWKNQNGNYDIENLAQNYHSVN--------------QIDLVPTLSLLLDIPVPFNNLGWP 378
            +K        +       S+N              QID+VPT+S L ++ +P NN+G  
Sbjct: 285 AYKPSKEQSSAKEFPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVI 344

Query: 379 ISEAFENEKEELACDNVVLQQLKRYADVMQLTYTEELEET 418
           I E  +  K+      +V +   + + + +   T+ +EET
Sbjct: 345 IPEFLQLFKDVSLQKAIVKENWNQLSGLTK-GKTQIMEET 383

>CAGL0M08448g complement(841439..844204) highly similar to sp|P36051
           Saccharomyces cerevisiae YKL165c sporulation protein,
           start by similarity
          Length = 921

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 20/178 (11%)

Query: 242 LDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDT 296
           LDK   ++ +    H+LG D  GH Y P      +    +++ ++++++ +     DNDT
Sbjct: 205 LDKQIRQDGNAFFLHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDT 264

Query: 297 LLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQN--------TWKNQNGNYDIENLAQ 348
             +   DHGM   G+HG    +   + L  +    N         +     N+++ N+ +
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKR 324

Query: 349 NYHSVNQIDLVPTLSLLLDIPVPFNNLG-WPIS--EAFENEKEELACDNV--VLQQLK 401
           N   V Q D+   +S L+    P N++G  P++  E  E +K E   +N   +L+Q +
Sbjct: 325 N--DVKQADIAALMSYLIGTNYPANSVGELPLAYIEGSEGQKLEALLNNAESILEQYR 380

>KLLA0B07249g complement(630336..633095) similar to sp|P36051
           Saccharomyces cerevisiae YKL165c MCD4 sporulation
           protein singleton, start by similarity
          Length = 919

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 96/220 (43%), Gaps = 34/220 (15%)

Query: 242 LDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDT 296
           L+    ++ ++   H+LG D  GH Y P      +    +++ ++ ++E +     D DT
Sbjct: 204 LETEIKQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDT 263

Query: 297 LLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNT--------WKNQNGNYDIENLAQ 348
             +   DHGM   G+HG    +   + L  +    N         + N   N+++ ++ +
Sbjct: 264 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGINKPVKNQAPIFDNYTENWNLADIKR 323

Query: 349 NYHSVNQIDLVPTLSLLLDIPVPFNNLG-WPIS--EAFENEKEELACDN--VVLQQ---- 399
           N   VNQ D+   +S L+    P N++G  P++  +A E++K     +N   +L+Q    
Sbjct: 324 N--DVNQADIASLMSYLIGANYPVNSVGELPLNFIDAPEDKKLNALFNNAKAILEQYLVK 381

Query: 400 ----------LKRYADVMQLTYTEELEETMSALWRNSTAD 429
                      K Y   +++ Y E L++  S + R +  +
Sbjct: 382 EQEIIASQFVYKEYEAFVEIPYQEYLQQIESLIERIAKGE 421

>AEL113C [2393] [Homologous to ScYKL165C (MCD4) - SH]
           (409096..411873) [2778 bp, 925 aa]
          Length = 925

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 37/197 (18%)

Query: 256 HMLGVDHVGHKYGPN----HFTMREKQNQVNRFIQEIIESI-DNDTLLVVMGDHGMDHTG 310
           H+LG D  GH Y P     +  ++   +Q+ R + ++ E   D+DT  V   DHGM   G
Sbjct: 219 HLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAFVFTADHGMSAFG 278

Query: 311 NHGGDSQDELESTLFFYTKRQN--------TWKNQNGNYDIENLAQNYHSVNQIDLVPTL 362
           +HG    +   + L  +    N         + N   N+D+ ++ +N   VNQ D+   +
Sbjct: 279 SHGDGHPNNTRTPLVAWGAGLNRPVLNDVPVYDNYTENWDLAHVRRN--DVNQADIASLM 336

Query: 363 SLLLDIPVPFNNLG----------------------WPISEAFENEKEELACDNVVLQQL 400
           S L+ +  P N++G                        I E +  ++ E+    +V ++ 
Sbjct: 337 SYLIGLNYPTNSVGELPLAYVNGSERTKLNALYKNALSILEQYLVKETEMIQSQLVYKEY 396

Query: 401 KRYADVMQLTYTEELEE 417
            ++A     +Y +E+E 
Sbjct: 397 PKFAQKSHSSYIQEIEH 413

>YKL165C (MCD4) [3105] chr11 complement(137937..140696) Protein
           required for glycosylphosphatidylinositol (GPI) anchor
           synthesis, has a role in modulating aminophospholipid
           metabolism [2760 bp, 919 aa]
          Length = 919

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 34/220 (15%)

Query: 242 LDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDT 296
           LD    ++ ++   H+LG D  GH Y P      +    ++  I  +I+ +     D+ T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKT 264

Query: 297 LLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQN--------TWKNQNGNYDIENLAQ 348
             +   DHGM   G+HG    +   + L  +    N           N   N+++ ++ +
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNPFPVSDNYTENWELSSIKR 324

Query: 349 NYHSVNQIDLVPTLSLLLDIPVPFNNLG-WPISEAFENEKEELAC--------------- 392
           N   V Q D+   +S L+ +  P N++G  PI+     E ++LA                
Sbjct: 325 N--DVKQADIASLMSYLIGVNYPKNSVGELPIAYIDGKESDKLAALYNNARSILEQYLVK 382

Query: 393 -DNVVLQQL--KRYADVMQLTYTEELEETMSALWRNSTAD 429
            D V+  Q   K Y   ++ +++  LEE  + + R S  +
Sbjct: 383 QDEVIDSQFFYKEYFKFVEKSHSHYLEEIETLIQRISEGE 422

>Kwal_33.13856
          Length = 922

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 89/216 (41%), Gaps = 23/216 (10%)

Query: 242 LDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDT 296
           L +   ++ ++   H+LG D  GH Y P      +    +++ + +++  +     D+DT
Sbjct: 205 LRQEITQSGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDT 264

Query: 297 LLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNT--------WKNQNGNYDIENLAQ 348
             +   DHGM   G+HG    +   + L  +    N         + N    +D+  + +
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNPVPIYDNYTEGWDLATIQR 324

Query: 349 NYHSVNQIDLVPTLSLLLDIPVPFNNLG-WPISEAFENEKEELACDNVVLQQLKRYADVM 407
           N   V Q D+   +S L+    P N++G  P+S  + N  EE       L+ L   A  +
Sbjct: 325 N--DVKQADIASLMSYLIGANYPANSVGELPLS--YINASEETK-----LKALYSNARSI 375

Query: 408 QLTYTEELEETMSALWRNSTADVFAASQYQQKFLEV 443
              Y  +  ET+ + ++      FAA    Q   E+
Sbjct: 376 LEQYVVKERETIESQFQYKKFPKFAAKSPAQYLNEI 411

>Scas_689.28
          Length = 924

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/226 (19%), Positives = 92/226 (40%), Gaps = 34/226 (15%)

Query: 242 LDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDT 296
           LD    +  ++   H+LG D  GH Y P      +    ++  +  +++ +     D+DT
Sbjct: 205 LDHEIRQEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDT 264

Query: 297 LLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNT--------WKNQNGNYDIENLAQ 348
             +   DHGM   G+HG    +   + L  +    N         + N   ++ + ++ +
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNEVPIYDNYTESWKLADIKR 324

Query: 349 NYHSVNQIDLVPTLSLLLDIPVPFNNLG-WPISEAFENEKEELAC----DNVVLQQ---- 399
           N   V Q D+   +S L+    P N++G  P++   + E ++L         +L+Q    
Sbjct: 325 N--DVKQADITSLMSYLIGTNYPANSVGELPLAYINDEESQKLEALYNNARSILEQYLVK 382

Query: 400 ----------LKRYADVMQLTYTEELEETMSALWRNSTADVFAASQ 435
                      K Y+   + ++   LEE  + + R +  +++  ++
Sbjct: 383 EKEIIESQFIYKEYSKFTEKSHEVYLEEIHAVIARIAEGEIYLQNE 428

>YCR026C (YCR026C) [560] chr3 complement(164106..166334) Protein
           containing a type I phosphodiesterase or nucleotide
           pyrophosphatase domain, has a region of low similarity
           to a region of ectonucleotide phosphodiesterase 3 (rat
           LOC54410), which releases monophosphates from
           phosphodiester and pyrophosphate bonds [2229 bp, 742 aa]
          Length = 742

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 11/66 (16%)

Query: 252 ILVGHMLGVDHVGHKYG-PN-----HFTMREKQNQVNRFIQEIIESIDNDTL-----LVV 300
           +++G++  VD  GHK+G P+     +    E   +V+ F+++++ES+    L     LV+
Sbjct: 353 LILGYVPNVDAFGHKHGYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVI 412

Query: 301 MGDHGM 306
           + DHGM
Sbjct: 413 VSDHGM 418

>KLLA0A11374g complement(985471..987336) some similarities with
           sp|P25353 Saccharomyces cerevisiae YCR026c, hypothetical
           start
          Length = 621

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 260 VDHVGHKYGPNHFTMREKQ-NQVNRFIQEIIESIDNDTLLVVMGDHGM 306
           VD +GHKYG    +   K   +V+ F++++   +D +  ++V+ DHGM
Sbjct: 303 VDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFADVDENVNILVISDHGM 350

>AFR684C [3877] [Homologous to ScYNL278W (CAF120) - SH; ScYLR187W -
           SH] (1699825..1703109) [3285 bp, 1094 aa]
          Length = 1094

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 170 AGSNFDGSVIE---EDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYP--SLNVW 224
           +GS F GS +    ED+++   +  +K++S VGD   +    P  + +  PY    +NV+
Sbjct: 753 SGSLFRGSSVAPLGEDDILDDFYNLSKAISKVGDSEANRKADPTTSGSRPPYDDTPVNVF 812

Query: 225 DLDTVD 230
           D D V+
Sbjct: 813 DPDYVE 818

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 31,032,480
Number of extensions: 1317624
Number of successful extensions: 4441
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4488
Number of HSP's successfully gapped: 30
Length of query: 1004
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 892
Effective length of database: 12,718,893
Effective search space: 11345252556
Effective search space used: 11345252556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)