Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G03223g1604157981460.0
Scas_716.271620154316910.0
YGR098C (ESP1)1630163116250.0
AAR089C1618158114121e-167
Kwal_55.205351636156013571e-159
KLLA0D15136g15918949531e-105
YDR484W (VPS52)64187840.14
AFR084C304175751.1
KLLA0B11517g50766751.5
CAGL0M00396g42092723.0
ABL155C866121714.7
YAL001C (TFC3)116061715.0
KLLA0F10813g44294698.0
AFR335C103376698.9
Sklu_2413.4112237699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G03223g
         (1579 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G03223g complement(300119..304933) similar to sp|Q03018 Sac...  3142   0.0  
Scas_716.27                                                           655   0.0  
YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin pr...   630   0.0  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...   548   e-167
Kwal_55.20535                                                         527   e-159
KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018 S...   371   e-105
YDR484W (VPS52) [1300] chr4 (1422751..1424676) Subunit of the VF...    37   0.14 
AFR084C [3276] [Homologous to ScYKR026C (GCN3) - SH] (579351..58...    33   1.1  
KLLA0B11517g 1011211..1012734 some similarities with sp|P39925 S...    33   1.5  
CAGL0M00396g 53938..55200 similar to sp|P47168 Saccharomyces cer...    32   3.0  
ABL155C [437] [Homologous to ScYDL220C (CDC13) - SH] (107861..11...    32   4.7  
YAL001C (TFC3) [65] chr1 complement(147598..151010,151101..15117...    32   5.0  
KLLA0F10813g complement(993942..995270) similar to sp|Q9US35 Sch...    31   8.0  
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    31   8.9  
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          31   9.7  

>CAGL0G03223g complement(300119..304933) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation, hypothetical start
          Length = 1604

 Score = 3142 bits (8146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1546/1579 (97%), Positives = 1546/1579 (97%)

Query: 1    MVRFDNSLHEVDLNAQLGDEYKTLSHSLKRGVTHDNNCTHHLMHQYTVSNLSYAVSNLTV 60
            MVRFDNSLHEVDLNAQLGDEYKTLSHSLKRGVTHDNNCTHHLMHQYTVSNLSYAVSNLTV
Sbjct: 1    MVRFDNSLHEVDLNAQLGDEYKTLSHSLKRGVTHDNNCTHHLMHQYTVSNLSYAVSNLTV 60

Query: 61   SDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLY 120
            SDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLY
Sbjct: 61   SDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLY 120

Query: 121  NNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRK 180
            NNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRK
Sbjct: 121  NNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRK 180

Query: 181  LLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQ 240
            LLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQ
Sbjct: 181  LLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQ 240

Query: 241  QLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLFSSTSAEHVPEGFFNLQNVVTNLER 300
            QLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLFSSTSAEHVPEGFFNLQNVVTNLER
Sbjct: 241  QLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLFSSTSAEHVPEGFFNLQNVVTNLER 300

Query: 301  NERFFDKYMMSTKQLNDLINIIAEEGRVFEKELDEKSILLIQRILSIFQIKCYEISKPVL 360
            NERFFDKYMMSTKQLNDLINIIAEEGRVFEKELDEKSILLIQRILSIFQIKCYEISKPVL
Sbjct: 301  NERFFDKYMMSTKQLNDLINIIAEEGRVFEKELDEKSILLIQRILSIFQIKCYEISKPVL 360

Query: 361  KFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTKN 420
            KFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTKN
Sbjct: 361  KFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTKN 420

Query: 421  SELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLFD 480
            SELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLFD
Sbjct: 421  SELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLFD 480

Query: 481  GKEHFNEVYAVCEYIAAIVKRKIGTLKWENLECKSEVMKGIIAGVTNDRYPNNECMEPCI 540
            GKEHFNEVYAVCEYIAAIVKRKIGTLKWENLECKSEVMKGIIAGVTNDRYPNNECMEPCI
Sbjct: 481  GKEHFNEVYAVCEYIAAIVKRKIGTLKWENLECKSEVMKGIIAGVTNDRYPNNECMEPCI 540

Query: 541  LLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTF 600
            LLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTF
Sbjct: 541  LLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTF 600

Query: 601  CQFATKDNKVNYCSRIENDFIKKLLNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYIT 660
            CQFATKDNKVNYCSRIENDFIKKLLNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYIT
Sbjct: 601  CQFATKDNKVNYCSRIENDFIKKLLNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYIT 660

Query: 661  YKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSS 720
            YKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSS
Sbjct: 661  YKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSS 720

Query: 721  NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKG 780
            NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKG
Sbjct: 721  NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKG 780

Query: 781  LKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVF 840
            LKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVF
Sbjct: 781  LKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVF 840

Query: 841  DQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYD 900
            DQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYD
Sbjct: 841  DQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYD 900

Query: 901  KIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDA 960
            KIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDA
Sbjct: 901  KIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDA 960

Query: 961  DPFLKSLNETILANLNCVSPGSLSNILDVGMIXXXXXXXXXXMTPKRRPTSFKTNKHIVM 1020
            DPFLKSLNETILANLNCVSPGSLSNILDVGMI          MTPKRRPTSFKTNKHIVM
Sbjct: 961  DPFLKSLNETILANLNCVSPGSLSNILDVGMISSNSTNRSSNMTPKRRPTSFKTNKHIVM 1020

Query: 1021 DILDEFFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNE 1080
            DILDEFFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNE
Sbjct: 1021 DILDEFFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNE 1080

Query: 1081 LPSEITHTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNI 1140
            LPSEITHTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNI
Sbjct: 1081 LPSEITHTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNI 1140

Query: 1141 TVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKI 1200
            TVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKI
Sbjct: 1141 TVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKI 1200

Query: 1201 INDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYC 1260
            INDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYC
Sbjct: 1201 INDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYC 1260

Query: 1261 DKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIIXXXXXXXXXXXGFFTALEDV 1320
            DKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWII           GFFTALEDV
Sbjct: 1261 DKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLDPSDLGFFTALEDV 1320

Query: 1321 IYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTF 1380
            IYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTF
Sbjct: 1321 IYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTF 1380

Query: 1381 PWEIMKPLKGRSVTRVPXXXXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTEKTF 1440
            PWEIMKPLKGRSVTRVP            KGNLPVKIERTNDISMILNSNSDLVRTEKTF
Sbjct: 1381 PWEIMKPLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRTEKTF 1440

Query: 1441 KDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKL 1500
            KDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKL
Sbjct: 1441 KDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKL 1500

Query: 1501 PPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCN 1560
            PPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCN
Sbjct: 1501 PPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCN 1560

Query: 1561 LLDAKPNTVITGVPQAVAD 1579
            LLDAKPNTVITGVPQAVAD
Sbjct: 1561 LLDAKPNTVITGVPQAVAD 1579

>Scas_716.27
          Length = 1620

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1543 (31%), Positives = 788/1543 (51%), Gaps = 93/1543 (6%)

Query: 69   IETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLYNNTNRNSI 128
            I    +  Y    R H LR +  + K+HL+++VKLIN N  + +   I+ LYN TN    
Sbjct: 78   IHAVFTTLYRELNRRHLLRHLRALVKEHLIVVVKLINNNFYDYSQSGILCLYNTTNLFKA 137

Query: 129  SEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHKL 188
             +++ ++L D++++N+ YLS+LKIL  Q +LKK ++     ++I+ F++D + +L+D  +
Sbjct: 138  HDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKMYEDTIIQAFSHDERYILKDPNI 197

Query: 189  KKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQQLGRQKTS 248
            K +TV+KL+LN++S    ++ LFGLKFLQYI QFN  +  +IKNM    F +QL R  + 
Sbjct: 198  KIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSFQTYIKNMDSITFEKQLVRYGSK 257

Query: 249  NNTLTSRYLSMFYFSYQMQYKSNNDQL----FSSTSAEHVPEGFFNLQN----VVTNLE- 299
            N      YL+ +Y +Y  ++ S+  +L    F     +   + F  L++      T+ E 
Sbjct: 258  NIQQLKPYLNSYYINYS-KFNSHLTKLMLTDFVGRDLQSHKKTFALLKDHKEISSTSTEC 316

Query: 300  ---RNERFFDKYMMSTKQL---NDLINIIAEEGRVFEKELDEKSILLIQRILSIFQIKCY 353
                +    D +++S   L   ND I++   +   F                SI + + +
Sbjct: 317  YCCLSHSQMDNFVISCHALMSNNDQIHLHTIDAVTFG--------------WSIIRSENF 362

Query: 354  EISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYN 413
              +K +L  LD  +I LNS +K+L      L+KLI+ + + C     +K   N + V++N
Sbjct: 363  PRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQEYKRMTNVINVSFN 422

Query: 414  IALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIF 473
              +  +N + L L ++ E    L+ + +++  K   + KF  F+ +  E   +Y+ +++F
Sbjct: 423  CFVFFRNFDFLKLTAELESKHYLVCHDKSQWKKL--IQKFEKFIGSAPE---QYQKIELF 477

Query: 474  YHHTLFDGKEHFNE--VYAVCEYIAAIVKRKIGTLK---WENLECKSEVMKGIIAG---V 525
             +  +F+    FN+  +  V E+   I  R    LK   + +    SE M  I+ G   +
Sbjct: 478  SY--VFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSI 535

Query: 526  TNDRYPNNECMEPCILLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDI 585
            TN  + +   +   +    S  F    + +   N  + +   +Y    L+K  Y+LN D+
Sbjct: 536  TNIPHGDWNNLTEMLFFCVSGRFE---INAININQVTTKWYYLYKYKDLIKSIYVLNLDM 592

Query: 586  AKGRTMYLVQVTKTF-CQFATKDNKVNY-CSRIENDFIKKLLNYLSINGYHKLLLSVVGI 643
             K  +  L Q+T ++  ++  K + +N   S IE  FI  L  YL  N ++K +L++   
Sbjct: 593  KKHSSSNLSQLTSSYISKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAA 652

Query: 644  LEKRTEYYKTLSNDYITYKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIM 703
            L     Y+  L  +   +   S + L+L  +        +           + +   L  
Sbjct: 653  LRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTICKLEKLLTFLEA 712

Query: 704  SLLYASW----EDSPELFTSSNERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANY 759
             L   +W    E   ELF    E +P  ++  + D +   K   ++Y + L+F  K  N+
Sbjct: 713  KLDVFTWTNDYEGFQELFM---EELP-SVRLEVFDLNNQSKMPASQYIKVLLFMTKLFNH 768

Query: 760  YASLLNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTA 819
             + L   +   + +V  SK+ LK+  S++K   KL  + R+ ++N +++S++ LI+IY  
Sbjct: 769  SSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIEIYIR 828

Query: 820  VGLAKGAQYYCKEVTKLLPVFDQPIFLF-SVHVLLFEFYLENGDYDSALTHKKNANYVFD 878
            +GLAK A YY  +++K++    +P  ++  +H L   + L   +    +T +K AN  FD
Sbjct: 829  LGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQK-ANKTFD 887

Query: 879  NLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICDE--CPT 936
             L+ E DI +   FL+ N E+ KI ESL L+F  D N++   L W+LK+G   D+  C T
Sbjct: 888  YLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSLCLT 947

Query: 937  QYSNMNFFNKIVHINQRLVLEIDADPFLKSLNETILA-----NL-NCVSPGSLSNILDVG 990
               + N   K+    + ++ ++++DPF K+L E+ILA     N+ N  S G++  +++  
Sbjct: 948  TLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDGTMC-LMETP 1006

Query: 991  -----MIXXXXXXXXXXMTPKRRPTSFKTNKHIVMDILDEFFTTFNAMRQELTERNVILK 1045
                             MTPK +    K +K + +  L+        +  EL     +L 
Sbjct: 1007 TKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNRIKCCIEDLNLELLNHGDLLN 1066

Query: 1046 VSDIYRLNYFYLISLLSVPESRKQLIEETITQ---LNELPSEITHTYESLLADKNCDIYG 1102
            +S ++ L    L ++     S+  L + T+ Q   L +LP  +   Y+ LL+  + D+Y 
Sbjct: 1067 ISSLFSLTVTMLSNI-----SKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYT 1121

Query: 1103 KTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNITVEVICIDICKLTNTLIIRRIS 1162
                   SSN+E  + K   L+  E        + C ++ +VI IDIC +T  L++ ++S
Sbjct: 1122 DIKLLPFSSNHEQTRKKQALLSLNEST------EFCGLSFDVITIDICSITGNLLLSKLS 1175

Query: 1163 NLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDSNESVSKNVTETIKDKNDV 1222
              +       IP++R   RDLDA SLTF +A + L  II++SN + S  VT +IK K D 
Sbjct: 1176 ATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDESNSTTSVEVTSSIKTKEDR 1235

Query: 1223 RNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDKDALLEFQSKITAILNQILPS 1282
            + WWK RY+LD  L +L+  IE +W  GL G+ +    D     EF+ K   IL+  LPS
Sbjct: 1236 KTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPS 1295

Query: 1283 RRNCCNRANFLQLDEWIIXXXXXXXXXXXGFFTALEDVIYFILDTLSHKGEENAYDEIDF 1342
            R+       FLQ+++WII            F + +ED+IYF LD L  +GEENAYDEID 
Sbjct: 1296 RKQMGKPMTFLQINDWIIELFLKLDPQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDL 1355

Query: 1343 GLLHVLLEEEIRKVRVNKKLFT---KIEHTFLVVGPSCHTFPWEIMKPLKGRSVTRVPXX 1399
             ++H+ LEE+I+  R + K+ +   K++HTFLV+G +CHTFPWE +  +   S++R+P  
Sbjct: 1356 SMVHIQLEEQIK--RYHSKVISNSHKVDHTFLVIGSACHTFPWESLSFMNDLSLSRIPSI 1413

Query: 1400 XXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTEKTFKDIFERIQDSRAGSRLLVN 1459
                         L   +  T  ISMILN + DL RTE  F++ FE I   R  S L+VN
Sbjct: 1414 KWLESAITRHYEQLIKGVPLTEKISMILNPHGDLERTELRFRETFETIVAKRPSSSLIVN 1473

Query: 1460 QKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPPVFLMGCSSAATKLNGNL 1519
            +KP EE+ +  ++N  +F+YVGHGGGEQYVR   I+RCD + P FL+GCSSA+ K  G L
Sbjct: 1474 EKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSFLLGCSSASLKYYGGL 1533

Query: 1520 NPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCNLL 1562
             P     SY+   S +VLGNLWDVTDKDIDKFS  + EK  L+
Sbjct: 1534 EPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLV 1576

>YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin protein
            required for Mcd1p and Rec8p cleavage and sister
            chromatid separation during mitosis and meiosis, also
            cleaves Slk19p and Mcd1p, also involved in regulation of
            spindle pole body duplication [4893 bp, 1630 aa]
          Length = 1630

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1631 (29%), Positives = 814/1631 (49%), Gaps = 98/1631 (6%)

Query: 1    MVRFDNSLHEVDLNAQLGDEYKTLSHSLKR---------------GVTHDNNCTHHLMHQ 45
            MV+ +  L+E+  N  +  +   L+ +L +               G    N+     MH 
Sbjct: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMHN 61

Query: 46   YTVSNLSYAVSN---LTVSDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVK 102
              + + +   SN   L + D    + ++ +L++ YS     H    IN   KQHL++IVK
Sbjct: 62   NIIRDFTKIASNNIDLAIED---ITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVK 118

Query: 103  LINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKH 162
            LIN N L  AS  II L+N TN      ++ +LL D++  N  YLS+LKIL LQ +LK+ 
Sbjct: 119  LINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRK 178

Query: 163  DVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQF 222
             V E +  +++LF++D++ LL+D  LK + + K++L+++S     ++LFGLKFLQYI QF
Sbjct: 179  LVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQF 238

Query: 223  NFRYDEFIKNMTRDAFLQQLGRQKTSNNTLTSRYLSMFYFSYQMQYKS-NNDQLFSSTSA 281
               + +FI N+T + F + L  +          YL+ FY SY M Y   +   L    S 
Sbjct: 239  KLPFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDILSY 298

Query: 282  EHVPEGFFNLQNVVTNLERNERFFDKYM-MSTKQL------NDLINIIAEEGRVFEKELD 334
            E   E    +Q  +    ++++ F++Y  MS  +L       D +N+I E    F +   
Sbjct: 299  EETTE----VQRAI----KSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKG 350

Query: 335  E---KSILLIQRILSIFQIKCYEISKPVLKFLDKIIILLNSNVKYLSNDISP--LIKLIE 389
            +    ++  +  + S  +++    +K +L+  D  +I +NSN+K ++++ +   L +L+ 
Sbjct: 351  KHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDESAAALLSELLG 410

Query: 390  SMIQFCTTNSLHKTFENTMAVAYNIALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSD 449
             + + C      K   N ++V +N ++  K+   LL  +  E S +L++     K     
Sbjct: 411  VLSEICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLIS--NDSKTSHRT 468

Query: 450  LNKFNVFLSATKEIRNRYKILQIFYHHTLFDGKEHFNEVYAVCE--YIAAIVKRKIGTLK 507
            + KF  F+S+ +  + + +I    ++       +  + V+  C+  +I    + KI   K
Sbjct: 469  ILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKIT--K 526

Query: 508  WENLECKSEVMKGIIAG---VTNDRYPNNECMEPCILLLQSSFFPEKVLTSEEYNDSSNQ 564
            +      SE+M  ++ G   + N    N   +   I       F    L   E N++ ++
Sbjct: 527  FIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFD---LDPLELNNTFDK 583

Query: 565  DGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTFCQ--FATKDNKVNYCSRIENDFIK 622
              ++     L++  YLLN D++K  T  L ++TK +        D K    S  E DF+K
Sbjct: 584  LHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVK 643

Query: 623  KLLNYLSINGYHKLLLSVVGILEKRTEYYKTL---SNDYITYKAHSCM----RLKLKNRT 675
             LL YL+ N + KL + +   ++ + +YY ++   +++Y+     S       L +KN+ 
Sbjct: 644  MLLCYLNFNNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQL 703

Query: 676  KHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSSNERVPKDIKEHILDF 735
            +   +  T +  +        I  HL        W+     F     +    +K  + D 
Sbjct: 704  QKTMNLSTAKIEQALLHASSLINVHL--------WDSDLTAFQIYFGKTLPAMKPELFDI 755

Query: 736  STNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLD 795
            + +    ++ Y + ++ NIK  N  A L  +      AV   +K   +  S+LK   KL 
Sbjct: 756  NNDHNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRKAQNLALSLLKKKNKLS 815

Query: 796  LNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFE 855
               RL +L  L  S+  LIKI+  +G A+  ++Y KE+++++   ++PI ++     L  
Sbjct: 816  QGSRLALLKSLSFSFFQLIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHR 875

Query: 856  FYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLN 915
            +Y+              AN  FD L+AE DI + T FLY N+E+ K+++SL LYFG  L 
Sbjct: 876  YYMITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLE 935

Query: 916  DTDFFLSWKLKLGNICDE--CPTQYSNMNFFNKIVHINQRLVLEIDADPFLKSLNETIL- 972
             T     WKL LG   D+  C ++Y   N  N++ ++ Q+++ +++ DPF K + E+ L 
Sbjct: 936  KTFLPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLG 995

Query: 973  --ANLNCVSPGSLSNILDVGM-----IXXXXXXXXXXMTPKRRPTSFKTNKHIVMDILDE 1025
              ++L  +     +NIL         +          MTP+ +    K ++   +  L +
Sbjct: 996  IPSSLPVIPSTMPNNILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQ 1055

Query: 1026 FFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNELPSEI 1085
                  +++ +  + + + K+S +  L    L ++ S+  +   LI  T   L +LP  +
Sbjct: 1056 MKELLESLKLDTLDNHELSKISSLSSLTLTILSNITSIHNAESSLI--TNFSLTDLPRHM 1113

Query: 1086 THTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEE---QIGKDRLLDLCNITV 1142
               ++ +L   N D      F + S    ++   N++   E       +  L++  N+ +
Sbjct: 1114 PLLFDKVL--NNIDNKNYREFRVSS----LIAPNNISTITESIRVSAAQKDLME-SNLNI 1166

Query: 1143 EVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIIN 1202
             VI ID C +T  L++ ++     +    ++P+ R+ SRDLD   L+F +A++ L  IIN
Sbjct: 1167 NVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIIN 1226

Query: 1203 DSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDK 1262
            +SN++ S  VT  IK + + ++WW  RYDLD+ +  L+  IE +W NG+ G  +    D 
Sbjct: 1227 ESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDN 1286

Query: 1263 DALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIIXXXXXXXXXXXGFFTALEDVIY 1322
                +F+ K   IL+Q LPSR+   N A F+++++W+I            F + +ED+IY
Sbjct: 1287 SLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIY 1346

Query: 1323 FILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTFPW 1382
            F+LD L   GEENAYDEIDF +LHV LEE+I+K R        I HTFLVV  SCH FPW
Sbjct: 1347 FVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMTT-NSIFHTFLVVSSSCHLFPW 1405

Query: 1383 EIMKPLKGRSVTRVPXXXXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTEKTFKD 1442
            E +  LK  S+TRVP               LP+++   ++ISMILN N DL RTE  FK 
Sbjct: 1406 ECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKG 1465

Query: 1443 IFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPP 1502
            +F++I D++  S+L++N+KP EE  +  L NS +F+Y+GHGGGEQYVR+  I++C K+ P
Sbjct: 1466 MFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAP 1525

Query: 1503 VFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEK---- 1558
             FL+GCSSAA K  G L P     +Y+ G   MVLGNLWDVTDKDIDKFS E+ EK    
Sbjct: 1526 SFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGFR 1585

Query: 1559 CNLLDAKPNTV 1569
            CN  D   N++
Sbjct: 1586 CNTDDLNGNSL 1596

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score =  548 bits (1412), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 433/1581 (27%), Positives = 754/1581 (47%), Gaps = 120/1581 (7%)

Query: 55   VSNLTVSDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASR 114
            V       +G + ++   L+  Y    + H L  +  +++QH+ ++V+L+      +A+R
Sbjct: 64   VQRFVQEGKGEADKVREALTGLYRELKQRHQLGRVAEVSRQHMGVVVRLLEAGQDAAAAR 123

Query: 115  NIISLYNNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKL 174
             +++LYN TN      +  +L+ D+  +N+ YLS+ KIL +Q +++   V     +V+++
Sbjct: 124  EVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAKILAMQLIIRMRQVESHAETVVRI 183

Query: 175  FAYDRKLLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMT 234
            FA D + +L D KLK +TV+KLILN++S   +Y++LF LKFLQY++QF   +  +IKNM 
Sbjct: 184  FAADERYILRDPKLKVHTVVKLILNFFSLLPQYKVLFALKFLQYVSQFRLDFSTYIKNMD 243

Query: 235  RDAFLQQLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLFSSTSAEHV------PEGF 288
               F +Q+ +   +    +  +L ++Y SY     S    ++              PE  
Sbjct: 244  LAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQHMTSIGKLMWQDFRVPDRGDTKLNPEDP 303

Query: 289  FNLQNVVTN---LERNERFFDKYMMSTKQLNDLINIIAEEGRVFEKELDEKSILLIQRIL 345
              LQ ++     L+  E  FD Y   TK +   ++        F   L            
Sbjct: 304  IILQQILHGRRTLDNAE--FDAY---TKHITTKLSKGVSPTDAFLGAL------------ 346

Query: 346  SIFQIKC----YEISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLH 401
             ++ + C      + K  +  LDKI I +N+NV ++S  +  +  +++S+ ++      +
Sbjct: 347  KVYILNCSLKRLRLQKAHVILLDKIAIFINTNVVHVS--VESIHTILKSLAEYFIDAKEY 404

Query: 402  KTFENTMAVAYNIALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATK 461
            K   N + +++N  +  K+  L+ L +  E   L ++ K+   +      KF  F+S   
Sbjct: 405  KRLNNVVNISFNAYVMYKHESLIRLAADLELF-LFMSVKQDWSM----FTKFEKFISVAS 459

Query: 462  EIRNRYKILQIFYHHTLFDGKEHFNEVYAVCEYIAAIVKRKIGTLKWENLECKSEVMKGI 521
               +     Q F  + +F        ++ VC   +    +K+G   + + +  SE M  +
Sbjct: 460  GDISVSLFEQCFNVYVMF-ADPSLAGLWDVCLNKSLKCFKKLGLTSYTDFKASSEPMLVL 518

Query: 522  I-AGVTNDRY--PNNECMEPCILLLQSSFFPEKVLTSEEYNDSSNQDGIVYDVFP----L 574
            + +G  +D +  P N       +L    F     +    Y D   +   V DV      L
Sbjct: 519  VYSGFVSDIFTIPYNGWAPLSKML----FMALNGVYKFGYMDVDCKIKSV-DVLAKYEML 573

Query: 575  LKCNYLLNNDIAKGRTMYLVQVTKTFC-QFATKDNKVNYCSRIENDFIKKLLNYLSINGY 633
            +K  Y LN ++    T+ L ++   +  ++ +        S +E  F+K L+ YL  N +
Sbjct: 574  IKSTYSLNMEMETHGTLQLSKIANMYVSRWVSSLPTDERISGLEVRFVKALVQYLRFNKF 633

Query: 634  HKLLLSVVGILEKRTEYYKTLSNDYITYKAHSCMRLKLKNRTK-------HVFDQFTNQK 686
            HK L+ +  +L+ + EYY++  ND   +   +   LK+   TK        +   F+ ++
Sbjct: 634  HKKLIELCQLLKSKGEYYESFKNDIRVWLLEAYTALKMVQATKLQIQSVLKIHSSFSIER 693

Query: 687  GEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSSNERVPKDIKEHILDFSTNDKSNLNKY 746
                FD    +Y +L   LL  SWE   + F    + + +  + +  D + N    ++++
Sbjct: 694  A--TFDS---LYEYLYARLLIISWERDNDSFNHLVQEL-RVSQTNFFDINNNSNLPVSQF 747

Query: 747  FQKLIFNIKFANYYASLL--NQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLN 804
             + L+ NI+     ASLL  +    +   +E +KK LK+ +S++K  +KL    RL V++
Sbjct: 748  LKLLLLNIRIEKL-ASLLQFHNNNMFESLLE-AKKALKLCQSLIKKQQKLSQFHRLEVIS 805

Query: 805  QLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLL-------PVFDQPIFLFSVHVLLFEFY 857
             L   ++ +I IY  VG++K  ++Y K+  +++       P++D   F++  + L     
Sbjct: 806  LLQDLFAQVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYDYYKLT---- 861

Query: 858  LENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLNDT 917
             E     SA   +   N  FD L+   +I     F+Y N+E DK++ SL L+F  DL DT
Sbjct: 862  -EQNQLASATLSR--LNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGDLEDT 918

Query: 918  DFFLSWKLKLGNICD---ECPTQYSNMNFFNKIVHINQRLVLEIDADPFLKSLNETILAN 974
                 W L+LG + +   E P Q   ++  NK   +  R++ +++ DPF  ++ E+++A 
Sbjct: 919  FLVDEWNLRLGIVIENTREQP-QLKALSDVNKSNELYLRILKQMELDPFFSNMCESVIAI 977

Query: 975  LNCVSP------GSLSNILDVGMIXXXXXXXXXXMTPKRRPTSFKTNKHIVMDILDEFFT 1028
             +C SP       ++SN+                +TP+ +    K ++   ++ L     
Sbjct: 978  PSCFSPKVEEIRPAVSNVWSPAG-SPYHSPRPSSLTPRGKCLRQKFDRSNAINNLQMIKR 1036

Query: 1029 TFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNELPSEITHT 1088
               ++  +  + + + K S +Y L+  +L ++ S  + R  LI+     + ELP  +   
Sbjct: 1037 LIESVNLDEMQNHEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFT--MAELPKYMPMY 1094

Query: 1089 YESLLADKNCDIYGKTI-FELESSNYEIM----KSKNVTLN---WEEQIGKDRLLDLCNI 1140
            Y+ + +    ++YG  +  E++S          K   +  N   W+E             
Sbjct: 1095 YDKMFSRMGNEVYGSFMPMEVKSMCTPFFTVQQKVDGIQTNFNSWDEPF----------- 1143

Query: 1141 TVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKI 1200
              + I +DICK    L++ ++ +   K+   ++P++R+ SRDL  ++LTF    E L  I
Sbjct: 1144 --QAISVDICKYNGDLLLSKVVSTTGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDI 1201

Query: 1201 INDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYC 1260
            I  +N + S  VT  IK K D R WW+ RY LD+ + +L+ RIE +W+ G  G  +    
Sbjct: 1202 IEKNNRTTSIEVTSVIKTKEDRREWWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQL 1261

Query: 1261 DKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIIXXXXXXXXXXXGF---FTAL 1317
            DK+    F+     +L Q LP+RR   N + FLQ+D++I+                   +
Sbjct: 1262 DKNHFALFKLGFQKVLQQNLPTRRQYGNPSMFLQVDDFILELFLKVDWDALPHEKKVEFM 1321

Query: 1318 EDVIYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSC 1377
            ED+IYFI D L   GEENAYDEID  L+H+ LEE I           ++ HTFLV+   C
Sbjct: 1322 EDLIYFIFDILLFHGEENAYDEIDVHLIHIQLEELIHDYHAKAPEAPRLGHTFLVISSEC 1381

Query: 1378 HTFPWEIMKPLKGRSVTRVPXXXXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTE 1437
               PWE +      SV+RVP            +G +  KI   + +S++LN + DL RTE
Sbjct: 1382 SLVPWESLSIFSDASVSRVPSINFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRTE 1441

Query: 1438 KTFKDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERC 1497
              FK+ F R+      +R++   KP E+E++  +TNS  F+Y+GHGGGEQY R+ T++  
Sbjct: 1442 LRFKEHFTRLCCDLGSTRIVTGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKLQ 1501

Query: 1498 DKLPPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLE 1557
            D   P FL+GCSSA     G L P+ V  SY+ G S MV+GNLWDVTDKDID F+  M  
Sbjct: 1502 DNAAPSFLLGCSSAYMIQYGKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMSH 1561

Query: 1558 KCNLLDAKPNTVITGVPQAVA 1578
            K  +  ++ +  +  V +AV+
Sbjct: 1562 KLGIFPSQRDRFLN-VSEAVS 1581

>Kwal_55.20535
          Length = 1636

 Score =  527 bits (1357), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 417/1560 (26%), Positives = 746/1560 (47%), Gaps = 92/1560 (5%)

Query: 68   EIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLYNNTNRNS 127
            E+       Y  Y   H   ++  + KQ++L I+K++     ++A + ++++YN TN + 
Sbjct: 86   EVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIKIVELQSYDAAVQEVLNIYNETNHHK 145

Query: 128  ISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHK 187
               ++Q LL D T +N  YLS+LK+L LQ ++K         +++KLFA D + +L   K
Sbjct: 146  AESLEQFLLADLTTSNDYYLSALKLLALQIIIKGKRQDFYGETILKLFANDSRYILRTEK 205

Query: 188  LKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQQLGRQKT 247
            +K   + K++LN++S   +++ LF LKF+QY+ QF+  ++ +IKNM    F + +     
Sbjct: 206  IKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQFDLNFESYIKNMDMPKFQEMILIWAQ 265

Query: 248  SNNTLTSRYLSMFYFSYQMQYKSNND----QLFSSTSAEHV---PEGFFNLQNVVTNLER 300
             + T T+ +L +FY SY   ++S +      L + +S + +    +GF    N +++ E 
Sbjct: 266  RSPTKTNGFLGLFYSSYSQYFQSVDKIMLHDLVNPSSRDRIKVISKGF----NSLSSHEW 321

Query: 301  NERFFDKYMMSTKQLNDLINIIAEEGRVFEKELD-EKSILLIQRILSIFQIKCYEISKPV 359
            ++       +S  + N L+  I  E ++ EK+ D +K  +L++  L +   +    ++ +
Sbjct: 322  SQGIETFTNLSIIERNSLLEFI--ESQLEEKKFDSQKVAILLRWFLQLANNELSPATRQL 379

Query: 360  LKFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTK 419
             + +D+I + +NSN+  LS  I  + +L++ +   C  N   K   N   VA+N  +  K
Sbjct: 380  WRIVDRITVFINSNLHSLS--IHIVKELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFK 437

Query: 420  NSELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLF 479
            N   +L  +KF+ +R     +   K    DL +   FLS+            +F   T F
Sbjct: 438  NDIFVLQAAKFDLAR-----QTIFKQGGLDLTRLEKFLSSASNGHRIKLFTDVFNVFTCF 492

Query: 480  DGKEHFNEVYAVCEYIAAIVK--RKIGTLKWENLECKSEVMKGIIAGVTNDRYPNNECME 537
            +    +  + ++ E  +   K  R +       L   SE+M  +++ +      +  C  
Sbjct: 493  E----YESLGSLTEVTSRFAKCLRSVNIRASTELSGASELMICLLSTLRPLEPDSISCWS 548

Query: 538  PCILLLQSSF--FPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQ 595
            P   +L  S   + +    +E+  D+ +     Y+V  L+K  Y L  +I K  +  L +
Sbjct: 549  PLTRMLYHSLTNYAKDNNKTEKCRDTLDPLK-HYEV--LIKTIYSLGLEIKKSSSHCLAK 605

Query: 596  VTKTFCQFATKDNKVNYCSR----IENDFIKKLLNYLSINGYHKLLLSVVGILEKRTE-Y 650
            V+  F +   K  ++N+       +E   I+ L  YL  N +HK ++ +   L+     Y
Sbjct: 606  VSDNFTENWVK--RLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALALKNSPHPY 663

Query: 651  YKTLSNDYITYKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEK--DIYNHLIMSLLYA 708
            Y+  + +         + L++K R      +        + ++ K   I+ +    L   
Sbjct: 664  YEYCAENAQEQLIRGYVGLQMKTRILEGCSELMRLAQNPRLENLKRDQIFMYAETQLEIC 723

Query: 709  SWEDSPELFTSS-NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQK 767
             W+   + F     E +P    E ++D +   K     Y + L+ +I      ++L    
Sbjct: 724  FWKRDFDTFNKIFVEGLPITNPE-VMDVTNTLKLPTKLYLKCLVLSINIVGIASNLQIHA 782

Query: 768  KCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQ 827
                 A+  +K+ +K+ +++LK + +LD   +  VL  L ++++N+I IYT +G+++   
Sbjct: 783  GNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIYTQLGVSRDCD 842

Query: 828  YYCKEVTKLLPVFDQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDII 887
            +Y  E  ++      P+ +         +Y        A    + AN +F+ L+   +  
Sbjct: 843  FYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIFNQLDGSENFD 902

Query: 888  NTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYS--NMNFFN 945
            +   FL  N E++K+  SLRL+F    +++     W L LG   +      +   ++  N
Sbjct: 903  DLALFLLNNGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHEDATLRRLSGIN 962

Query: 946  KIVHINQRLVLEIDADPFLKSLNETILANLNCVSPG------SLSNILDVGMIXXXXXXX 999
            +   + +++  ++D D F  S+ E++    +CV P         +++ + G         
Sbjct: 963  EGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEFGTPTKNKGIP 1022

Query: 1000 XXXMTPKRRPTSFKTNKHIVMDILDEFFTTFNAMRQELTERNVILKVSDIYRLNY----- 1054
               +   R P+S           L + F    A+    T + ++  +S     NY     
Sbjct: 1023 FTNLNSPR-PSSLTPRGKS----LKQKFDRAKALNDLETVKRLVGSLSTDGMKNYEIVEA 1077

Query: 1055 -------FYLISLLSVPESRKQLIEETITQLNELPSEITHTYESLLADKNCDIYGKTI-- 1105
                     L+S ++        IE+ +T L ELP      ++ +L+ +  +IYG  I  
Sbjct: 1078 SDLYSLVLSLLSSITTSRLSSSAIEQMLT-LAELPKMRPLHFDKILSSQGNEIYGSFIPL 1136

Query: 1106 ------FELESSNYEIMKSK-NVTLNWEEQIGKDRLLDLCNITVEVICIDICKLTNTLII 1158
                    +++   +I++++ +++ N +  +              V+CID+C +T  LI+
Sbjct: 1137 QVDCKRISIDNQLQDIVRNQTDMSFNSDPHL------------FNVVCIDVCGITGDLIL 1184

Query: 1159 RRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDSNESVSKNVTETIKD 1218
             R  +  +K +  ++P+ R  SRD+D  +L+F  A E L+ II +SN + S +VT  I  
Sbjct: 1185 TRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINT 1244

Query: 1219 KNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDKDALLEFQSKITAILNQ 1278
            K+D + WW+RRYDLD  L NLI +IE +W +G          ++  L  F+ K+  IL +
Sbjct: 1245 KDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQE 1304

Query: 1279 ILPSRRNCCNRANFLQLDEWIIXXXXXXXXXXXGFFTALEDVIYFILDTLSHKGEENAYD 1338
             LP+R+   N ANF ++D+ ++            F   +ED+I+F+ D L   GEENAYD
Sbjct: 1305 SLPTRKQFGNPANFFRIDDVVLDLFLKLDPSDSDFMEMMEDLIFFVFDLLLFHGEENAYD 1364

Query: 1339 EIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTFPWEIMKPLKGRSVTRVPX 1398
            EID  ++H+ +EE I++ R       K+ HTFLVV  + H  PWE ++ L   S++R+P 
Sbjct: 1365 EIDVNMIHIQIEEFIKEFRTTVPPPPKLAHTFLVVCSAGHLMPWESLEFLAKNSISRIPS 1424

Query: 1399 XXXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTEKTFKDIFERIQDSRAGSRLLV 1458
                       +  +   +E   +IS+ILN + DLVRT+  F   FE       GSRL+V
Sbjct: 1425 TQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGSRLIV 1484

Query: 1459 NQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPPVFLMGCSSAATKLNGN 1518
             +KP E+ +++ LT +K F+YVGHGGGEQ+VR   I++ + + P FL+GCSSA  +  G 
Sbjct: 1485 GEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQNFGK 1544

Query: 1519 LNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCNLLDAKPNTVITGVPQAVA 1578
            L P+ +A SY+ G S MV+GNLWDVTDKDIDKFS  M EK  L+  +  T    V  AVA
Sbjct: 1545 LEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLVREEEETYT--VSDAVA 1602

>KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation singleton, hypothetical start
          Length = 1591

 Score =  371 bits (953), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 260/894 (29%), Positives = 433/894 (48%), Gaps = 40/894 (4%)

Query: 697  IYNHLIMSLLYASWEDSPELFTSSNERVPKDI---KEHILDFSTNDKSNLNKYFQKLIFN 753
            ++  L + L    W+   E F   N+ +  D+   + ++ D     K  + +Y + L+ N
Sbjct: 658  LHTTLCILLTQVLWKKDIETF---NKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLN 714

Query: 754  IKFANYYASL-LNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSN 812
            IK     + L L+Q   Y  +++  K+ LKI + ++K    L    R  V++ L   +  
Sbjct: 715  IKITRCASILQLSQNNVY-MSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQR 773

Query: 813  LIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFEFYLENGDYDSALTHKKN 872
            +I IY   G+ K   ++  E  +++   D P  LF++   L  +Y    + ++A      
Sbjct: 774  IISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTK 833

Query: 873  ANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICD 932
             N  FD ++   +I    +FLY N+E +K+  S+RL+FG D+  +D    W L+    C 
Sbjct: 834  MNAAFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLR---SCQ 890

Query: 933  ECPTQYSNMNFFNKIVHINQRLVL-----EIDADPFLKSLNETILANLNCVSPGSLSNIL 987
            +  T+ +  +F   +   N +++      ++  D F +S+ E+++A   C    S+S   
Sbjct: 891  KTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDG 950

Query: 988  DVGMIXXXXXXXXXXMTPKRRPTSFKTNKHIVMDILDEFFTTFNAMRQELTERNV----- 1042
                +          +    RP+S       +    D   T  N +  ++T+R +     
Sbjct: 951  RHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRS-TAINNL--QMTDRFIQNADI 1007

Query: 1043 -ILKVSDIYRLNYFYLISL-LSVPESRKQLIEETITQ---LNELPSEITHTYESLLADKN 1097
              LK  +I  L   + ++L L    S K  +E  + Q   L + P  ++  YE   +D  
Sbjct: 1008 KALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMG 1067

Query: 1098 CDIYGKTIFELESSNYEIMKSKNVTL-NWEEQIGKDRLLDLCNITVEVICIDICKLTNTL 1156
             +IY   I E  ++    M   N+ L     + GK       +++  V+ IDIC+LT  L
Sbjct: 1068 TEIYDSFIPETIATESVEMSECNMNLATIHSEFGKK----WSHLSFNVVEIDICQLTGDL 1123

Query: 1157 IIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDSNESVSKNVTETI 1216
            +I R   + +K++  ++P++R+ SRDL  + L F+ A + L  II+ +N + S  VT  I
Sbjct: 1124 LITRFDTVRNKHLHLRLPLNRHNSRDLSEEVLGFEAALDELNHIISSNNCTTSIEVTSVI 1183

Query: 1217 KDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDKDALLEFQSKITAIL 1276
              K   +NWW  RY L+  L  L+ +IE +W  G  G+ N    D+     F+    +IL
Sbjct: 1184 TTKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSIL 1243

Query: 1277 NQILPSRRNCCNRANFLQLDEWIIXXXX---XXXXXXXGFFTALEDVIYFILDTLSHKGE 1333
            +  LPSR++     +FLQ+D  +I                 + +ED+IYF+ D L   GE
Sbjct: 1244 HTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGE 1303

Query: 1334 ENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTK-IEHTFLVVGPSCHTFPWEIMKPLKGRS 1392
            +NAYDEID  L+HV  EE +++     K   + ++HTFL++G  CH+ PWE +  LK  S
Sbjct: 1304 QNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSIS 1363

Query: 1393 VTRVPXXXXXXXXXXXXKGNLPVKIERTNDISMILNSNSDLVRTEKTFKDIFERIQDSRA 1452
            ++RVP                P  +  + ++S +LN  +DL RTE  F   F  +  SR 
Sbjct: 1364 ISRVPSIKMLDELLTKHSELSPC-VNVSENLSFVLNPGNDLGRTETVFSSEFIAMA-SRT 1421

Query: 1453 GSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPPVFLMGCSSAA 1512
             S+  + + PT +E+   + +S +F+YVGH GGEQYV+   + +C+ L P  L+GCSSA 
Sbjct: 1422 NSKAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAH 1481

Query: 1513 TKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCNLLDAKP 1566
             K  G    +    SY+ G S MV+GNLWDVTDKD DK S+ + EK    ++KP
Sbjct: 1482 LKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKP 1535

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%)

Query: 84  HGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNN 143
           H L+ +  + K+H+  I+ L+  N L  AS  I+ LYN TN      I  +LL D++  N
Sbjct: 87  HQLKKLQELPKKHMNWIIFLMERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGN 146

Query: 144 KEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSK 203
           + YL++LK++ +Q +LK         S+++ FA+D + LL+D  +K + ++KLILN+++ 
Sbjct: 147 ENYLATLKVITMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTL 206

Query: 204 FKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQQLGR 244
              ++ LFGLKF+QY+ QF   +  +IKNM    F +Q+ +
Sbjct: 207 LTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSSTFQRQITK 247

>YDR484W (VPS52) [1300] chr4 (1422751..1424676) Subunit of the VFT
            (Sac2p-Vps53p-Luv1p) complex, involved in protein sorting
            in the late Golgi [1926 bp, 641 aa]
          Length = 641

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 1487 QYVRNCTIERCDKLPPVFLMGCSSAATKLNG-NLNPNCVAESYMYGNSVMVLGNLWDVTD 1545
            +Y+R+ TI +  ++   F +G   + T ++G N +P+    +Y+  ++     N   VTD
Sbjct: 268  RYIRSLTILQFQQIDSQFALGNGLSTTSVSGFNNSPSLFFSNYLTTSASNAFYNKLPVTD 327

Query: 1546 KDIDKFSIEMLEKCNLLDAKPNTVITG 1572
            + IDK+  ++ ++ N+L  + NTV+  
Sbjct: 328  EKIDKY-FQIKKRLNILTQEDNTVMVS 353

>AFR084C [3276] [Homologous to ScYKR026C (GCN3) - SH]
           (579351..580265) [915 bp, 304 aa]
          Length = 304

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 74/175 (42%), Gaps = 35/175 (20%)

Query: 696 DIYNHLIM--SLLYASWE-------DSPELFTSSNERVPKDIKEHILDFSTNDKSNLNKY 746
           DI+   ++  + LY  WE       ++ +LF S  +R    I +  +DF TND   L   
Sbjct: 72  DIFMRFVLRNTHLYGDWESCKQHLVENGQLFVSRAKRSRDKIAKIGVDFITNDYIILVHG 131

Query: 747 FQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKG---------------LKIGKSVLKII 791
           F + +F++   +Y A  L + +C       S +G               + +  +V  II
Sbjct: 132 FSRTVFSL--LSYTAEKLIRFRCVVTEARPSGQGKQLYDLLHAKGIPVTMIVDSAVGSII 189

Query: 792 EKLDLNDRLTVLNQLVSSYS---NLIKIYTAVGLAKGAQ---YYCKEVTKLLPVF 840
            K+   D++ V  + V+      NL+  YT   LAK A+   Y   E  K + +F
Sbjct: 190 HKI---DKVLVGAEGVAESGGIINLVGTYTVGVLAKNARKPFYVVSESHKFVRMF 241

>KLLA0B11517g 1011211..1012734 some similarities with sp|P39925
            Saccharomyces cerevisiae YER017c AFG3 protease of the
            SEC18/CDC48/PAS1 family of ATPases (AAA), hypothetical
            start
          Length = 507

 Score = 33.5 bits (75), Expect = 1.5,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 1158 IRRISNLDSKNIMAKIPIDRNVS--RDLDADS-LTFQQASESLQKIINDSNESVSKNVTE 1214
            I+ I N  S ++ AKIP   N S  R+  ADS L FQ +  + +    D+NE   K+  E
Sbjct: 29   IKTIRNGFSTSLYAKIPDLGNYSNVRNFHADSRLNFQHSGRTFKDQQKDNNEQNKKDENE 88

Query: 1215 TIKDKN 1220
              K++N
Sbjct: 89   QKKNQN 94

>CAGL0M00396g 53938..55200 similar to sp|P47168 Saccharomyces
           cerevisiae YJR136c, hypothetical start
          Length = 420

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 16/92 (17%)

Query: 331 KELDEKSILLIQRILSIFQIKCYEISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIES 390
           + L EKS + IQR+  I+ I  Y I  P     DK+I                 I+L+E+
Sbjct: 300 RTLGEKSTIYIQRV--IYDIGQYLIKDPFFTAFDKLIF--------------ETIELVEA 343

Query: 391 MIQFCTTNSLHKTFENTMAVAYNIALKTKNSE 422
           +I +C T  + +   + + +   I  K KN E
Sbjct: 344 IIGYCNTTRVLEHKYDILGIILLIYGKLKNEE 375

>ABL155C [437] [Homologous to ScYDL220C (CDC13) - SH]
           (107861..110461) [2601 bp, 866 aa]
          Length = 866

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 14/121 (11%)

Query: 869 HKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQESL-----RLYFGYDLNDTDFFLSW 923
           +  + +YV    + +H++    + + +N   DK++  L     +L+F    +D+ +   W
Sbjct: 426 YSSDIDYVLQQYDIDHNMDRKEALILLNSRLDKLEVRLSITKAKLFF----SDSTYSFCW 481

Query: 924 KLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDADPFLKSLNETILANLNC--VSPG 981
           +LK   +  E  TQ++++   N +        L ID      S + TI A L C  V PG
Sbjct: 482 ELKALQVNAETLTQFTSIKMPNPLPERGN--ALSIDQLSATTS-SATIFAMLICARVDPG 538

Query: 982 S 982
           S
Sbjct: 539 S 539

>YAL001C (TFC3) [65] chr1 complement(147598..151010,151101..151170)
           RNA polymerase III transcription initiation factor
           TFIIIC (tau), 138 kDa subunit [3483 bp, 1160 aa]
          Length = 1160

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 655 SNDYITYKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSP 714
           SN YI  + H    +++  R+K+   Q  + K E+KFD EK +    I ++   +W D  
Sbjct: 179 SNPYINIRDHLATIVEVVKRSKNGIRQIIDLKRELKFDKEKRLSKAFIAAI---AWLDEK 235

Query: 715 E 715
           E
Sbjct: 236 E 236

>KLLA0F10813g complement(993942..995270) similar to sp|Q9US35
           Schizosaccharomyces pombe Hypothetical 45.6 kDa protein,
           start by similarity
          Length = 442

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 354 EISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENTM-AVAY 412
           E+  P L   + +I   +SN+  L   I  +  L+E  +++      HKT E T+  + +
Sbjct: 33  ELPTPALIMKEPVI---DSNISTLLQSIDSINSLLERPVKYRAHIKTHKTIEGTLKQLGH 89

Query: 413 NIALKTKNSELLLLVSKFEFSRLLLNYKETEKIK 446
           N+          ++VS    + L+L+Y E +K K
Sbjct: 90  NLPEYDGPKYGSIVVSTLREAYLVLDYHEKKKTK 123

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 887 INTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECPTQYSNMNFFNK 946
           +N++    + + Y   Q+   LYF  +      FLS   + G + +EC T+Y      + 
Sbjct: 255 LNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEEC-TKYYGAQILDA 313

Query: 947 IVHINQRLVLEIDADP 962
           I H++++ ++  D  P
Sbjct: 314 IHHLHKQGIIHRDVKP 329

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 722  ERVPKDIKEHILDFSTNDKSNLNKYFQ----KLIFNI 754
            E +P+D K  I++F  NDK  L + FQ    K +FN+
Sbjct: 1012 EYLPQDAKVQIIEFPKNDKRKLRELFQEHDIKAVFNL 1048

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 53,147,487
Number of extensions: 2499019
Number of successful extensions: 9263
Number of sequences better than 10.0: 66
Number of HSP's gapped: 9589
Number of HSP's successfully gapped: 69
Length of query: 1579
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1464
Effective length of database: 12,615,039
Effective search space: 18468417096
Effective search space used: 18468417096
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)