Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G03179g1061104551660.0
YGR097W (ASK10)1146114519400.0
Scas_716.281108107916950.0
YPR115W108386215110.0
Kwal_55.205471014108114061e-178
KLLA0D15081g101099613681e-172
AAR086W80793111481e-142
CAGL0B04213g90076510411e-125
Kwal_23.49586493854715e-49
Scas_671.236863854682e-48
Sklu_2395.67113884673e-48
CAGL0G02827g7494164683e-48
ADL234C7363854631e-47
KLLA0F03839g6483854547e-47
YNL047C6563924502e-46
YIL105C6863854504e-46
CAGL0G01386g5323964113e-42
YKR053C (YSR3)404109850.065
ABL159W58045760.77
KLLA0C14190g59566760.79
Kwal_55.21164588103741.3
Scas_623.1137896703.9
Sklu_2055.436349695.0
KLLA0E16951g82586687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G03179g
         (1045 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces c...  1994   0.0  
YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcrip...   751   0.0  
Scas_716.28                                                           657   0.0  
YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containi...   586   0.0  
Kwal_55.20547                                                         546   e-178
KLLA0D15081g 1271696..1274728 some similarities with sgd|S000631...   531   e-172
AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -...   446   e-142
CAGL0B04213g 412230..414932 some similarities with sp|P48361 Sac...   405   e-125
Kwal_23.4958                                                          186   5e-49
Scas_671.23                                                           184   2e-48
Sklu_2395.6 YIL105C, Contig c2395 8302-10437                          184   3e-48
CAGL0G02827g complement(259569..261818) similar to sp|P40485 Sac...   184   3e-48
ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH] (2...   182   1e-47
KLLA0F03839g complement(363977..365923) similar to sp|P40485 Sac...   179   7e-47
YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protei...   177   2e-46
YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein...   177   4e-46
CAGL0G01386g complement(132280..133878) similar to sp|P40485 Sac...   162   3e-42
YKR053C (YSR3) [3304] chr11 complement(533709..534923) Sphingoid...    37   0.065
ABL159W [433] [Homologous to ScYDL225W (SHS1) - SH] complement(9...    34   0.77 
KLLA0C14190g complement(1227049..1228836) some similarities with...    34   0.79 
Kwal_55.21164                                                          33   1.3  
Scas_623.11                                                            32   3.9  
Sklu_2055.4 YDL055C, Contig c2055 7624-8715 reverse complement         31   5.0  
KLLA0E16951g 1500700..1503177 highly similar to sp|P33416 Saccha...    31   7.3  

>CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces
            cerevisiae YGR097w ASK10 involved in SKN7P-dependent
            transcription, hypothetical start
          Length = 1061

 Score = 1994 bits (5166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 978/1045 (93%), Positives = 978/1045 (93%)

Query: 1    MSEPYDQYDESNPNAIPFPXXXXXXXXXXXXXXXATPGYLTPQSRTPSYAALNDDAVSIK 60
            MSEPYDQYDESNPNAIPFP               ATPGYLTPQSRTPSYAALNDDAVSIK
Sbjct: 1    MSEPYDQYDESNPNAIPFPSGSTSGYSTRSTSISATPGYLTPQSRTPSYAALNDDAVSIK 60

Query: 61   SSDYLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYFXXXXXXXXXXXXXXDNGDK 120
            SSDYLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYF              DNGDK
Sbjct: 61   SSDYLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYFVGVPVPVIAASAVVDNGDK 120

Query: 121  SLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFA 180
            SLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFA
Sbjct: 121  SLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFA 180

Query: 181  RINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLP 240
            RINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLP
Sbjct: 181  RINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLP 240

Query: 241  PVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTV 300
            PVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTV
Sbjct: 241  PVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTV 300

Query: 301  IPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQ 360
            IPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQ
Sbjct: 301  IPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQ 360

Query: 361  NKLKPKHDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYS 420
            NKLKPKHDPY           RQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYS
Sbjct: 361  NKLKPKHDPYLLKLQLDLQLKRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYS 420

Query: 421  TLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAV 480
            TLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAV
Sbjct: 421  TLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAV 480

Query: 481  IYPNMKSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYKPKKGAP 540
            IYPNMKSPMSKCIRAGYFMM               YFILTSTYIHQFSSSDFYKPKKGAP
Sbjct: 481  IYPNMKSPMSKCIRAGYFMMKSESKSSKSNNFQKSYFILTSTYIHQFSSSDFYKPKKGAP 540

Query: 541  NQQNSIQFQFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASI 600
            NQQNSIQFQFQP            TRKVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASI
Sbjct: 541  NQQNSIQFQFQPNIYHNYNNNSINTRKVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASI 600

Query: 601  PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY 660
            PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY
Sbjct: 601  PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY 660

Query: 661  GQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTF 720
            GQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTF
Sbjct: 661  GQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTF 720

Query: 721  KMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSN 780
            KMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSN
Sbjct: 721  KMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSN 780

Query: 781  QNSTSNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLITFGQRHSVVSPHYSNNS 840
            QNSTSNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLITFGQRHSVVSPHYSNNS
Sbjct: 781  QNSTSNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLITFGQRHSVVSPHYSNNS 840

Query: 841  DNSYRQSYRPTNSLPGSRNLSPLPVNSPTSVNSEGSGGGYFAIPVNKQMSHPGSNVQVSE 900
            DNSYRQSYRPTNSLPGSRNLSPLPVNSPTSVNSEGSGGGYFAIPVNKQMSHPGSNVQVSE
Sbjct: 841  DNSYRQSYRPTNSLPGSRNLSPLPVNSPTSVNSEGSGGGYFAIPVNKQMSHPGSNVQVSE 900

Query: 901  FGSRSNVNTAGSSPNITGMGYFVPVQSTGVVPKVKVNNEEMGQNSPQPPASPYNSLRKNI 960
            FGSRSNVNTAGSSPNITGMGYFVPVQSTGVVPKVKVNNEEMGQNSPQPPASPYNSLRKNI
Sbjct: 901  FGSRSNVNTAGSSPNITGMGYFVPVQSTGVVPKVKVNNEEMGQNSPQPPASPYNSLRKNI 960

Query: 961  STGSIPTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMF 1020
            STGSIPTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMF
Sbjct: 961  STGSIPTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMF 1020

Query: 1021 SKKGSVGYGGQPINGISENSDNEDE 1045
            SKKGSVGYGGQPINGISENSDNEDE
Sbjct: 1021 SKKGSVGYGGQPINGISENSDNEDE 1045

>YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcription
            factor involved in Skn7p-mediated two-component
            regulatory system [3441 bp, 1146 aa]
          Length = 1146

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1145 (43%), Positives = 631/1145 (55%), Gaps = 198/1145 (17%)

Query: 40   LTPQSRTPSYAALNDDAVSI--KSSDYLMDMVPDSMTLKDGAS--ISTAKRKEFILPETD 95
            LTP    PS     DDA SI  KSS YLMD++PDSMTL +  S  ++  + KEFILPETD
Sbjct: 13   LTPMGNKPSGGGGGDDASSIHSKSSQYLMDILPDSMTLNESVSSIVANNQAKEFILPETD 72

Query: 96   ERSPYFXXXXXXXXXXXXXXDNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRF 155
            ERSPYF                       +T +K  +   E  DGQFV+EYPTD+L+DRF
Sbjct: 73   ERSPYFINVPIPKAQPTS-----------TTETKKPLAGDEAIDGQFVKEYPTDILVDRF 121

Query: 156  YKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKK 215
            YKWKKILK ++ YLREVAYAQEQFARIN QL+ SVKFPFLTD+ E +N I DP + AP+ 
Sbjct: 122  YKWKKILKGLVIYLREVAYAQEQFARINYQLKGSVKFPFLTDIDETTNTITDPFTTAPRG 181

Query: 216  NAPTTMAQKR---------KQKEEEQNAPNVDLPPVDPSE------QFMPVQAT--DNTS 258
                  AQK+         + + +++   N    P D S+      ++ PVQ T  DNTS
Sbjct: 182  PKKAQPAQKKVGLTDSEQFQMQMQQEQQENAVQAPTDESKMSLAPHEYKPVQTTESDNTS 241

Query: 259  ASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEI 318
            A+SGF++FGSGSIQDIQVILKKYH+SLANQQFKISKEI STVIPKLEE++KDL +KI EI
Sbjct: 242  AASGFVKFGSGSIQDIQVILKKYHLSLANQQFKISKEITSTVIPKLEELRKDLRYKITEI 301

Query: 319  KELNGDFKTNINYHIKMTGILLKKYIAACRFV-------DRNNYLQDVQNKLKPKHDPYX 371
            K+L+GDFKTNI  HI++T  LLKKYIAA +F+       DR +      +KL PKHDPY 
Sbjct: 302  KDLHGDFKTNIGAHIQLTSQLLKKYIAAVKFMNAHGIGNDRASPTNKKPHKLDPKHDPYL 361

Query: 372  XXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMI 431
                      RQ+AEE YLQEAF+NLQSSGLQLEKIIY++IQH L RYS LIDSEARLMI
Sbjct: 362  LKLQLDLQLKRQVAEETYLQEAFINLQSSGLQLEKIIYTKIQHALLRYSALIDSEARLMI 421

Query: 432  KNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSK 491
            KN+CQELQ+GI++KPPA EWDNFV+ HP CLLNWKSNDP+P PR  S VIYP+MKSP++K
Sbjct: 422  KNMCQELQHGIISKPPAFEWDNFVTQHPSCLLNWKSNDPIPPPRKVSDVIYPHMKSPLAK 481

Query: 492  CIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYKPKKGAPN--------QQ 543
            CI+AGYF+                YF+LTS YIH+F SSDFY      PN          
Sbjct: 482  CIKAGYFL----KKSELLPTYHQGYFVLTSNYIHEFQSSDFYNLSSSTPNSTKSSAYSSS 537

Query: 544  NSIQFQFQPXXXXXXXXXXXXTRKV---SGNVNAVSGHNGVTVENSPFSRHSEVIPIASI 600
             SI   +                 V   S      +G NG+        + S + PI SI
Sbjct: 538  VSIADTYANANNAKANNHHRQASDVHNSSTTTGGTAGANGI----RGIRKKSYLAPIMSI 593

Query: 601  PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY 660
            PL++C L ++S   FV+ GK   + N         V KS +    +  S   AS+P  KY
Sbjct: 594  PLNDCTLKDASSTKFVLVGKPTLNEN-------ADVRKSSSSTYLSGSSQ--ASLP--KY 642

Query: 661  GQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSK--SGLEKDANKVVTNKVYTTEQVKW 718
            G + + K+  K    K +KG+K K   T++S+  +  +  +K++N  VT          W
Sbjct: 643  GHETA-KIFSKAPFHKFLKGSKPKNKNTKSSELDQFYAAAQKESNNYVT----------W 691

Query: 719  TFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQ------------ 766
            TFK+V+ +P+E+E+K+F +W+ D+KNLT F   K+R  FIEDR+MKS             
Sbjct: 692  TFKIVSPEPSEEELKHFKRWVQDLKNLTSFNDTKDRIKFIEDRVMKSHRFKAGHMSRNSV 751

Query: 767  ---------TKSQMSVAEEGRSNQNSTSNFAGKPTYISLGVDSKSTFTPDG--SVMNTPA 815
                     T S  ++ ++G +   +    A KP YI +  +S + F  +G  S +NTPA
Sbjct: 752  NIGSHTPCLTDSTFTL-QDGTTTSVNLKGRAEKPQYIHIQNNSLADFDGNGFRSKVNTPA 810

Query: 816  IDDNGNLITFGQRHSVVSPH-------YSNNSDNSYRQSYRP------------------ 850
            IDD GNLIT  +R    SPH        S N+  SY    RP                  
Sbjct: 811  IDDYGNLITV-ERRPAQSPHQYSDYMATSGNTTPSYSSGSRPQSMYNGYNPAVSITSNGM 869

Query: 851  -------------------------TNSLPG-SRNLSPLPVNSPTSVNSEGSGGGYFAIP 884
                                     T+SLPG S     LPVNSP S NSE S GGYFAIP
Sbjct: 870  MLQQSTANNNTNPTTNLRHQRNISQTSSLPGFSYTSLSLPVNSPGSSNSESSSGGYFAIP 929

Query: 885  V------------NKQMSHPGSN-----VQVSEFGSRSNVNTAGSSPNITGMGYFVPVQS 927
            +            N + S P  N      Q      +    T+ SS N+T M       S
Sbjct: 930  LHGNNNNNNYTQRNSEGSSPCYNDDQIRQQQQPLQMQPLSRTSSSSVNVTAMRSTSAGNS 989

Query: 928  TG----VVPKVKVNNE-------EMGQNSPQPPA-----------SPYNSLRKNISTGSI 965
                  VVPKV VNN+       +    +P  P            SPY +L+K  STG++
Sbjct: 990  ITANAPVVPKVMVNNQNVKTVAADQSATAPSSPTMNSSVTTINRESPYQTLKKTNSTGNV 1049

Query: 966  PTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMFSKKGS 1025
            P L  E +      + + NNS+ NL  +++  +RV  +RKHKKNVSFSSLNSLMFSKKG+
Sbjct: 1050 PCLTAEKTHAHPAFYKRGNNSAQNLTTSSSTASRVHPIRKHKKNVSFSSLNSLMFSKKGA 1109

Query: 1026 VGYGG 1030
              +GG
Sbjct: 1110 -NHGG 1113

>Scas_716.28
          Length = 1108

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1079 (39%), Positives = 589/1079 (54%), Gaps = 222/1079 (20%)

Query: 90   ILPETDERSPYFXXXXXXXXXXXXXXDNGDKSLEKSTRSKTVIGDTEGYDGQ-FVREYPT 148
            +L + DERSP +               +    L+    S    GD E  + Q +VREYPT
Sbjct: 78   LLGKNDERSPLYVDVPIPKALPKQEQQD----LQNRDGSAATKGDIELEENQQYVREYPT 133

Query: 149  DMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDP 208
            D++ DRF+KWKKILK++IAYLREVAYAQEQF RINNQL+ +VKF FLTD+ EGSNK+++P
Sbjct: 134  DIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEP 193

Query: 209  LSQ-AP-KKNAPTTMAQKRKQKEEE-----------------------------QNAPNV 237
            ++  AP K+  P T+A+K+KQ E E                             Q+ P  
Sbjct: 194  MTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKSQSQFPPQAPLQSQQSQPLN 253

Query: 238  DLPPVDPSEQFM----PVQA--TDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFK 291
             +P  D S   +    P+Q   +D+TSA+SGF++FGSGSIQDIQVILKKYH+S+ANQQFK
Sbjct: 254  QMPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFK 313

Query: 292  ISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVD 351
            +SKEI + +IPKLEE++KDL  KI+EIK+++GDFK+NI++H+K+T  LL KY  + R + 
Sbjct: 314  VSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIM- 372

Query: 352  RNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSR 411
              N+     ++ +PKHDPY           RQ++EENYL++A+VNLQSSG+QLEKIIYS+
Sbjct: 373  --NHQSHSHHEFQPKHDPYLLKLQLDLQLKRQLSEENYLKDAYVNLQSSGMQLEKIIYSK 430

Query: 412  IQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPV 471
            IQ+VLQRY+TLID+E RLMIKNLC ELQ GIL++PPA EWD+FVSHHP CLLNWKS DPV
Sbjct: 431  IQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPV 490

Query: 472  PVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSD 531
            P PR  S ++Y NMKSP++KCIRAGYF+                YF+LTS Y+H+F +S+
Sbjct: 491  PQPRKVSEIVYSNMKSPLAKCIRAGYFL----------KNGSKGYFVLTSNYLHEFKTSN 540

Query: 532  FYKPKKGAPNQQNSIQFQFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRH 591
            F+       NQQ+S                    +K       +S  NG+T         
Sbjct: 541  FF-------NQQSS---------TLQAPASDPMGKK-------ISTLNGLT--------- 568

Query: 592  SEVIPIASIPLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNP 651
                PI SI L+EC+L+E+ +  F IEG                V+       +N +S P
Sbjct: 569  ----PINSISLNECKLIETGENHFTIEGT---------------VFHGPVTTTANQLS-P 608

Query: 652  LASIPGAKYGQDAS-TKVLHKTKLSKLVKGAKAKT-LGTETSKHSKSGLEKDANKVVTNK 709
              S   A    +A+  K  H   L K  K AK KT + T T+           + V  NK
Sbjct: 609  STSKTSASMSLNATHHKKYHLPNLLKSKKDAKPKTKVPTATT--------SSGSTVANNK 660

Query: 710  VYTTEQVKWTFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKS 769
                 +VKWTFK  ++  +E++ K+F KW+ D+K+LT ++  K+R  FIEDRLMK+  +S
Sbjct: 661  TSIESKVKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRS 720

Query: 770  QM------SVAEEGRSNQNSTSNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLI 823
            +       S   + + +  STS   GKP YI +   + + ++   S +NTPAIDDNGNLI
Sbjct: 721  KSVGIIPGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLI 780

Query: 824  TFGQRH----------SVVSPHYSNNSDNS------------------------------ 843
            T  +R            +VSP YS+ S +S                              
Sbjct: 781  TLTERKYAPTLSMTPSPMVSPMYSDKSASSSNPPPPQQQHQPTNIASTSNGIIQPVMTSR 840

Query: 844  --------------------YRQSYRPTNSLPG-SRNLSPLPVNSPTSVNSEGSGGGYFA 882
                                +++    TNSL    +  S L V+SP S+NS+GS GGYFA
Sbjct: 841  NGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFA 900

Query: 883  IPV--NKQMSHPGSNVQVSEFGSRSNV-------------NTAGSSPNITGMGYFVPVQS 927
            IPV  N+   +  +N ++ +  SR +               ++  +P ++       +Q+
Sbjct: 901  IPVRNNQTAYNTAANAKIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQT 960

Query: 928  TGVVPKVKV-NNEEMGQNSPQP------------PASPYNSLRKNISTGSIPTLNNEGS- 973
               VPKV + NN+E+G+N   P            P  P  +L+K  STGS P ++ + S 
Sbjct: 961  VNTVPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPTMP--ALKKITSTGSAPLMHADSSP 1018

Query: 974  -----RPESGNFYKNNNSSTNLVAAANG--TARVQAVRKHKKNVSFSSLNSLMFSKKGS 1025
                  P +   Y+ +NSST  +   +   T RV  +RKHKKNVSFSSLNSLMFSKKGS
Sbjct: 1019 NLSTTMPHASQLYQRSNSSTQSLTTPSQLVTQRVHPIRKHKKNVSFSSLNSLMFSKKGS 1077

>YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containing
           a pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to S. cerevisiae Ask10p, which may
           be a transcription factor in the S. cerevisiae
           Skn7p-mediated regulatory system [3252 bp, 1083 aa]
          Length = 1083

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/862 (41%), Positives = 494/862 (57%), Gaps = 119/862 (13%)

Query: 35  ATPGYLTPQSRT-------PSYAALNDDAVSIKSSD--YLMDMVPDSMTLK--------- 76
           ATPG     SR         S+   +D+  S+ S+D  YLMDM+PDS+TLK         
Sbjct: 20  ATPGSTRSSSRNLELPKNYRSFGGSSDELASMYSADSQYLMDMIPDSLTLKNEPASGNTQ 79

Query: 77  ----DGASISTAKRKEFILPETDERSPYFXXXXXXXXXXXXXXDNGDKSLEKSTRSKTVI 132
               DG      K  E+ILP+TD RSPY+              +   ++ +K  R+    
Sbjct: 80  MNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKS--EGKARAKQKVNRADPSD 137

Query: 133 GDTEGY---DGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNS 189
            D E      G+FVREYPTD+LIDRF+KWKKILKS+IAY RE AY+QEQ ARIN Q++N+
Sbjct: 138 LDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNA 197

Query: 190 VKFPFLTDLTEGSNKIIDP-LSQAP-KKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQ 247
           VKF FLTDL + +NK++DP +S+ P KK  P  +A    QK + +   +V+ P     + 
Sbjct: 198 VKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAA---QKLDSKYDTDVEQP-----QS 249

Query: 248 FMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEI 307
              V + +  SASSGF++FGSGSIQDIQVILKKYH+SL +QQ+KISKEI++ +IPKL ++
Sbjct: 250 IQSVPSEEVASASSGFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDL 309

Query: 308 KKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQN-KLKPK 366
           +KDL+ K+KEIKELNGDFKTNI  HIK+T  LL KYIA+ + +D  +   D Q  KLKPK
Sbjct: 310 RKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPK 369

Query: 367 HDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSE 426
           HDPY           RQ+ EENYL+EAF+NLQS+ LQLEKI+YS+IQ  LQRYS LIDSE
Sbjct: 370 HDPYLLKLQLDLQLKRQLLEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSE 429

Query: 427 ARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMK 486
           ARLMIKNLC ELQ GIL++PPA+EWDNFVSHHP CL+N KS DP P PR  S ++YPNMK
Sbjct: 430 ARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMK 489

Query: 487 SPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYKPKKGAPNQQNSI 546
           SP++KCIR GY +                YF+LT+ Y+H+F SSDF+   K   ++   +
Sbjct: 490 SPLAKCIRVGYLL----KKTESSKSFTKGYFVLTTNYLHEFKSSDFFLDSKSPRSKNKPV 545

Query: 547 QFQFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRH------SEVIPIASI 600
             Q               +R      NA S  +    ++   ++       S + PI+S+
Sbjct: 546 VEQ------------SDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKGLSSSNLYPISSL 593

Query: 601 PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY 660
            L++C L +S+D+ FV++G A Y +      P+    K    + ++ ++ P  ++     
Sbjct: 594 SLNDCSLKDSTDSTFVLQGYASYHS------PEDTCTKE--SSTTSDLACPTKTL----- 640

Query: 661 GQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTF 720
              AS K  H+   S L   +  K L + +    +   +++AN  +  K    ++V+WTF
Sbjct: 641 ---ASNKGKHQRTPSALSMVSVPKFLKSSSVPKEQKKAKEEAN--INKKSICEKRVEWTF 695

Query: 721 KMVAE--KPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGR 778
           K+ +   +PT +E K F KW+ DIK LT F   +ER NFIE++++KS+  +       G+
Sbjct: 696 KIFSASLEPTPEESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKSRNHNN------GK 749

Query: 779 SNQNS-----------------------------TSNFAGKPTYI----SLGVDSKSTFT 805
           S+Q S                             T   A +P YI    S  +++ +  +
Sbjct: 750 SSQRSKNSTYITPVDSFVNLSEKVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNS 809

Query: 806 PDGSVMNTPAIDDNGNLITFGQ 827
              S +NTPAID+NGNL   G+
Sbjct: 810 VYRSKVNTPAIDENGNLAIVGE 831

>Kwal_55.20547
          Length = 1014

 Score =  546 bits (1406), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 386/1081 (35%), Positives = 540/1081 (49%), Gaps = 236/1081 (21%)

Query: 54   DDAVSIKSSD--YLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYFXXXXXXXXXX 111
            DDA S+ SSD  YLM++               +   E ILP+TD  SPY+          
Sbjct: 23   DDASSLFSSDSGYLMELA------------DASDDDETILPKTDFHSPYYVNVPTP---- 66

Query: 112  XXXXDNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLRE 171
                     S    T   + +       G FVREYPTD+L+DRF KW+KILK +  YLRE
Sbjct: 67   ---------SQSALTSDYSELSQDAAAAG-FVREYPTDILLDRFTKWRKILKGLANYLRE 116

Query: 172  VAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKK--NAPTT----MAQKR 225
            VAYAQE+FARIN  LR +VKF FLTDL E +N++IDP  Q  KK  NA +T       K 
Sbjct: 117  VAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPGNAASTSNLNTGLKS 176

Query: 226  KQKEEEQNAPNVDLPPVDPSEQF----MPVQATDNTSASSGFLRFGSGSIQDIQVILKKY 281
                +++N  N           F    +P+   DN SASSGF++FGSGSI+DIQV+LKKY
Sbjct: 177  PPAVDDENLTNSSTLQSSSQSAFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKY 236

Query: 282  HVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLK 341
            H S+ NQQ K+SKE+ + V+PKL++++KDL  KIKEIKEL+GDF+TNI  HI +TG LL+
Sbjct: 237  HTSMGNQQIKMSKELNTVVVPKLDDLRKDLQLKIKEIKELHGDFRTNIGEHIALTGQLLQ 296

Query: 342  KYIAACRFVDRNNYLQDV----QNKLKPKHDPYXXXXXXXXXXXRQIAEENYLQEAFVNL 397
            KY+AA +F+  N+  Q++      KLKPKHDPY           RQ+ EENYLQEA++NL
Sbjct: 297  KYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYLLKLQLDLQLKRQLLEENYLQEAYINL 356

Query: 398  QSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSH 457
            QSSGL+LEKIIY  +QH LQRYS LI + AR+ I NLC EL  G+L+KPPA+EWD+FV H
Sbjct: 357  QSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGH 416

Query: 458  HPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYF 517
            HP CL+NWKS +P+P PR  S + YP MKS ++KCI+AGY                  YF
Sbjct: 417  HPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL----SKKSQILKNYNKGYF 472

Query: 518  ILTSTYIHQFSSSDFYKPKKGAPNQQNSIQFQFQPXXXXXXXXXXXXTRKVSGNVNAVSG 577
            +LTS Y+H+F SS+F+K      +Q NS                    +K  G V     
Sbjct: 473  VLTSNYLHEFKSSNFFK-----LSQDNS-------------------EKKDHGEVQT--- 505

Query: 578  HNGVTVENSPFSRHSEVIPIASIPLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVY 637
                       S+   ++P+ S+ L+  +LVE+S++ F I G A  SN           +
Sbjct: 506  ----------GSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIATSSN-----------F 544

Query: 638  KSMAHAGSNTISNPLASIPGAKYGQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSG 697
            +  +      IS   +SI           K L  +  +   K          +S      
Sbjct: 545  ERKSAETGKMISKSTSSI----------QKFLKSSGKNPHKKDNHHNHHAPGSSGSVSGP 594

Query: 698  LEKDANKVVTNKVYTTEQVKWTFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNF 757
            + +D    V+  V+         K V+ KP  ++ K   KWI ++++L+ F+   +R  F
Sbjct: 595  VVQDVADDVSTWVF---------KPVSSKP--EDAKDLKKWIAEVRHLSNFDTSADRAKF 643

Query: 758  IEDRLMKSQTK----------SQMSVAEEGRSNQNSTSNFAGKPTYISLGVDSKSTFTPD 807
            IE++++++ ++          S  S  ++ +   N T     KP +I LG       T  
Sbjct: 644  IEEKILRAHSRASSMNLAKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPTSA 703

Query: 808  GSVMNTPAIDDNGNLITFGQRH-SVVSPHYSNNSDNSYRQSYRPT-NSLPGSRNLS-PLP 864
             + +NTPAIDDNGNLIT G+RH S+ SP   ++   S  QS        PGS + + P P
Sbjct: 704  RAKINTPAIDDNGNLITAGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVPSP 763

Query: 865  VN------------------SPTS----------------------VNSEGSGG------ 878
            VN                  +PT+                      +NS GS        
Sbjct: 764  VNPQGFVITSNGMTPINRTPAPTAKRVPSGIILSSGASSDGSGSLPMNSPGSASMAINSP 823

Query: 879  ----------GYFAIPVN--KQMSHPGSNVQVSEFGSRSNVNTAGSSPNITGMGYFVPVQ 926
                      GYFAIPV+   Q S PG                 G++P+ +        Q
Sbjct: 824  SSHVSGSSGGGYFAIPVHASSQASTPG-----------------GANPDSSA----AQAQ 862

Query: 927  STG-VVPKVKVNNEEMGQNSP-----------QPPASPYNS-----------LRKNISTG 963
            +TG VVP+V++N++++  + P           +P A+  +            +RK+++ G
Sbjct: 863  ATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATKVSEGAPLSRGAPVHIRKSVNAG 922

Query: 964  SIPTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMFSKK 1023
                   E       N  ++N++ T  +A+ N     Q +RKHKKNVSF SLNSL+FSKK
Sbjct: 923  GTGMTIAEPPHSVYANPKQSNSAQT--LASTNA----QPIRKHKKNVSFGSLNSLLFSKK 976

Query: 1024 G 1024
            G
Sbjct: 977  G 977

>KLLA0D15081g 1271696..1274728 some similarities with sgd|S0006319
            Saccharomyces cerevisiae YPR115w, hypothetical start
          Length = 1010

 Score =  531 bits (1368), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 383/996 (38%), Positives = 525/996 (52%), Gaps = 185/996 (18%)

Query: 133  GDTEGYD------GQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQL 186
            G  EG D        FVREYPTD+L DRF+KW+KILK++I YLREVAY+QEQFARIN  L
Sbjct: 103  GKAEGLDLYDDGTASFVREYPTDILADRFHKWRKILKAMIIYLREVAYSQEQFARINYSL 162

Query: 187  RNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEE------QNAPNVDLP 240
            +NSVKF FLTDL E +N++ DPL++   +  P  M Q +   +E+       NA  ++  
Sbjct: 163  KNSVKFSFLTDLDESTNRVSDPLTKNLPQKKPQPMTQMKSPFDEKPDPFAASNASTLNNS 222

Query: 241  PVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTV 300
             +D  ++   ++  D+ S + GF+ FGSGSIQDIQVILKKYH+SLA+QQ K SKEI   +
Sbjct: 223  SIDLGQELQ-LEPNDSCSGA-GFMNFGSGSIQDIQVILKKYHLSLASQQVKSSKEITLQI 280

Query: 301  IPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDV- 359
            IPKLE+++KDLS KIKEIKELN DFKTNI  H+ +TG LL KYIAA  F++ N    D+ 
Sbjct: 281  IPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALTGQLLHKYIAAVNFLNDNASRSDLI 340

Query: 360  ----QNKLKPKHDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHV 415
                 + LK KHDPY           RQ+ EENYLQEA++NLQSSG++LEKII+S IQ  
Sbjct: 341  KLKRNSSLKSKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQSSGMELEKIIFSTIQKT 400

Query: 416  LQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPR 475
            LQ++S +ID +AR  I NLC+ELQ GIL+KPP +EWDNFVSHHP CLLNWKS DP+P PR
Sbjct: 401  LQKFSAIIDVQARTSINNLCRELQRGILSKPPCVEWDNFVSHHPRCLLNWKSTDPIPQPR 460

Query: 476  NASAVIYPNMKSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYK- 534
              S + YP MKS ++KCIRAGY +                YF+LTS Y+H+F SS+F+K 
Sbjct: 461  KLSDIRYPKMKSSLAKCIRAGYLL----KKSKYLKQYNKGYFVLTSNYLHEFKSSNFFKL 516

Query: 535  PKKGAPNQQNSIQFQFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRHSEV 594
             +    N +++I                             SG+ G +           +
Sbjct: 517  TQDTGENSEHAII--------------------------PSSGNKGRS-----------I 539

Query: 595  IPIASIPLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLAS 654
            IPI SI L+E  L+E  D  F I  K+ Y                M  + S +ISN L  
Sbjct: 540  IPIMSISLNESELLEIEDK-FTINCKSTY---------------IMEESASESISNDLKK 583

Query: 655  IPGAKYGQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKS-----GLEKDANKVVTNK 709
            I      +  ST       +SKL K          + KH K+     G   D+ +VV+  
Sbjct: 584  I-----SKSTST-------ISKLFKPG--------SGKHGKNNNLAMGSSNDS-RVVSGG 622

Query: 710  VYTTEQVKWTFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKS 769
              T +    TFK    +P + +VK F KW  ++K+LTKF    +R  +IE++++K+  K 
Sbjct: 623  DDTVKFTSITFK----RPADVDVKEFKKWTNNLKDLTKFHNTLDRARYIEEKILKAHNKF 678

Query: 770  QMSVAEEGRSNQNST----------SNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDN 819
              S    G+S    T          SN   +P YI L   S+       S +NTPAIDDN
Sbjct: 679  ASSTLSLGQSKSEPTSSLHLSSQSSSNLQQRPHYIQLPSVSQVNLR---SKVNTPAIDDN 735

Query: 820  GNLITFGQRHSVVSPHYSNNSDNSYRQSYRPTNSLPGSRNLSPLPV--NSPTSVNSEGSG 877
            GNLI   +R   ++P           ++  P   LP S  +SP     N  +S +++ S 
Sbjct: 736  GNLIFATERPKSLAPTI---------EARPPPTELP-SHQVSPTSFISNDGSSGSNKTSN 785

Query: 878  GGYF-----AIPVNK----------------QMSHPGS--NVQVSEFGSRSNVNTAGSSP 914
             GY        PV+                   +H G+  N  +S      NV +A ++ 
Sbjct: 786  MGYVITSNGMTPVHHLTPLTHVRTTSGDAGNTTNHTGAEFNFFMSPKDISGNVTSASNTS 845

Query: 915  NITGMGYF-VPVQSTG--------------VVPKVKVNNEEMGQ--------NSPQPPAS 951
            + +G GYF +PV+ST                +PK+ +N  E           ++P+   S
Sbjct: 846  SGSGGGYFAIPVKSTSQHSTPTGEGSRTPNAIPKIHINELEAPHPAKVIPLNHTPETSTS 905

Query: 952  ---PYNSLRKNISTGSIPTLNN-EGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHK 1007
               PYN+L+KN S  S+P++++   + P   N    +N ST  +      ++ Q VRKHK
Sbjct: 906  RNIPYNNLKKNSSASSVPSVSSLRAASPILSNPL--HNLSTPALQGGK-QSQTQPVRKHK 962

Query: 1008 KNVSFSSLNSLMFSKKGSVGYGGQPINGISENSDNE 1043
            K VSF+SLNSLMFSKK       Q ++    N D++
Sbjct: 963  KTVSFNSLNSLMFSKKAPTPVNSQYLSDAKINEDDD 998

>AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W - SH]
            complement(496601..499024) [2424 bp, 807 aa]
          Length = 807

 Score =  446 bits (1148), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 317/931 (34%), Positives = 462/931 (49%), Gaps = 220/931 (23%)

Query: 132  IGDTE--GYDGQ-FVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRN 188
            +GD    G D Q +VREYPT +L DRF KW+K+LKS++AYLREVA AQEQ ARIN  L++
Sbjct: 52   LGDHRHLGDDTQSYVREYPTSILADRFDKWRKLLKSLVAYLREVAAAQEQHARINAHLKS 111

Query: 189  SVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQF 248
            +VKF FL DL EG+NK+++ L +      P++ +Q   +  ++                +
Sbjct: 112  AVKFSFLADLEEGTNKVVEQLKR------PSSPSQSGAESAQDS---------------Y 150

Query: 249  MPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIK 308
              VQ       S+GFLR+GSGSIQD+QV LKKYH++++NQQ K S+E+ + VIPKLEE++
Sbjct: 151  FQVQE----GCSNGFLRYGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEELR 206

Query: 309  KDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFV---DRNNYLQDVQNKLKP 365
            ++LS KIKEIKEL+ DFKTNI+  + +TG LL+KYIA+   +   + +   +    +LKP
Sbjct: 207  RNLSSKIKEIKELSNDFKTNIHEQVALTGQLLQKYIASVDLLSTAEDSTSSKSTGQRLKP 266

Query: 366  KHDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDS 425
            KHDPY           RQ+ EENYLQEA++NLQ+SG++LEKI+Y +IQ  LQ+++  +D 
Sbjct: 267  KHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYMDI 326

Query: 426  EARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNM 485
            E+   I  +CQEL+ GIL+KP  +EWD+FV  HP CLLNWKS+DPVP PR  S + YP M
Sbjct: 327  ESCAAINGICQELRRGILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYPKM 386

Query: 486  KSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYKPKKGAPNQQNS 545
            KSPM+KCIRAGY M                YF+LTS Y+H+F SSDF+K           
Sbjct: 387  KSPMAKCIRAGYLM----KKSKLLKNYNKGYFVLTSNYLHEFKSSDFFK----------- 431

Query: 546  IQFQFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASIPLSEC 605
                                            +NG      P  +     P+ SIPL+E 
Sbjct: 432  ------------------------------MANNG----EKPSLKKINFDPLGSIPLNE- 456

Query: 606  RLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKYGQDAS 665
                               + +TE +P+K V  S      +  +   A+  G  +     
Sbjct: 457  -------------------STVTEALPQKFVLCSTWAGIDSQEAGLSATSSGTSFTSMQG 497

Query: 666  TKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTFKMVAE 725
            ++      L KL+KGA            +K G    + K  T+++  T+   WTFK    
Sbjct: 498  SR--SSVSLGKLLKGA------------AKPGKALTSAKASTSEI--TKGHVWTFKPSTT 541

Query: 726  KPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSNQNSTS 785
            +  +D    F KW  +++ L  F    ER  +IE++++K+ +++    ++          
Sbjct: 542  QSEKD----FKKWCGELRQLAGFNSTLERCRYIEEKIVKAHSRASSKASQSSIGTPPEGP 597

Query: 786  NFAGKPTYISLGVDSKSTFTPDG----SVMNTPAIDDNGNLITFGQRH-SVVSPHYSNNS 840
              A KP +I +        +P G    S +NTPA DDNGNLI  G R+ S+++P     S
Sbjct: 598  GRAQKPQFIDI-----KGLSPIGYNIASPINTPAFDDNGNLIMAGDRNMSLLTP-----S 647

Query: 841  DNSYRQSYRPTNSLPGS----RNLSPLPVNSPTSVNSEG--------------------- 875
              S++ +   TN++       ++ SP PV++  +  +EG                     
Sbjct: 648  GLSFQGAPSLTNTISSDGTSLQSRSPTPVDTAATF-TEGNLNAVQPGVGQSGGGGSISSP 706

Query: 876  -------SGGGYFAIPVNKQMSHPGSNVQVSEFGSRSNVNTAGSSPNITGMGYFVPVQST 928
                   + GGYFAIPVN+  S P  +   S   S+S  + A  S               
Sbjct: 707  RSTESINNSGGYFAIPVNR--SQPQRDSVPS---SQSRADRAPPS--------------- 746

Query: 929  GVVPKVKVNNEEMGQNSPQPPASPYNSLRKNISTGSIPTLNNEGSRPESGNFYKNNNSST 988
            G VP ++V ++      P  P     SL K  S+   P+L +  SR              
Sbjct: 747  GSVPLLRVTSQSGNVEQPGRP-----SLYKQTSS---PSLTSIKSR-------------- 784

Query: 989  NLVAAANGTARVQAVRKHKKNVSFSSLNSLM 1019
                      + Q V KHK+N+SF SL  ++
Sbjct: 785  ----------QTQLVLKHKRNLSFQSLAEMV 805

>CAGL0B04213g 412230..414932 some similarities with sp|P48361
           Saccharomyces cerevisiae YGR097w ASK10 involved in
           SKN7P-dependent transcription, hypothetical start
          Length = 900

 Score =  405 bits (1041), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 271/765 (35%), Positives = 385/765 (50%), Gaps = 103/765 (13%)

Query: 138 YDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTD 197
           +  Q+V+EYPT +L DRF KW KILK +I+YLRE AY +E  AR++ +L+  V FPFLTD
Sbjct: 135 HHSQYVKEYPTVLLADRFKKWNKILKYLISYLREAAYVEEHIARLHVKLKKKVTFPFLTD 194

Query: 198 LTEGSNKIIDPLSQ--APKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQF------- 248
           L +  N+++DP  +    K+  P T A+K++ + E   A             F       
Sbjct: 195 L-DDHNQLVDPYQKNLPTKRTQPITPAEKKRLEAEAALAAATTTEETTEELDFDTELEDE 253

Query: 249 MPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIK 308
           +PV + ++T A SGFL+FGSGSIQDIQV+LKKYH S+A QQ K+S+EI+  VIPKLE + 
Sbjct: 254 VPVSSDNDTMAPSGFLKFGSGSIQDIQVLLKKYHGSIAGQQLKVSREIMENVIPKLEGLV 313

Query: 309 KDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHD 368
           K+L+ KI+EIK L+GDF+TN+   +  T  L++KY +  + +   N   D    ++PK D
Sbjct: 314 KELNNKIREIKSLDGDFRTNLIGQMNQTSRLIQKYNSVVKKL--ANEKSDATTTIQPKCD 371

Query: 369 PYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEAR 428
           PY           +Q+AEE YL EAFVNLQSSGL LE+I+Y++IQ  L+ Y+ LIDSEAR
Sbjct: 372 PYLVKIQLETQLKKQLAEEKYLMEAFVNLQSSGLDLERIVYTKIQSALENYTALIDSEAR 431

Query: 429 LMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSP 488
           L++KNLCQELQ G+L+KP   EWD F++HH  C+LNW S  P PVPR  S ++Y NMK+P
Sbjct: 432 LILKNLCQELQQGMLSKPANYEWDQFITHHTNCMLNWTSTQPKPVPRELSDIVYQNMKAP 491

Query: 489 MSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSDFYKPKKGAPNQQNSIQF 548
            SKCIR GY                  YFILTS Y+H+F  SDF K  KG+ +  N+   
Sbjct: 492 QSKCIRKGYMYY---GSGKDVKKYSKGYFILTSHYLHEFKDSDFSKEMKGSTDASNNF-- 546

Query: 549 QFQPXXXXXXXXXXXXTRKVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASIPLSECRLV 608
                                        H  +++ N        +IP  S  LS+  + 
Sbjct: 547 ----------------------------CHMAISLVN--------LIPEKSFSLSDIDIE 570

Query: 609 ESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPG-AKYGQDASTK 667
           E +D   V   ++  S           +      + S +I+   A++P   + G   STK
Sbjct: 571 EITDTEMVFTARSLKSTKPRSSPSPAPIPAPEHKSRSPSIT---AAVPKFLRGGPSRSTK 627

Query: 668 VLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTFKMVAEKP 727
               +       GA  +TL  E S      L +   ++        E+  W  ++     
Sbjct: 628 TRSNS-------GANRQTLFAEPS------LSEPLREI-------GERTTWHLRLSLGDY 667

Query: 728 TEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSNQNSTSNF 787
            E+  K F KW  D K L  F     R +FI +R  +S T+     A  G  N+ ++ + 
Sbjct: 668 DEEYKKQFKKWSSDFKALADFNHSYHRNSFINER-AESATRRASKTAGPGEFNKQNSDSS 726

Query: 788 AGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLITFGQRHSVVSPHYSNNSDNSYRQS 847
            G      +    +S    D  + N   +D++GNLI    R   VSP          RQ 
Sbjct: 727 RGSSDSTIVQDSGRS----DSKIGNIVGLDEDGNLIASDGRKYSVSPQLQ-------RQ- 774

Query: 848 YRPTNSLPGSRNLSPLPVNSPTSVNSEGSGGGY----FAIPVNKQ 888
                   GS  L+  P + P S   +GS   Y     ++P NK+
Sbjct: 775 --------GSSGLTS-PSSQPGSPLGDGSTTQYRDRVLSLPTNKR 810

>Kwal_23.4958
          Length = 649

 Score =  186 bits (471), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 182/385 (47%), Gaps = 68/385 (17%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PT++L  RF  W+ +++SI+ YL E    Q++  R   +L ++V FPF    TE  ++  
Sbjct: 145 PTEVLAQRFAAWRSVIRSILVYLTETVSIQDEIVRQQLRLSHAVNFPFFA--TENQHQ-- 200

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
                      P+T  +K  QK                                  FL  
Sbjct: 201 -----------PSTPEEKAIQK---------------------------------FFLPM 216

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           G+GS+QD+  IL ++H  +AN   K+SKE+ + VIP+LE+++ DL  KIKEIK L+ DFK
Sbjct: 217 GNGSVQDLPSILSQFHSQMANGALKMSKELANEVIPRLEDLRGDLLIKIKEIKTLHSDFK 276

Query: 327 TNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAE 386
            + +  ++ T   LK +I A           +      PK DPY           RQ+ E
Sbjct: 277 NSCSKELQQTKHDLKHFIEAV----------EAARYGAPKSDPYLIKISLEKQIKRQLNE 326

Query: 387 ENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKP 446
           EN L EAF NLQ SG +LEK++   IQ+ L  Y+ L+   A+++   L   L  G   K 
Sbjct: 327 ENLLHEAFDNLQGSGRELEKVVVMEIQNALSIYARLLGQNAQIVFDVLISRLDVGFFNKE 386

Query: 447 PAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXX 506
           P  EWDNF+S  P  +   + N PV   R+   ++Y     P++  +++G+         
Sbjct: 387 PVFEWDNFISKDPNFI---EPNLPV---RHMRDIVYKYQDDPLTYEVKSGFL----ERRS 436

Query: 507 XXXXXXXXXYFILTSTYIHQFSSSD 531
                    +++LTS+Y+H+F + D
Sbjct: 437 KFLKSYTKGFYLLTSSYLHEFKTPD 461

>Scas_671.23
          Length = 686

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/385 (30%), Positives = 185/385 (48%), Gaps = 68/385 (17%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PTD+L  RF  W+ I++SI+AYL E A  Q++  R   +L ++V+FPF +          
Sbjct: 234 PTDILAARFSAWRNIIRSILAYLTETASIQDEIVRQQLRLSHAVQFPFFS---------- 283

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
                   ++ P++   K  QK                                  FL  
Sbjct: 284 -----LDNQHQPSSYEDKATQK---------------------------------FFLPQ 305

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           G+ SIQD+  IL  YH   AN     S+E+ + VIP+LE++++DL  KIKEIK L  DFK
Sbjct: 306 GNNSIQDLPTILFNYHNKTANSASAASRELTNEVIPRLEDLRRDLLIKIKEIKSLQSDFK 365

Query: 327 TNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAE 386
            +    ++ T   L+ +  +         L+D +    PK DPY           RQI+E
Sbjct: 366 NSCIKELQQTKQDLRNFYDS---------LKDARYS-TPKQDPYLTKIVLDKQIKRQISE 415

Query: 387 ENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKP 446
           EN+L EAF NL++SG +LEK++   IQ+ L +Y+ L+  +++++  +L  +L  G     
Sbjct: 416 ENFLHEAFDNLETSGAELEKVVVMEIQNALTQYARLLGQQSQIVFDDLIAKLDSGFFNID 475

Query: 447 PAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXX 506
           P  EWDNF++  P  LL    N P+   RN   +IY     P++  IR+GY         
Sbjct: 476 PQFEWDNFIARDPNFLL---PNLPM---RNFKNIIYKAQYDPLTYQIRSGYL----ERRS 525

Query: 507 XXXXXXXXXYFILTSTYIHQFSSSD 531
                    Y++LT +++H+F +SD
Sbjct: 526 KFLKSYSKGYYVLTPSFLHEFKTSD 550

>Sklu_2395.6 YIL105C, Contig c2395 8302-10437
          Length = 711

 Score =  184 bits (467), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 185/388 (47%), Gaps = 74/388 (19%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PT++L  RF  W+ +++SI+ Y+ E    Q++  R   +L ++V FPF    TE  ++  
Sbjct: 182 PTEVLAQRFAAWRSVIRSILVYMTETVSIQDEIVRQQLRLSHAVNFPFFA--TENQHQ-- 237

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
                      PTT  +K  QK                                  FL  
Sbjct: 238 -----------PTTAEEKAIQK---------------------------------FFLPL 253

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           G+GSIQD+  IL +YH  +A+   K SKE+ + V+P+LE++++DL  KIKEIK L  DFK
Sbjct: 254 GNGSIQDLPSILTQYHSQMASAASKASKELTNEVLPRLEDLRRDLLVKIKEIKGLQSDFK 313

Query: 327 TNINYHIKMTGILLKKY---IAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQ 383
            + N  ++ T   LK +   I   R+                + DPY           RQ
Sbjct: 314 NSCNKELQQTKQDLKGFQDSIEEARYG-------------TARQDPYLAKIILDKQIKRQ 360

Query: 384 IAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGIL 443
           + EEN+L EAF NLQSSG +LEK++   IQ+ L  Y+ ++  EA+L+   L  +L  G  
Sbjct: 361 LTEENFLHEAFNNLQSSGRELEKVVVMEIQNALTIYARILGQEAQLVFDILISKLDMGFF 420

Query: 444 AKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXX 503
            K P  EWDNFVS  P    N+   D +P+ R+   ++Y N   P++  +++G+      
Sbjct: 421 NKEPIFEWDNFVSKDP----NFVEPD-LPM-RHMKDIVYRNQFDPLTNEVKSGFL----E 470

Query: 504 XXXXXXXXXXXXYFILTSTYIHQFSSSD 531
                       +++LT +++H+F + D
Sbjct: 471 RRSKFLKSYSKGFYVLTPSFLHEFKTGD 498

>CAGL0G02827g complement(259569..261818) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 749

 Score =  184 bits (468), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 191/416 (45%), Gaps = 73/416 (17%)

Query: 116 DNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAYA 175
           +N    L+ ST++K+ +       GQ     PTD+L  RF  W+ +++SII YL E+A  
Sbjct: 202 NNNQTQLDYSTKAKSPLAVLIPTTGQ-----PTDVLAARFSAWRNVIRSIIVYLTEIASI 256

Query: 176 QEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEEQNAP 235
           +++  R   +L ++V+FPF T                  +  PT+   +  QK       
Sbjct: 257 EDEIVRQQLRLSHAVQFPFFT---------------IENQYQPTSSEDRYTQK------- 294

Query: 236 NVDLPPVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKISKE 295
                                      FL  GSGS+QD+  IL +YH +LA+     S+E
Sbjct: 295 --------------------------FFLPLGSGSVQDLPTILNQYHEALASNASNASRE 328

Query: 296 IVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNY 355
           + + VIP+LE++++DL  KIKEIK L  DFK +    ++ T   +K YI + +       
Sbjct: 329 LTNDVIPRLEDLRRDLLVKIKEIKSLQSDFKNSCAKELQQTKQDMKHYIDSLKEARYGT- 387

Query: 356 LQDVQNKLKPKHDPYXXXXXXXXXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHV 415
                    PK DPY           +Q+ EEN+L EAF NL++SG +LEK++   IQ+ 
Sbjct: 388 ---------PKQDPYLAKIALDKQIKKQLIEENFLHEAFDNLETSGAELEKVVVMEIQNA 438

Query: 416 LQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPVPR 475
           L  Y+ L+  +++L+   L  +L  G     P  EWD F+S  P  L   + N P+   R
Sbjct: 439 LTIYARLLGQQSQLIFDILISKLDMGFFNMNPQYEWDTFISRDPNFL---QPNVPM---R 492

Query: 476 NASAVIYPNMKSPMSKCIRAGYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSD 531
           N   + Y     P +  IR+GY                  +++LT  ++H+F S D
Sbjct: 493 NLKEITYKYQHDPFTYEIRSGYL----ERRSKFLKSYSKGFYVLTPNFLHEFKSID 544

>ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH]
           (293117..295327) [2211 bp, 736 aa]
          Length = 736

 Score =  182 bits (463), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 114/385 (29%), Positives = 188/385 (48%), Gaps = 68/385 (17%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PT++L  RF  W+ ++K+II YL E A  Q++  R + +L ++V FPF +         +
Sbjct: 246 PTEVLAGRFASWRAVIKAIIVYLTETASIQDELVRQHLRLSHAVSFPFFS---------V 296

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
           + + Q      P+T  +K  Q                   QF              FL  
Sbjct: 297 ENVRQ------PSTPEEKAIQ-------------------QF--------------FLPL 317

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           GSGSIQD+  IL  YH  +A+   K SKE+ + VIP+LE++++DL  KIKEIK L  DFK
Sbjct: 318 GSGSIQDLPTILTGYHAQMASMASKASKELTNEVIPRLEDMRRDLLVKIKEIKSLQSDFK 377

Query: 327 TNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAE 386
            +    +  T  +L+ +  +   V++  Y         PK DPY           RQ+AE
Sbjct: 378 NSCAKEVSETKQMLRTFHES---VEQARYG-------TPKSDPYLTRILLDKQLKRQLAE 427

Query: 387 ENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKP 446
           EN+L +AF NLQ+SG +LEK++   IQ  L  Y+ ++  EA+L+  ++  +L  G L++ 
Sbjct: 428 ENFLHQAFNNLQASGKELEKVVVMEIQSALTVYARILGREAQLVFDSVITKLDMGFLSRD 487

Query: 447 PAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXX 506
           P  EWD+F++  P  +      +P    R+   + Y +   P++  ++ G+         
Sbjct: 488 PVFEWDDFIARDPNFV------EPSVPMRSLKDITYKHQYDPLTYKLQCGFL----ERRS 537

Query: 507 XXXXXXXXXYFILTSTYIHQFSSSD 531
                    +++LT +++H+F + D
Sbjct: 538 KFLKSYSRGFYVLTPSFLHEFKTCD 562

>KLLA0F03839g complement(363977..365923) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 648

 Score =  179 bits (454), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/385 (29%), Positives = 179/385 (46%), Gaps = 68/385 (17%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PT++L  RF  W+ I++S++ YL+E    Q++  R + +L++++ FPF T         I
Sbjct: 158 PTEVLSQRFAAWRGIIRSLLVYLQETVSIQDEVVRQHLRLQHAINFPFFT---------I 208

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
           D   Q      PTT   K  QK                                  FL  
Sbjct: 209 DSQHQ------PTTPEDKNIQK---------------------------------FFLPL 229

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           G GSIQD+  +  +YH  + +   K SKE+   VIP+LE++++DL  KIKEI+ L  DFK
Sbjct: 230 GHGSIQDLPTLFNQYHTQMVHAASKASKELSQDVIPRLEDMRRDLLVKIKEIQSLESDFK 289

Query: 327 TNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAE 386
            + N  ++ T I LK +  +      N+    V      K DP+           +Q+ E
Sbjct: 290 NSCNKELQETKIRLKAFQESLE----NSKYGSV------KQDPFLAKILLEKQIKKQLTE 339

Query: 387 ENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKP 446
           EN+L EAF NLQ+SG +LEK++   IQ+ L  Y+ ++  EA+++   L  +L  G   K 
Sbjct: 340 ENFLHEAFNNLQTSGRELEKVVMMEIQNALTSYAKVLGQEAQIVFDVLISKLDTGFFNKD 399

Query: 447 PAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXX 506
           P  EW+NFV+  P  +      DP    R    ++Y N   P +  I++G          
Sbjct: 400 PVFEWENFVAKDPNFI------DPNLPMRRVKDIVYKNQNDPFTYEIKSGIL----ERRS 449

Query: 507 XXXXXXXXXYFILTSTYIHQFSSSD 531
                    +++LT +++H+F S D
Sbjct: 450 KFLKSYSRGFYVLTPSFLHEFKSGD 474

>YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protein
           with similarity to Ask10p [1971 bp, 656 aa]
          Length = 656

 Score =  177 bits (450), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 186/392 (47%), Gaps = 75/392 (19%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PTD+L  RF  W+ ++++I+ YL E A  Q++  R   +L ++V+FPF +          
Sbjct: 164 PTDVLSARFSAWRNVIRAILVYLSETASIQDEIVRQQLRLSHAVQFPFFS---------- 213

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
                                                   Q+ PV + ++ S    FL  
Sbjct: 214 -------------------------------------IENQYQPV-SNEDKSMQKFFLPL 235

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           GSGS+QD+  +L KYH +LA+   K SKE+ S +IP+LE++++DL  KIKEIK L  DFK
Sbjct: 236 GSGSVQDLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRRDLLVKIKEIKALQSDFK 295

Query: 327 TNINYHIKMTGILLKKY---IAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQ 383
            + N  ++ T  L+K +   +  C+                PK DP+           RQ
Sbjct: 296 NSCNKELQQTKHLMKLFNESLKECKLG-------------TPKSDPFLIKLQLEKQIKRQ 342

Query: 384 IAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGIL 443
           + EENYL EAF NLQ+SG QLE +I   IQ+ L  Y+ ++  EA+++  ++  +L   IL
Sbjct: 343 LVEENYLHEAFDNLQNSGAQLESVIVMEIQNGLTSYARILGKEAQVVFDSVISKLDSTIL 402

Query: 444 AKPPAMEWDNFVSHHPLCLLNWKSNDPVPVP-RNASAVIYPNMKSPMSKCIRAGYFMMXX 502
            K   +EWD+F+      L N  +  P  +P R    + Y N   P +  +++G+     
Sbjct: 403 NKNTNLEWDSFI------LRNISNFVPPNLPMRRFKEISYSNQNDPFTFEVKSGFL---- 452

Query: 503 XXXXXXXXXXXXXYFILTSTYIHQFSSSDFYK 534
                        +++LT +++H+F + D +K
Sbjct: 453 EKRSKFLKSYSRGFYVLTPSFLHEFKTPDKHK 484

>YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein
           with similarity to Ask10p and Ynl047p, contains a
           Q/N-rich domain [2061 bp, 686 aa]
          Length = 686

 Score =  177 bits (450), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 118/385 (30%), Positives = 185/385 (48%), Gaps = 68/385 (17%)

Query: 147 PTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKII 206
           PTD+L  RF  W+ ++KS+I YL E+A  Q++  R   +L ++V+FPF +          
Sbjct: 188 PTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFS---------- 237

Query: 207 DPLSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRF 266
                                                   Q+ P    D  S    FL  
Sbjct: 238 -------------------------------------IENQYQPSSQEDK-SVQKFFLPL 259

Query: 267 GSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFK 326
           G+GSIQD+  IL +YH SLA+   K S+E+ + VIP+LE++++DL  KIKEIK L  DFK
Sbjct: 260 GNGSIQDLPTILNQYHESLASSASKASRELTNDVIPRLEDLRRDLIVKIKEIKSLQSDFK 319

Query: 327 TNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXXXXXXRQIAE 386
            + +  ++ T   +K++  +         L+D +  + PK DP+           +Q+ E
Sbjct: 320 NSCSKELQQTKQAMKQFQES---------LKDARYSV-PKQDPFLTKLALDRQIKKQLQE 369

Query: 387 ENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKP 446
           EN+L EAF NL++SG +LEKI+   IQ+ L  Y+ L+  EA+L+   L  +L  G     
Sbjct: 370 ENFLHEAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQEAQLVFDILISKLDSGFFNVD 429

Query: 447 PAMEWDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMXXXXXX 506
           P  EWDNF+S  P  LL    N P+   R    ++Y     P++  I++G+         
Sbjct: 430 PQFEWDNFISRDPNFLL---PNLPM---RTFKEIVYKYQFDPLTYEIKSGFL----ERRS 479

Query: 507 XXXXXXXXXYFILTSTYIHQFSSSD 531
                    Y++LT  ++H+F ++D
Sbjct: 480 KFLKSYSKGYYVLTPNFLHEFKTAD 504

>CAGL0G01386g complement(132280..133878) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c or sp|P53955
           Saccharomyces cerevisiae YNL047c, hypothetical start
          Length = 532

 Score =  162 bits (411), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 193/396 (48%), Gaps = 46/396 (11%)

Query: 146 YPTDMLIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKI 205
           +P + L  RF +W+K+LK+II YL EVA  QE+  R N ++ N +    +++   GS+  
Sbjct: 20  HPAEQLAQRFTEWRKVLKAIIVYLSEVASVQEEIIRQNAKVSNILASHGISNAGIGSSGS 79

Query: 206 IDP----LSQAPKKNAPTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASS 261
                  L+ A  K A      K  +               + +  F      DNT +++
Sbjct: 80  GLSGSFNLTSAANKLASGGAHDKHGK---------------NNNGWFFSGSEEDNTHSAN 124

Query: 262 G----FLRFGSGSIQDIQVILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKE 317
                FL  G+GSIQD+ +IL++YH  +A +  K ++E+ +++IP LE + KDL  KIK 
Sbjct: 125 TINHFFLPIGNGSIQDVPIILRQYHDVMAAEAAKGTRELQNSIIPGLESLNKDLVLKIKS 184

Query: 318 IKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYXXXXXXX 377
           IK L+ DFK N +  +  T   + K+  +     +N           P  DPY       
Sbjct: 185 IKSLSSDFKNNCSKELDTTRECMVKFQQSINQARKN----------VPARDPYLLKVNLD 234

Query: 378 XXXXRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQE 437
               RQ++EEN+L EAF+NLQSSG +LEKI+ + IQ+  +  + ++ +EA+++   L   
Sbjct: 235 NQIRRQLSEENFLHEAFMNLQSSGQELEKIVVASIQNAFRVLAQILGAEAKIIDDQLVNR 294

Query: 438 LQYGILAKPPAMEWDNFVSHHPLCLLNWKSN-DPVPVP-RNASAVIYPNMKSPMSKCIRA 495
           L    L+  P+ EWDNF       LL   +N  P+ +P R    + Y     P++  ++ 
Sbjct: 295 LLSSFLSLSPSHEWDNF-------LLRDNTNFIPLNLPMRKFKEIEYTGKNDPLTLVVQC 347

Query: 496 GYFMMXXXXXXXXXXXXXXXYFILTSTYIHQFSSSD 531
           GY                  Y++LT  Y+H+F +SD
Sbjct: 348 GYL----ERRSKYLKSYTKGYYVLTPNYLHEFKTSD 379

>YKR053C (YSR3) [3304] chr11 complement(533709..534923) Sphingoid
           base-phosphate phosphatase, putative regulator of
           sphingolipid metabolism and stress response [1215 bp,
           404 aa]
          Length = 404

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 43/109 (39%), Gaps = 4/109 (3%)

Query: 601 PLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKY 660
           P+ EC   E S A   +    + S+ LTE+     V    A  GS     PL  +     
Sbjct: 266 PIDECPCFEDSVAFIGVVSGLDCSDWLTERYGWNLVCSRYASCGSKVFLRPLVGVASVIV 325

Query: 661 GQDASTKVLHKTKLSKLVKGAKAKT----LGTETSKHSKSGLEKDANKV 705
            +D  +K    T L KL++    ++       ETS+  +  L    +KV
Sbjct: 326 WKDVISKTAVYTLLIKLLRFHDDRSEKVHFHNETSEEEECLLYSGVSKV 374

>ABL159W [433] [Homologous to ScYDL225W (SHS1) - SH]
           complement(99828..101570) [1743 bp, 580 aa]
          Length = 580

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 4/45 (8%)

Query: 131 VIGDTEGYDGQFVREYP-TDMLI-DRFYKWKKILKSII--AYLRE 171
           V  DT+G DG++VR YP  D+ I D      ++LKS++  +YL+E
Sbjct: 271 VCSDTKGKDGRYVRAYPWGDLFIDDETVSDLRVLKSVLFGSYLQE 315

>KLLA0C14190g complement(1227049..1228836) some similarities with
           ca|CA5008|IPF12577 Candida albicans unknown function,
           hypothetical start
          Length = 595

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 786 NFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLI----TFGQRHSVVSPHYSNNSD 841
           NFA    + SLG+ S      +G  +N P IDD GN++         H+ +   ++  S 
Sbjct: 263 NFA----FQSLGIHSALRMMYEGHFLNLPVIDDTGNILGLISVLQLTHAALRCQFATTSK 318

Query: 842 NSYRQS 847
           N   QS
Sbjct: 319 NVSSQS 324

>Kwal_55.21164
          Length = 588

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 240 PPVDPSEQFMPVQATDNTSASS-------GFLRFGSGSIQDIQVIL--KKYHVSLANQQF 290
           P V  SE    V  T   +ASS        F R     + ++Q I+  KK  +     + 
Sbjct: 43  PSVSASEHRNMVNHTKKHNASSEGSSHMTAFYRENIRQLNELQDIMFQKKCKLDAIKDEL 102

Query: 291 KISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHI 333
             SK+   T++ KLE +K++ + K+++IK  N D K   + H+
Sbjct: 103 GESKDEFRTLMLKLETLKEEKNVKLQQIKLKNNDLKKLSDEHV 145

>Scas_623.11
          Length = 378

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 218 PTTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVI 277
           P  +A+  K+++E      ++    DP E+F  +Q   +T      LR+G G I++I   
Sbjct: 289 PIPLAKVFKKEDELTVDFLINTLKYDPMERFNSLQCLCSTYFDE--LRYGEGKIKEITTD 346

Query: 278 LKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSF 313
           LK         +FK+  E+      +LE IK+ L+ 
Sbjct: 347 LKLL-------EFKVDDELSHLTPDQLEIIKQKLAL 375

>Sklu_2055.4 YDL055C, Contig c2055 7624-8715 reverse complement
          Length = 363

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 617 IEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASI-PGAKYGQDA 664
           + G   Y N+L+ + P+K   +S  H   N + +P A I P AK G D 
Sbjct: 227 LSGTVLYLNSLSRRAPEKLAKQSEGHIVGNVLIDPSAKIAPTAKIGPDV 275

>KLLA0E16951g 1500700..1503177 highly similar to sp|P33416
           Saccharomyces cerevisiae YDR258c HSP78 heat shock
           protein of clpb family of ATP-dependent proteases,
           mitochondrial, start by similarity
          Length = 825

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 246 EQFMPVQATDNTSASSGFLRFGS----GSIQDIQVILKKYHVSLANQQFKISKEIVSTVI 301
           ++F+P +A D    +   LR        SIQ I   +    + L +    + KE     +
Sbjct: 330 DRFLPDKAIDLVDEACAVLRLQHESKPDSIQAIDRAVMTMQIELES----LKKETDPVSV 385

Query: 302 PKLEEIKKDLSFKIKEIKELNGDFKT 327
            + EE++KDL  K KE++ L   ++T
Sbjct: 386 ERREELEKDLEVKKKELERLTEIWET 411

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,588,461
Number of extensions: 1562225
Number of successful extensions: 5551
Number of sequences better than 10.0: 200
Number of HSP's gapped: 5659
Number of HSP's successfully gapped: 245
Length of query: 1045
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 933
Effective length of database: 12,718,893
Effective search space: 11866727169
Effective search space used: 11866727169
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)