Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G03135g30730216020.0
Scas_716.293163077641e-101
YGR096W (TPC1)3143086915e-90
KLLA0D15015g3173056403e-82
AAR036W3173076325e-81
Kwal_23.39653073056021e-76
CAGL0J01661g3273242679e-27
CAGL0K02915g3423422442e-23
Sklu_2363.23233242414e-23
YPR011C3263232326e-22
Scas_379.23013052211e-20
Kwal_14.22103153062221e-20
YKR052C (MRS4)3042962105e-19
AGL311C3623112092e-18
YHR002W (LEU5)3573242072e-18
YIL006W3733112072e-18
Scas_717.203563312046e-18
YJL133W (MRS3)3143152001e-17
CAGL0K08250g2972941992e-17
CAGL0L05742g3053181992e-17
CAGL0J05522g5193192022e-17
AGL047C3163071983e-17
Kwal_55.213353173101983e-17
YNL083W5453192004e-17
ACR260W3113141957e-17
Kwal_26.79723583221967e-17
Kwal_55.208683803291951e-16
KLLA0B12826g3193231931e-16
CAGL0J02002g3613021941e-16
Sklu_2334.23193061922e-16
Kwal_33.140503143091922e-16
YEL006W3353231922e-16
Kwal_23.47313143121912e-16
YOR100C (CRC1)3273031913e-16
Kwal_23.30425423191916e-16
CAGL0B04543g3173231877e-16
ADL009W3793091898e-16
Sklu_2359.69022911918e-16
Scas_691.43343211861e-15
CAGL0D01606g3053071842e-15
Scas_632.92923091823e-15
KLLA0E15532g3263121833e-15
YOR130C (ORT1)2922941814e-15
YMR056C (AAC1)3092991814e-15
CAGL0G08910g2891971806e-15
Sklu_2374.75133211837e-15
ADL049W9122901839e-15
YJR095W (SFC1)3223011781e-14
Scas_578.3*5241981811e-14
Scas_602.88852931811e-14
AGL065C3353251782e-14
Kwal_47.182163333371772e-14
YPR021C (AGC1)9022971793e-14
Kwal_47.173218811981793e-14
KLLA0E18788g3813301755e-14
Kwal_26.76533253071745e-14
CAGL0K11616g3203201711e-13
CAGL0K02365g9192971741e-13
Kwal_33.154463053031701e-13
Scas_667.43083131701e-13
Scas_709.93653001711e-13
Scas_582.73293031702e-13
AER184W3052931692e-13
Sklu_2430.103243191702e-13
KLLA0C11363g5173191712e-13
Scas_589.103162361683e-13
Sklu_2127.52782901663e-13
Scas_667.223063021673e-13
YMR166C3683291684e-13
CAGL0G01166g2952911674e-13
Kwal_27.125993042891664e-13
Sklu_2037.23103091664e-13
CAGL0M09020g3483321665e-13
AER419W4933121676e-13
YBR085W (AAC3)3073081656e-13
KLLA0E02772g2843001646e-13
Kwal_23.29133201951631e-12
KLLA0F03212g3053031622e-12
CAGL0K10362g3013051593e-12
YBL030C (PET9)3182931595e-12
CAGL0L02079g2973071576e-12
YOR222W (ODC2)3072311578e-12
Scas_721.1293233071569e-12
Sklu_2432.52882881569e-12
Sklu_1149.22963081561e-11
YKL120W (OAC1)3243231551e-11
KLLA0D14036g4313401561e-11
KLLA0E09680g3073081542e-11
CAGL0K12210g3112941542e-11
Scas_718.243373231542e-11
Kwal_27.124813042921532e-11
KLLA0F04697g3071941532e-11
Sklu_2075.33452631542e-11
YGR257C (MTM1)3662131533e-11
KLLA0E13453g9063001553e-11
AGR383W2932451514e-11
YBR104W (YMC2)3293281515e-11
Scas_721.273743151525e-11
Kwal_27.120813693091515e-11
KLLA0E23705g3682621516e-11
YIL134W (FLX1)3111971506e-11
YBR291C (CTP1)2992031506e-11
AFR146W2813011497e-11
YPR058W (YMC1)3073041497e-11
Scas_714.183053161498e-11
Kwal_27.114192983041481e-10
Scas_489.42973071471e-10
Kwal_26.86692962921471e-10
Sklu_2431.53703151472e-10
Sklu_1926.23052971452e-10
CAGL0F04213g3062921452e-10
YDL198C (YHM1)3001941443e-10
AFR131C3442211453e-10
Scas_645.93912201453e-10
YLR348C (DIC1)2982901444e-10
Scas_662.123083161435e-10
YNL003C (PET8)2841831426e-10
Kwal_33.129883033101427e-10
Scas_718.53243211418e-10
KLLA0D04290g1881431378e-10
Scas_562.123001961418e-10
Sklu_2115.42993081401e-09
KLLA0E18810g3772971411e-09
Kwal_33.155973052001401e-09
CAGL0J09790g3001961382e-09
Scas_669.63733251392e-09
CAGL0H10538g2973111382e-09
KLLA0D07073g2972921382e-09
AER366W2932061382e-09
Scas_702.103022711372e-09
KLLA0A09383g3662191383e-09
KLLA0E12353g3052961373e-09
YJR077C (MIR1)3111931373e-09
Scas_697.473283041373e-09
ADL264C3293001364e-09
Scas_640.253062931364e-09
Scas_558.22891901346e-09
CAGL0B03883g3063201346e-09
Kwal_27.116262991821346e-09
AEL253W3653101348e-09
Sklu_2398.43091901331e-08
YBR192W (RIM2)3772771321e-08
Scas_328.12271781291e-08
Sklu_2117.22981811302e-08
KLLA0F13464g3001871302e-08
Kwal_55.213383232821302e-08
Kwal_56.230113032921293e-08
Sklu_2127.43232871293e-08
CAGL0C02013g3292391293e-08
Sklu_1119.13071931283e-08
KLLA0E08877g2943161275e-08
KLLA0B08503g3032901275e-08
Kwal_26.79672972481267e-08
CAGL0D04774g3223061268e-08
CAGL0F07711g3682401268e-08
KLLA0D04312g103901171e-07
KLLA0F17864g3073041241e-07
Sklu_2260.53021861232e-07
YPR128C (ANT1)3283071242e-07
Sklu_2442.82752051232e-07
KLLA0C13431g3282051232e-07
Kwal_47.192282811421222e-07
Scas_715.453052731213e-07
Kwal_23.43543432121223e-07
AGR191W2981821213e-07
Sklu_2433.84201611213e-07
ACR109W2991841204e-07
CAGL0F00231g3071981204e-07
AFR147C3152861195e-07
Scas_687.15*3282321187e-07
CAGL0M05225g3812791189e-07
CAGL0H03839g2821731179e-07
Kwal_0.2322741851151e-06
CAGL0F08305g3742151152e-06
Scas_673.173141931152e-06
Sklu_1275.13112051133e-06
Kwal_23.57573072021124e-06
KLLA0B14454g3051931099e-06
AAL014C2711821081e-05
Kwal_23.35293952881081e-05
Scas_705.93233071082e-05
CAGL0J04114g3032261072e-05
ABL023W3093101063e-05
Sklu_2435.23443371053e-05
ADR036C3402591053e-05
AFL196W3612031054e-05
KLLA0E02750g3041801044e-05
Scas_613.241771811014e-05
YER053C3002381027e-05
AER450C3081731028e-05
YPL134C (ODC1)3102501019e-05
AEL060C4291541021e-04
AFR253W344801011e-04
CAGL0K06545g512235984e-04
KLLA0D04950g274197964e-04
KLLA0A00979g343197965e-04
AGL064W296125956e-04
KLLA0F08547g308307930.001
YFR045W285206910.002
KLLA0D09889g364294900.003
Scas_671.1*12371830.006
YMR241W (YHM2)314302850.010
CAGL0K07436g307304830.016
AFR542W310319830.018
YDR470C (UGO1)502109780.097
Kwal_34.15907312305770.11
KLLA0E22880g43684750.17
Scas_696.9312298750.18
Sklu_2194.3312294730.32
YDL119C307329730.33
YLR401C609118730.34
Kwal_55.2110632869681.2
Scas_650.9*60988672.1
KLLA0B11319g35587626.3
Scas_653.1943989627.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G03135g
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   621   0.0  
Scas_716.29                                                           298   e-101
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...   270   5e-90
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   251   3e-82
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....   248   5e-81
Kwal_23.3965                                                          236   1e-76
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   107   9e-27
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    99   2e-23
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          97   4e-23
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    94   6e-22
Scas_379.2                                                             90   1e-20
Kwal_14.2210                                                           90   1e-20
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    86   5e-19
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    85   2e-18
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    84   2e-18
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    84   2e-18
Scas_717.20                                                            83   6e-18
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    82   1e-17
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    81   2e-17
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    81   2e-17
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    82   2e-17
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    81   3e-17
Kwal_55.21335                                                          81   3e-17
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    82   4e-17
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    80   7e-17
Kwal_26.7972                                                           80   7e-17
Kwal_55.20868                                                          80   1e-16
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    79   1e-16
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    79   1e-16
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         79   2e-16
Kwal_33.14050                                                          79   2e-16
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    79   2e-16
Kwal_23.4731                                                           78   2e-16
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    78   3e-16
Kwal_23.3042                                                           78   6e-16
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    77   7e-16
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    77   8e-16
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          78   8e-16
Scas_691.4                                                             76   1e-15
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    75   2e-15
Scas_632.9                                                             75   3e-15
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    75   3e-15
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    74   4e-15
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    74   4e-15
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    74   6e-15
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       75   7e-15
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    75   9e-15
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    73   1e-14
Scas_578.3*                                                            74   1e-14
Scas_602.8                                                             74   1e-14
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    73   2e-14
Kwal_47.18216                                                          73   2e-14
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    74   3e-14
Kwal_47.17321                                                          74   3e-14
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    72   5e-14
Kwal_26.7653                                                           72   5e-14
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    70   1e-13
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    72   1e-13
Kwal_33.15446                                                          70   1e-13
Scas_667.4                                                             70   1e-13
Scas_709.9                                                             70   1e-13
Scas_582.7                                                             70   2e-13
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    70   2e-13
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         70   2e-13
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    70   2e-13
Scas_589.10                                                            69   3e-13
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         69   3e-13
Scas_667.22                                                            69   3e-13
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    69   4e-13
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    69   4e-13
Kwal_27.12599                                                          69   4e-13
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         69   4e-13
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    69   5e-13
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    69   6e-13
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    68   6e-13
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    68   6e-13
Kwal_23.2913                                                           67   1e-12
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    67   2e-12
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    66   3e-12
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    66   5e-12
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    65   6e-12
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    65   8e-12
Scas_721.129                                                           65   9e-12
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       65   9e-12
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         65   1e-11
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    64   1e-11
KLLA0D14036g complement(1203522..1204817) some similarities with...    65   1e-11
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    64   2e-11
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    64   2e-11
Scas_718.24                                                            64   2e-11
Kwal_27.12481                                                          64   2e-11
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    64   2e-11
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                64   2e-11
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    64   3e-11
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    64   3e-11
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    63   4e-11
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    63   5e-11
Scas_721.27                                                            63   5e-11
Kwal_27.12081                                                          63   5e-11
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    63   6e-11
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    62   6e-11
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    62   6e-11
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    62   7e-11
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    62   7e-11
Scas_714.18                                                            62   8e-11
Kwal_27.11419                                                          62   1e-10
Scas_489.4                                                             61   1e-10
Kwal_26.8669                                                           61   1e-10
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            61   2e-10
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          60   2e-10
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    60   2e-10
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    60   3e-10
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    60   3e-10
Scas_645.9                                                             60   3e-10
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    60   4e-10
Scas_662.12                                                            60   5e-10
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    59   6e-10
Kwal_33.12988                                                          59   7e-10
Scas_718.5                                                             59   8e-10
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    57   8e-10
Scas_562.12                                                            59   8e-10
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            59   1e-09
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    59   1e-09
Kwal_33.15597                                                          59   1e-09
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    58   2e-09
Scas_669.6                                                             58   2e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    58   2e-09
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    58   2e-09
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    58   2e-09
Scas_702.10                                                            57   2e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    58   3e-09
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    57   3e-09
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    57   3e-09
Scas_697.47                                                            57   3e-09
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    57   4e-09
Scas_640.25                                                            57   4e-09
Scas_558.2                                                             56   6e-09
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    56   6e-09
Kwal_27.11626                                                          56   6e-09
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    56   8e-09
Sklu_2398.4 , Contig c2398 9476-10405                                  56   1e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    55   1e-08
Scas_328.1                                                             54   1e-08
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            55   2e-08
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    55   2e-08
Kwal_55.21338                                                          55   2e-08
Kwal_56.23011                                                          54   3e-08
Sklu_2127.4 , Contig c2127 6322-7293                                   54   3e-08
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    54   3e-08
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             54   3e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    54   5e-08
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    54   5e-08
Kwal_26.7967                                                           53   7e-08
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    53   8e-08
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    53   8e-08
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    50   1e-07
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    52   1e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         52   2e-07
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    52   2e-07
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          52   2e-07
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    52   2e-07
Kwal_47.19228                                                          52   2e-07
Scas_715.45                                                            51   3e-07
Kwal_23.4354                                                           52   3e-07
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    51   3e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       51   3e-07
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    51   4e-07
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    51   4e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    50   5e-07
Scas_687.15*                                                           50   7e-07
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    50   9e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    50   9e-07
Kwal_0.232                                                             49   1e-06
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    49   2e-06
Scas_673.17                                                            49   2e-06
Sklu_1275.1 , Contig c1275 314-1249                                    48   3e-06
Kwal_23.5757                                                           48   4e-06
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    47   9e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    46   1e-05
Kwal_23.3529                                                           46   1e-05
Scas_705.9                                                             46   2e-05
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    46   2e-05
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    45   3e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         45   3e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    45   3e-05
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    45   4e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    45   4e-05
Scas_613.24                                                            44   4e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    44   7e-05
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    44   8e-05
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    44   9e-05
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    44   1e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    44   1e-04
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    42   4e-04
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    42   4e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    42   5e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    41   6e-04
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    40   0.001
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    40   0.002
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    39   0.003
Scas_671.1*                                                            37   0.006
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    37   0.010
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    37   0.016
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    37   0.018
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    35   0.097
Kwal_34.15907                                                          34   0.11 
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    33   0.17 
Scas_696.9                                                             33   0.18 
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            33   0.32 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    33   0.33 
YLR401C (DUS3) [3779] chr12 complement(922618..924447) Member of...    33   0.34 
Kwal_55.21106                                                          31   1.2  
Scas_650.9*                                                            30   2.1  
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    28   6.3  
Scas_653.19                                                            28   7.8  

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK 60
           MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK
Sbjct: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK 60

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
           REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT
Sbjct: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
           SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM
Sbjct: 121 SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180

Query: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN 240
           FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN
Sbjct: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN 240

Query: 241 EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE
Sbjct: 241 EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300

Query: 301 LF 302
           LF
Sbjct: 301 LF 302

>Scas_716.29
          Length = 316

 Score =  298 bits (764), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 211/307 (68%), Gaps = 13/307 (4%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH--NKNANVLINIL 59
           +  DHLRK E+V  + SLVAGS+SGL ART IAPLDT+KI+LQ+ P    +  + L+ ++
Sbjct: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68

Query: 60  K-----REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVG 114
           K       G+R FWKGNVPG++MY++YGGAQF SY++  +      D+N   QL S +VG
Sbjct: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVG 126

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
           +LAGMTSS  SYP DVLRTRF AN    L  L      IW+ EG+ GFF GC +SM  I 
Sbjct: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
           L+ +I+FG YESIKI+ +E SK SD  +    L   A  ISG TSK+ T+PLDT+RRRIQ
Sbjct: 187 LSASILFGTYESIKIYCDEYSKESDYTN---YLRYSASSISGVTSKMVTYPLDTIRRRIQ 243

Query: 235 IRNSPNEERH-DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           +RNS   + + + +   +IY+SYK   F+ +G+++++QEG LSLY+GV+MSL K+VPST 
Sbjct: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303

Query: 294 ISLWSYE 300
           +SLW+YE
Sbjct: 304 VSLWAYE 310

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 74/192 (38%), Gaps = 21/192 (10%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKL---QVTPHNKNANVLINILKREGIRGFWKGNVP 73
            SLV G+L+G+ +     P D ++ +    Q    +  ++    I   EGI GF++G   
Sbjct: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180

Query: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRT 133
                 +     FG+Y  I  +       +           S++G+TS + +YP D +R 
Sbjct: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240

Query: 134 RFAANSQGQLI-----KLRDEI-------------MAIWSHEGLMGFFSGCGSSMINIGL 175
           R    +   +      K+  EI             + I   EGL+  + G   S+     
Sbjct: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300

Query: 176 NTAIMFGVYESI 187
           +T +    YE++
Sbjct: 301 STVVSLWAYETV 312

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score =  270 bits (691), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 198/308 (64%), Gaps = 14/308 (4%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN-------KNANV 54
            ++D LRK + V+   +L+AG++SGL AR+  AP+DT+KI+LQ+TP N       +   V
Sbjct: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62

Query: 55  LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVG 114
             +++K EGIR FWKGN+PGS++Y+ YG AQF SY+    +L       +  +L+S +VG
Sbjct: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT---PFGLEARLHSLVVG 119

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
           + AG+TSS+ SYPFDVLRTR  AN+Q   + +  E+  IW  EGL GFF G  +SM  I 
Sbjct: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTL--LNELAGPISGFTSKLATFPLDTVRRR 232
           L  +IMFG YE+I+I+ +E  K +     + L  LN  AG I G  +K+ TFPL+T+RRR
Sbjct: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239

Query: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292
           +Q  NS + E+  R     +Y SYK   F  +G+ +++QEG  SLYRG+ ++L K++P+T
Sbjct: 240 MQFMNSKHLEKFSRH--SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297

Query: 293 AISLWSYE 300
            +S W YE
Sbjct: 298 FVSFWGYE 305

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269
           LAG +SG  ++  T P+DT++ R+Q+  +       + F   +         + V  SM+
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGL----KPFGSQV---------MEVARSMI 67

Query: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           + EG  S ++G     +  V   +    SY LF
Sbjct: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLF 100

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  251 bits (640), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 189/305 (61%), Gaps = 16/305 (5%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-----ANVLIN 57
           +KDHLRK E VS  NS++AGS+SG+FAR   AP+DTVKI+ Q+ P  ++     A+ +  
Sbjct: 6   RKDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRT 65

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           I+K EG+R  WKGN+P + MY++YG  QFGSY++  +          S Q  +  VG+LA
Sbjct: 66  IMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFP-RFSQQGQTLTVGALA 124

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           GMTSS+ SYP D+LRTR  AN       + +E   +W +EG+ GFF+G  ++M  + L+T
Sbjct: 125 GMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLST 184

Query: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237
           AIMF  YE++ I  E   K    R     ++  +G I+GF SK   FP+DT+RRR+Q+ N
Sbjct: 185 AIMFLTYETVNIVCENHEKEFWSRP----VSASSGIIAGFVSKTMVFPIDTLRRRMQVMN 240

Query: 238 SPNEERHDREFTK--DIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
           S    +    FTK   +Y  Y+ +    +   +++QEG  +LYRG+TM L KSVP+TAIS
Sbjct: 241 S----KRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAIS 296

Query: 296 LWSYE 300
           L+ YE
Sbjct: 297 LFVYE 301

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score =  248 bits (632), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 181/307 (58%), Gaps = 22/307 (7%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIK--LQVTPHNKNANVLIN- 57
           +  +DHLRK E VS  +++VAGS+SGL AR+  AP+DTVKI+  LQ+   +K   +L   
Sbjct: 10  LATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTF 69

Query: 58  --ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGS 115
             + + EG+R  WKGNVP S MY++YG  QFG+Y ++ +         + PQ +S  VG+
Sbjct: 70  RTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNT---AAASAGLPPQAHSLAVGA 126

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
           LAG+ SSL +YP D+LRTR  AN       LR +   IW  EG  GFF G   ++    L
Sbjct: 127 LAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTL 186

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
            T ++FG+YE+  I  +              L   A P +G  SK A FPLDTVRRR+QI
Sbjct: 187 TTGLIFGIYETCTIAADTYG--------LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQI 238

Query: 236 RNSPNEERHDREFTKD--IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
            ++    +H   FT+D   Y + +  RFLG+ + MV+ EG  SLY+G+TM+L KS P+T 
Sbjct: 239 VDA----KHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTV 294

Query: 294 ISLWSYE 300
           I+LW Y+
Sbjct: 295 ITLWVYQ 301

>Kwal_23.3965
          Length = 307

 Score =  236 bits (602), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 182/305 (59%), Gaps = 15/305 (4%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN--ANVLIN---I 58
           +DHLRK +EV    SLVAG LSG+ AR   APLDT+KI+LQ+   N+     +L+    +
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG 118
           +++EG+R  WKGNVP   MYI+YG  QF SY  +   L       +  Q+++ +VG+L+G
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSG 119

Query: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178
             S++ASYP DVLRTRF AN   +L  +      IW HEG  GFF G  SS+++I + T+
Sbjct: 120 TCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATS 179

Query: 179 IMFGVYESIKIFTEERSKLSDRRDP-FTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237
            +   YES+KIF E+R    DR      LL   A  I+G  SK   FP+DTVR+R Q+ +
Sbjct: 180 SILATYESVKIFCEQR---PDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236

Query: 238 SPN--EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
                   H  +  K  YKSY +  FL + + +V++EG L+LY G T+ + KSVPST +S
Sbjct: 237 WQQLGHPGHTNKAYKA-YKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVS 295

Query: 296 LWSYE 300
           L  YE
Sbjct: 296 LGVYE 300

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  107 bits (267), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 151/324 (46%), Gaps = 46/324 (14%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNA-NVLINI 58
           K+ L++D  V+     +AG ++G  +RT ++P + VKI LQV    T +NK   + +  +
Sbjct: 16  KNFLKQDTNVA----FLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RG-GLDLNISPQLYSCL 112
            K E I+G ++GN    I    Y   QF  +      +     +G G  LN   +L+S  
Sbjct: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS-- 129

Query: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQG--QLIKLRDEIMA----IW--------SHEG 158
            G+L G  S +A+YP D++RTR +  +    +L K R   +A    +W           G
Sbjct: 130 -GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIKIFT-EERSKLSDRRDPFTLLNELAGPISGF 217
           +MG + G   + + I    A+ F VYE +K F   + +  S  RD    L+   G ISG 
Sbjct: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLS--MGAISGG 246

Query: 218 TSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSL 277
            ++  T+P D +RRR Q+      E             +         +++ + EG    
Sbjct: 247 VAQTITYPFDLLRRRFQVLAMGGNEL-----------GFHYNSVWDALVTIGKTEGFKGY 295

Query: 278 YRGVTMSLIKSVPSTAISLWSYEL 301
           Y+G+T +L K VPSTA+S   YEL
Sbjct: 296 YKGLTANLFKVVPSTAVSWLVYEL 319

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251
           EE ++L +     T +  LAG I+G  S+    P + V+  +Q+++S             
Sbjct: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTT----------- 58

Query: 252 IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
              +Y    F  +G  + ++E    L+RG  ++ I+  P +A+    +E
Sbjct: 59  ---AYNKGLFDAIG-QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 148/342 (43%), Gaps = 55/342 (16%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT-PH-NKNANVLI--- 56
           N +  + K+       S +AG +SG  A+T IAPLD +KI  Q + PH +K A  L+   
Sbjct: 5   NNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLY 64

Query: 57  ----NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL 112
               +I   +GIRGF++G+    +    Y   +F +Y  I S L    +           
Sbjct: 65  EAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE--SHWRRLA 122

Query: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIW---SHEGL---------- 159
            GSLAG+ S   +YP D+ R R A  ++ + +KLRD +  I+   + EGL          
Sbjct: 123 SGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWF 182

Query: 160 ---MGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE------------------ERSKLS 198
                F+ G   +++ +     + F  ++ I    +                  ER KL 
Sbjct: 183 AHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLR 242

Query: 199 DRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKN 258
            +    T    +AG +SG  S+ A +PL+ +RRR+Q+      + +D +F          
Sbjct: 243 QKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKF---------- 292

Query: 259 RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           +    +   + Q++G    + G+++  IK  P  A S + YE
Sbjct: 293 QSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 89/203 (43%), Gaps = 22/203 (10%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANS------QGQLIKLRDEIMAIWSHEGLMGFF 163
           S L G ++G  +     P D ++  F  ++       G L+ L +    IW ++G+ GFF
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 164 SGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPISGFTSKLA 222
            G   +++ I    A+ F  YE I      RS L   R+  +    LA G ++G  S   
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQI------RSILIPSREYESHWRRLASGSLAGLCSVFI 134

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKS-YKNRRFLGVGISMVQQE---GPLSLY 278
           T+PLD  R R+          H R   +DI K+ Y      G+   ++  +      + Y
Sbjct: 135 TYPLDLTRVRLAYVTE-----HKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFY 189

Query: 279 RGVTMSLIKSVPSTAISLWSYEL 301
           RG   +++  +P   +S ++++L
Sbjct: 190 RGYVPTVLGMIPYAGVSFFAHDL 212

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 89/226 (39%), Gaps = 49/226 (21%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ-VTPHN--KNANVLINILKREGIRG- 66
           E  S    L +GSL+GL +     PLD  +++L  VT H   K  +++  I       G 
Sbjct: 113 EYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGL 172

Query: 67  ---------------FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL-------DLNI 104
                          F++G VP  +  I Y G  F ++  I   ++  L        L+ 
Sbjct: 173 TSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSS 232

Query: 105 SPQL-------------YSCLV-GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI 150
             +L             ++ LV G L+G+ S  A+YP +++R R   ++     K+ D  
Sbjct: 233 QEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPR-KMYDHK 291

Query: 151 MA--------IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
                     I+  +G  GFF G     I +    A  F VYE +K
Sbjct: 292 FQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/110 (20%), Positives = 47/110 (42%), Gaps = 11/110 (10%)

Query: 191 TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTK 250
           T  R  +      + + + LAG +SG  +K    PLD ++   Q  N      H  ++  
Sbjct: 4   TNNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNP-----HYSKYAG 58

Query: 251 DIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
            +   Y+  + + +       +G    ++G +++L++  P  A+   +YE
Sbjct: 59  SLVGLYEAAKHIWI------NDGIRGFFQGHSVTLLRIFPYAAVKFVAYE 102

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 97.4 bits (241), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 144/324 (44%), Gaps = 49/324 (15%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKN-ANVLINI 58
           K  L+ D  V+     +AG L+G  +RT ++P + VKI LQV    T +N+     +  +
Sbjct: 15  KSILKNDSNVA----FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQV 70

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL------RGGLDLNISPQLYSCL 112
            + EG  G ++GN    I    Y   QF  Y             +G   L    +L+S  
Sbjct: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFS-- 128

Query: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR--------------DEIMAIWSHEG 158
            G+L G  S LA+YP D++RTR +  +   L KL               D +   +  EG
Sbjct: 129 -GALCGGCSVLATYPLDLVRTRLSIQT-ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186

Query: 159 -LMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGF 217
            + G + G   + + +    A+ F VYE  K F  E +   +    F  L+   G +SG 
Sbjct: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLS--IGALSGG 242

Query: 218 TSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSL 277
            ++  T+P D +RRR Q+      E   R      YKS  +       I++ + EG    
Sbjct: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFR------YKSVMDAL-----ITIGKTEGFRGY 291

Query: 278 YRGVTMSLIKSVPSTAISLWSYEL 301
           Y+G+T +L K +PSTA+S   YE+
Sbjct: 292 YKGLTANLFKVIPSTAVSWLVYEV 315

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 90/206 (43%), Gaps = 24/206 (11%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA------------ 52
           D  +  E++     L +G+L G  +     PLD V+ +L +   N               
Sbjct: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171

Query: 53  ----NVLINILKREG-IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ 107
               ++L    K EG I+G ++G  P S+  + Y    F  Y     F+  G D N    
Sbjct: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLAN 230

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG------QLIKLRDEIMAIWSHEGLMG 161
            Y   +G+L+G  +   +YPFD+LR RF   + G      +   + D ++ I   EG  G
Sbjct: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESI 187
           ++ G  +++  +  +TA+ + VYE +
Sbjct: 291 YYKGLTANLFKVIPSTAVSWLVYEVV 316

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 102/222 (45%), Gaps = 26/222 (11%)

Query: 90  TYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRF------AANSQGQL 143
           +Y+ S L+   D N++      L G LAG  S     PF+ ++          A +QG +
Sbjct: 12  SYVKSILKN--DSNVA-----FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIV 64

Query: 144 IKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRR 201
             +R     ++  EG  G F G G + I I   +A+ F VYE+ K   F  + SK  ++ 
Sbjct: 65  GAVRQ----VYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120

Query: 202 DPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRF 261
             +  L   +G + G  S LAT+PLD VR R+ I+ + N  +  +    +I K       
Sbjct: 121 QNWQRL--FSGALCGGCSVLATYPLDLVRTRLSIQTA-NLTKLSKSRAHNISKPPGVWDL 177

Query: 262 LGVGISMVQQEGPLS-LYRGVTMSLIKSVPSTAISLWSYELF 302
           L       ++EG +  LYRGV  + +  VP  A++   YE F
Sbjct: 178 L---CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 94.0 bits (232), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 141/323 (43%), Gaps = 44/323 (13%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI-----NI 58
           KD L++D  ++     +AG ++G  +RT ++P + VKI LQV     + N  I      +
Sbjct: 15  KDFLKQDSNIA----FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL------RGGLDLNISPQLYSCL 112
              EG +G ++GN    I    Y   QF  Y      L       G   L  + +L+S  
Sbjct: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS-- 128

Query: 113 VGSLAGMTSSLASYPFDVLRTRFA---AN------SQGQLIKLRDEIMAIWSHE-----G 158
            G+L G  S +A+YP D+++TR +   AN      S+ + I     I  + S       G
Sbjct: 129 -GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGG 187

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFT 218
           L G + G   + + +    A+ F VYE ++ F    S          L     G ISG  
Sbjct: 188 LRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKS-NLYKLTIGAISGGV 246

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
           ++  T+P D +RRR Q+      E   R      Y S  +       +++ + EG    Y
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELGFR------YTSVWDAL-----VTIGRAEGVSGYY 295

Query: 279 RGVTMSLIKSVPSTAISLWSYEL 301
           +G+  +L K VPSTA+S   YE+
Sbjct: 296 KGLAANLFKVVPSTAVSWLVYEV 318

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 25/203 (12%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA----------------N 53
            E+++ T  L +G+L G  +     PLD +K +L +   N ++                 
Sbjct: 117 QEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQ 176

Query: 54  VLINILKREG-IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS--PQLYS 110
           +L    + EG +RG ++G  P S+  + Y    F  Y  +  F     D   S    LY 
Sbjct: 177 LLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK 236

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQG------QLIKLRDEIMAIWSHEGLMGFFS 164
             +G+++G  +   +YPFD+LR RF   + G      +   + D ++ I   EG+ G++ 
Sbjct: 237 LTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYK 296

Query: 165 GCGSSMINIGLNTAIMFGVYESI 187
           G  +++  +  +TA+ + VYE +
Sbjct: 297 GLAANLFKVVPSTAVSWLVYEVV 319

>Scas_379.2
          Length = 301

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 135/305 (44%), Gaps = 33/305 (10%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK---R 61
           D+    +    ++ L+AG+ +G+   + + P+D +K ++Q T     +N+L  + K    
Sbjct: 13  DYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTA 72

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116
           EG    WKG     +  +I G        F +Y Y   +L    D+     L + L G++
Sbjct: 73  EGSLALWKG-----VQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTV 127

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM-INIGL 175
           A + +     PFD L+ R   N+   +  +  +   I+ +EG   F+    +++ +NI  
Sbjct: 128 ATIAADALMNPFDTLKQRMQLNTNTTVWNVTKQ---IYKNEGFSAFYYSYPTTLAMNIPF 184

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
             A  F +YES   F       +   D   L++ L+G +SG T    T PLD ++  +Q+
Sbjct: 185 -AAFNFMIYESATKF------FNPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQV 237

Query: 236 RNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
           R S +      +      K+ K         ++ Q  G    +RG+   +  ++P+TAI+
Sbjct: 238 RGSESVSLQVMKEANTFQKATK---------AIYQVHGAKGFWRGLQPRVFANMPATAIA 288

Query: 296 LWSYE 300
             +YE
Sbjct: 289 WTAYE 293

>Kwal_14.2210
          Length = 315

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 129/306 (42%), Gaps = 42/306 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN-----VLINILKREGIRGFWKGNV 72
           +  AG ++G  +RT ++P + VKI LQV       N      +  +   EG+ G  +GN 
Sbjct: 20  AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNG 79

Query: 73  PGSIMYIIYGGAQFGSYTYIG-SFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVL 131
              I    Y   QF  Y +    + +   D  +    +  + G+L G  S LA+YP D++
Sbjct: 80  LNCIRIFPYSAVQFLVYEFCKKQWFQQNPD-TVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 132 RTRFAANSQGQLIKLRDEIM-------AIW--------SHEGLMGFFSGCGSSMINIGLN 176
           RTR +  +   L +L             +W           G+ G + G   + I +   
Sbjct: 139 RTRLSIQT-ANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPY 197

Query: 177 TAIMFGVYESIKIFTEERSKLSDRRDPFT--LLNELAGPISGFTSKLATFPLDTVRRRIQ 234
            A+ F VYE +      R  +    DP +  L     G ISG  ++  T+P D +RRR Q
Sbjct: 198 VALNFAVYEQL------REYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQ 251

Query: 235 IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
           +      E          YKS  +       I++ + EG    Y+G+T +L K VPSTA+
Sbjct: 252 VLAMGQSELGFH------YKSVPDAL-----ITIGRTEGFKGYYKGLTANLFKVVPSTAV 300

Query: 295 SLWSYE 300
           S   YE
Sbjct: 301 SWVVYE 306

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 97/215 (45%), Gaps = 26/215 (12%)

Query: 3   KKDHLRKDEEVSTTN--SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN----------- 49
           KK   +++ +    N   LV+G+L G  +     PLD V+ +L +   N           
Sbjct: 100 KKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAAS 159

Query: 50  -KNANVLINILKRE-----GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN 103
                 +  +L++      GI G ++G  P SI  + Y    F  Y  +  ++    D  
Sbjct: 160 AAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFD-P 218

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQ------LIKLRDEIMAIWSHE 157
            S  LY   +G+++G  +   +YPFD+LR RF   + GQ         + D ++ I   E
Sbjct: 219 ASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTE 278

Query: 158 GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192
           G  G++ G  +++  +  +TA+ + VYE+++ + +
Sbjct: 279 GFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQ 313

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 137/296 (46%), Gaps = 37/296 (12%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV-----LINILKREGIRGFWKGN 71
           + L+AG+ +G+   + + P+D +K ++Q    NK A+      +  I   EG    WKG 
Sbjct: 25  SQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKG- 83

Query: 72  VPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
               +  +I G        FG+Y +  + L    D+     + + L G++A + +     
Sbjct: 84  ----VQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMN 139

Query: 127 PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM-INIGLNTAIMFGVYE 185
           PFD ++ R   ++    +++ +    I+ +EG   F+    +++ +NI    A  F +YE
Sbjct: 140 PFDTVKQRLQLDTN---LRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPF-AAFNFMIYE 195

Query: 186 SI-KIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH 244
           S  K F  + S      +P  L++ L G ISG T    T PLD ++  +Q+R S   E  
Sbjct: 196 SASKFFNPQNS-----YNP--LIHCLCGGISGATCAALTTPLDCIKTVLQVRGS---ETV 245

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
             E  KD     +  R      ++++  G    +RG+   ++ ++P+TAIS  +YE
Sbjct: 246 SIEIMKDANTFGRASR------AILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 81/198 (40%), Gaps = 14/198 (7%)

Query: 4   KDHLRKDEEVSTTNSL---VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK 60
           K  L   E++ T   +   ++G+++ + A   + P DTVK +LQ+  + +  NV   I +
Sbjct: 106 KARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVTKQIYQ 165

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
            EG   F+        M I +    F  Y     F       N    L  CL G ++G T
Sbjct: 166 NEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYN---PLIHCLCGGISGAT 222

Query: 121 SSLASYPFD----VLRTRFAANSQGQLIKLRDEI----MAIWSHEGLMGFFSGCGSSMIN 172
            +  + P D    VL+ R +     +++K  +       AI    G  GF+ G    ++ 
Sbjct: 223 CAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVA 282

Query: 173 IGLNTAIMFGVYESIKIF 190
               TAI +  YE  K F
Sbjct: 283 NIPATAISWTAYECAKHF 300

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 38/94 (40%), Gaps = 14/94 (14%)

Query: 17  NSLVAGSLSGLFARTCIA---PLDTVKIKLQVTPHN-------KNANVL----INILKRE 62
           N L+     G+   TC A   PLD +K  LQV           K+AN        IL+  
Sbjct: 208 NPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVH 267

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL 96
           G +GFW+G  P  +  I      + +Y     FL
Sbjct: 268 GWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 133/311 (42%), Gaps = 31/311 (9%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVL---IN 57
           +H+   +  +   +LVAG  +GLF   C  PLDT+K+++Q+        K    L    N
Sbjct: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           I   EG+  F+KG     I  I     +F SY +  + L       +     + L G  A
Sbjct: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-ADRQTGVVSTGNTFLAGVGA 165

Query: 118 GMTSS-LASYPFDVLRTRFAA---NSQGQLIKLRDEIMA---IWSHEGLMGFFSGCGSSM 170
           G+T + L   P +V++ R  A   +   +  K R+ I A   I   EG+   + G   + 
Sbjct: 166 GVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
                N    F VY  +    E   +    ++  +    L G +SG     +  PLDT++
Sbjct: 226 ARQATNQGANFTVYSKL---MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
            R+Q      +++  R  +  +       R   +G  +VQ+EG  +LY+G+T  +++  P
Sbjct: 283 TRLQ------KDKSTRNLSNWV-------RITTIGRQLVQEEGFRALYKGITPRVMRVAP 329

Query: 291 STAISLWSYEL 301
             A++   YE 
Sbjct: 330 GQAVTFTVYEF 340

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 82/199 (41%), Gaps = 14/199 (7%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQV------TPHNKNANVLIN--- 57
           R+   VST N+ +AG  +G+  A   + P++ VKI+LQ           K  N +     
Sbjct: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL 207

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           I+K EGI   ++G    +       GA F  Y+ +   L+        P   + L+G ++
Sbjct: 208 IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVS 267

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIW----SHEGLMGFFSGCGSSMINI 173
           G     ++ P D ++TR   +   + +     I  I       EG    + G    ++ +
Sbjct: 268 GAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRV 327

Query: 174 GLNTAIMFGVYESIKIFTE 192
               A+ F VYE ++   E
Sbjct: 328 APGQAVTFTVYEFVRRHLE 346

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 195 SKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYK 254
           + +S ++     +N +AG  +G    L   PLDT++ R+QI    NE             
Sbjct: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANE------------- 93

Query: 255 SYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
             K   FL  G ++   EG L+ Y+G+   +I  +P  AI   SYE +
Sbjct: 94  GTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFY 141

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 9/106 (8%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINI-- 58
           M +       + + +  + + G +SG       APLDT+K +LQ     +N +  + I  
Sbjct: 243 MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITT 302

Query: 59  -----LKREGIRGFWKGNVPGSIMYIIYGGA-QFGSYTYIGSFLRG 98
                ++ EG R  +KG  P  +M +  G A  F  Y ++   L G
Sbjct: 303 IGRQLVQEEGFRALYKGITP-RVMRVAPGQAVTFTVYEFVRRHLEG 347

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 136/324 (41%), Gaps = 55/324 (16%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVT-PH-NKNANVLINILK-------REGIRGFWKG 70
           +AG +SG  A+T IAPLD +KI  Q + PH  K    LI +++        +G+RGF++G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           +    +    Y   +F +Y  I + L    +          + GSLAG+ S   +YP D+
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE--SHWRRLVSGSLAGLCSVFITYPLDL 155

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSHEG---------------------------LMGFF 163
           +R R A  ++ + +KL   I  I+                               ++G  
Sbjct: 156 VRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMI 215

Query: 164 SGCGSSMINIGLNTAIM----FGVYESIKIFTE---ERSKLSDRRDPFTLLNELAGPISG 216
              G S     L   ++    F  Y  +++  +   ER +   RR   T    ++G ++G
Sbjct: 216 PYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAG 275

Query: 217 FTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLS 276
             S+ A +P + +RRR+Q+     +  +D +F          +    +   + ++ G   
Sbjct: 276 MASQTAAYPFEIIRRRLQVSALSPKTMYDHKF----------QSISEIAHIIFKERGVRG 325

Query: 277 LYRGVTMSLIKSVPSTAISLWSYE 300
            + G+++  IK  P  A S + YE
Sbjct: 326 FFVGLSIGYIKVTPMVACSFFVYE 349

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 92/219 (42%), Gaps = 26/219 (11%)

Query: 94  SFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANS------QGQLIKLR 147
           SF R   D  +     S L G ++G  +     P D ++  F  ++       G LI L 
Sbjct: 24  SFDRNSFDYIVR----SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLV 79

Query: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLL 207
           +    IW ++G+ GFF G  ++++ I    A+ F  YE I      R+ L   ++  +  
Sbjct: 80  EAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQI------RNTLIPSKEFESHW 133

Query: 208 NEL-AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDR----EFTKDIYKSYKNRRFL 262
             L +G ++G  S   T+PLD VR R+       E  H R       K IYK   +   +
Sbjct: 134 RRLVSGSLAGLCSVFITYPLDLVRVRLAY-----ETEHKRVKLGRIIKKIYKEPASATLI 188

Query: 263 GVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                        + YRG   +++  +P   +S ++++L
Sbjct: 189 KNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDL 227

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 90/217 (41%), Gaps = 47/217 (21%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILKREGIRG---------- 66
           LV+GSL+GL +     PLD V+++L     +K   +  +I  + +E              
Sbjct: 136 LVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPN 195

Query: 67  -------FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGG-------LDLNISPQL---- 108
                  F++G VP  +  I Y G  F ++  +   L+         L+L+   +L    
Sbjct: 196 WFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQ 255

Query: 109 ---------YSCLV-GSLAGMTSSLASYPFDVLRTRFAANS-------QGQLIKLRDEIM 151
                    ++ L+ G LAGM S  A+YPF+++R R   ++         +   + +   
Sbjct: 256 KKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAH 315

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
            I+   G+ GFF G     I +    A  F VYE +K
Sbjct: 316 IIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 31.2 bits (69), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----------ANVLIN 57
           ++   + T   L++G L+G+ ++T   P + ++ +LQV+  +            + +   
Sbjct: 257 KQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHI 316

Query: 58  ILKREGIRGFWKG 70
           I K  G+RGF+ G
Sbjct: 317 IFKERGVRGFFVG 329

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 50/117 (42%), Gaps = 11/117 (9%)

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
           Y+ I   T +++        + + + LAG ISG  +K    PLD ++   Q  N      
Sbjct: 12  YKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNP----- 66

Query: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           H  ++T  +    +  + + +       +G    ++G + +L++  P  A+   +YE
Sbjct: 67  HYTKYTGSLIGLVEAAKHIWI------NDGVRGFFQGHSATLLRIFPYAAVKFVAYE 117

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 133/311 (42%), Gaps = 47/311 (15%)

Query: 14  STTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--------TPHNKN-ANVLINILKREGI 64
           ST  + ++G+ +G  +   + PLD  K +LQ          P+ +     L  I++ EG 
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQL----YSCLVGSLAGMT 120
           RG +KG VP  + Y       F  Y +   F  G     I PQ      SC     AG  
Sbjct: 136 RGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHG-----IFPQFDFVAQSC-AAITAGAA 189

Query: 121 SSLASYPFDVLRTRFAANSQ-----GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
           S+  + P  V++TR    S             D    ++  EG    ++G   S++ +  
Sbjct: 190 STTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-F 248

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE----LAGPISGFTSKLATFPLDTVRR 231
           + AI F +YE +K+    R     R +    +N     +A  +S   +   T+P + +R 
Sbjct: 249 HVAIHFPIYEDLKV----RFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRT 304

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
           R+Q+++             DI  S + R F  +  +  Q EG    Y G T +L++++P+
Sbjct: 305 RMQLKS-------------DIPDSIQRRLFPLIKATYAQ-EGLKGFYSGFTTNLVRTIPA 350

Query: 292 TAISLWSYELF 302
           +AI+L S+E F
Sbjct: 351 SAITLVSFEYF 361

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 81/205 (39%), Gaps = 32/205 (15%)

Query: 92  IGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDE-- 149
           IG+ LR    + +S    + L G+ AG  S +A  P DV +TR     Q Q ++ R E  
Sbjct: 63  IGTTLRKKW-VPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRL----QAQGLQTRFENP 117

Query: 150 ----IMAIWS----HEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRR 201
               IM   S     EG  G + G    ++       I F VYE  K F        D  
Sbjct: 118 YYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFD-- 175

Query: 202 DPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRF 261
               +    A   +G  S   T P+  V+ R+ ++++  E     + T D ++       
Sbjct: 176 ---FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFR------- 225

Query: 262 LGVGISMVQQEGPLSLYRGVTMSLI 286
                 +  QEG  +LY G+  SL+
Sbjct: 226 -----KLFYQEGFKALYAGLVPSLL 245

>Scas_717.20
          Length = 356

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 138/331 (41%), Gaps = 61/331 (18%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVT-PH-NKNANVLI-------NILKREGIRG 66
           T S +AG +SG  A+T IAPLD +KI  Q + PH  K A  L+       +I   +GIRG
Sbjct: 33  TRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRG 92

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
           F++G+    +    Y   +F +Y  I + L    +          + GSLAG+ S   +Y
Sbjct: 93  FFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE--SHWRRLMSGSLAGLCSVFTTY 150

Query: 127 PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEG----------------LMGFFSGCGSSM 170
           P D++R R A  ++ + I L   +  I+                       F+ G   ++
Sbjct: 151 PLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTV 210

Query: 171 INIGLNTAIMFGVYE--------------SIKIFTE---ERSKLSDRRDPFTLLNE-LAG 212
           + +     + F  ++              S+   +E   E      +R P     E L+G
Sbjct: 211 LGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSG 270

Query: 213 PISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFT--KDIYK-SYKNRRFLGVGISMV 269
            ++G  S+ A +P + +RRR+Q+      + +D  F    +I K  YK R + G      
Sbjct: 271 GLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRG------ 324

Query: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                   + G+++  IK  P  A S + YE
Sbjct: 325 -------FFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 87/204 (42%), Gaps = 22/204 (10%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANS------QGQLIKLRDEIMAIWSHEGLMGFF 163
           S L G ++G  +     P D ++  F  ++       G L+ L++    IW ++G+ GFF
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 164 SGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL-AGPISGFTSKLA 222
            G   +++ I    A+ F  YE I      R+ L   ++  +    L +G ++G  S   
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQI------RNTLIPSKEYESHWRRLMSGSLAGLCSVFT 148

Query: 223 TFPLDTVRRRIQIRNSPNEERHDR----EFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
           T+PLD +R R+          H R       K IYK   +      G          + Y
Sbjct: 149 TYPLDLIRVRLAYVTE-----HKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFY 203

Query: 279 RGVTMSLIKSVPSTAISLWSYELF 302
           RG T +++  +P   +S ++++L 
Sbjct: 204 RGYTPTVLGMIPYAGVSFFAHDLL 227

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 90/226 (39%), Gaps = 47/226 (20%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVL--INILKREGIR-- 65
            E  S    L++GSL+GL +     PLD ++++L     +K  ++L  +  + +E     
Sbjct: 126 KEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTT 185

Query: 66  ---------------GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGG-------LDLN 103
                           F++G  P  +  I Y G  F ++  +   L+         L L+
Sbjct: 186 LEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALS 245

Query: 104 ISPQ--------------LYSCLVGSLAGMTSSLASYPFDVLRTRFAAN--SQGQLIKLR 147
            S Q                  L G LAGM S  A+YPF+++R R   +  S  Q+   R
Sbjct: 246 ESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHR 305

Query: 148 DEIMA-----IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
            + ++     I+   G  GFF G     I +    A  F VYE +K
Sbjct: 306 FQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 135/315 (42%), Gaps = 43/315 (13%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--NI 58
           M+  D+          + L+AG+ +G+   + + P+D +K ++Q    + NA  L   N+
Sbjct: 19  MDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQ----SANAKSLSAKNM 74

Query: 59  LKR-------EGIRGFWKGNVPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISP 106
           L +       EG    WKG     +  +I G        FG+Y +    L    D     
Sbjct: 75  LSQISHISTSEGTLALWKG-----VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHH 129

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGC 166
              + + G+ A   S     PFD ++ R   N+   + +   +I   +  EGL  F+   
Sbjct: 130 PFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQI---YQSEGLAAFYYSY 186

Query: 167 GSSMI-NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFP 225
            ++++ NI    A  F +YES   F       S+  +P  L++ L G ISG T    T P
Sbjct: 187 PTTLVMNIPF-AAFNFVIYESSTKFLNP----SNEYNP--LIHCLCGSISGSTCAAITTP 239

Query: 226 LDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSL 285
           LD ++  +QIR S       +  + +I +  K   F     ++ Q  G    +RG    +
Sbjct: 240 LDCIKTVLQIRGS-------QTVSLEIMR--KADTFSKAASAIYQVYGWKGFWRGWKPRI 290

Query: 286 IKSVPSTAISLWSYE 300
           + ++P+TAIS  +YE
Sbjct: 291 VANMPATAISWTAYE 305

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 128/294 (43%), Gaps = 34/294 (11%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN----ILKREGIRGFWKGNV 72
           + L+AG+ +G+   + + P+D +K ++Q +        LI     I   EG    WKG  
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKG-- 75

Query: 73  PGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYP 127
              +  +I G        F +Y +  S L    D++    + + + G  A   +     P
Sbjct: 76  ---VQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNP 132

Query: 128 FDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYES 186
           FDV++ R   N++  +  +   I   +  EG   F+    ++++ NI    A  F +YES
Sbjct: 133 FDVIKQRMQLNTRESVWHVTKNI---YHKEGFAAFYYSYPTTLVMNIPF-AAFNFAIYES 188

Query: 187 IKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDR 246
              F       S+  +PF  ++ ++G +SG T    T PLD ++  +Q+R S   E    
Sbjct: 189 ATKFMNP----SNEYNPF--IHCISGGLSGATCAAITTPLDCIKTVLQVRGS---ETVSN 239

Query: 247 EFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           E  K      +   F     ++ +  G     RG+   +I ++P+TAIS  SYE
Sbjct: 240 EIMK------QANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 30/200 (15%)

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK-LRDEIMAIWSHEGLMGFF 163
           +P  +  L G+ AG+      +P D ++TR  ++S G   + L  +I  I + EG +  +
Sbjct: 14  APLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALW 73

Query: 164 SGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFT---LLNELAGPISGFTSK 220
            G  S ++  G   A+ F  YE        +SKL D +D  T   +   ++G  +   + 
Sbjct: 74  KGVQSVILGAGPAHAVYFATYEF------SKSKLIDPQDMHTHQPIKTAISGMAATTVAD 127

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
               P D +++R+Q+    N        TK+IY                 +EG  + Y  
Sbjct: 128 ALMNPFDVIKQRMQL----NTRESVWHVTKNIY----------------HKEGFAAFYYS 167

Query: 281 VTMSLIKSVPSTAISLWSYE 300
              +L+ ++P  A +   YE
Sbjct: 168 YPTTLVMNIPFAAFNFAIYE 187

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 15/193 (7%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTC----IAPLDTVKIKLQVTPHNKNANVLINILKREGIR 65
           D +   T+  +  ++SG+ A T     + P D +K ++Q+       +V  NI  +EG  
Sbjct: 103 DPQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESVWHVTKNIYHKEGFA 162

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125
            F+       +M I +    F  Y     F+    + N  P ++ C+ G L+G T +  +
Sbjct: 163 AFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYN--PFIH-CISGGLSGATCAAIT 219

Query: 126 YPFD----VLRTRFAANSQGQLIKLRDEIM----AIWSHEGLMGFFSGCGSSMINIGLNT 177
            P D    VL+ R +     +++K  +       AI+   G  GF  G    +I     T
Sbjct: 220 TPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPAT 279

Query: 178 AIMFGVYESIKIF 190
           AI +  YE  K F
Sbjct: 280 AISWTSYECAKHF 292

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 139/318 (43%), Gaps = 49/318 (15%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN----------- 53
           D+    +     + L+AG+ +G+   + I PLD +K +LQ   H  +             
Sbjct: 8   DYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAM-HAISTTGGQPIPSTMLR 66

Query: 54  VLINILKREGIRGFWKGNVPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQL 108
            L +I  +EG    WKG     +  ++ G        F +Y  + SFL   +D   S   
Sbjct: 67  QLSSISAQEGSMVLWKG-----VQSVLLGAGPAHAVYFATYEMVKSFL---IDEATSTSK 118

Query: 109 YSCLVGSLAGMTSSLAS----YPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFS 164
           Y     + +G T+++A+     PFDV++ R   N+    I + D    I+S EG   F+S
Sbjct: 119 YHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN---ISVWDTAKRIYSKEGFQAFYS 175

Query: 165 GCGSSM-INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLAT 223
              +++ INI    A  FG+Y++   +       S   +PF  ++ L G ISG      T
Sbjct: 176 SYPTTLAINIPF-AAFNFGIYDTATRYFNP----SGVYNPF--IHCLCGGISGAACAGLT 228

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            PLD ++  +Q+R S   E+   E  K      K  R      ++ Q  G    + GV  
Sbjct: 229 TPLDCIKTALQVRGS---EKVSMEVFKQADTFKKATR------AIYQVYGWRGFWSGVKP 279

Query: 284 SLIKSVPSTAISLWSYEL 301
            ++ ++P+TAIS  +YE 
Sbjct: 280 RILANMPATAISWTAYEF 297

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 79/194 (40%), Gaps = 16/194 (8%)

Query: 10  DEEVSTTN-----SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGI 64
           DE  ST+      +  +G+ + + A   + P D +K ++Q+  +    +    I  +EG 
Sbjct: 111 DEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISVWDTAKRIYSKEGF 170

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
           + F+        + I +    FG Y     +       N  P ++ CL G ++G   +  
Sbjct: 171 QAFYSSYPTTLAINIPFAAFNFGIYDTATRYFNPSGVYN--PFIH-CLCGGISGAACAGL 227

Query: 125 SYPFDVLRT----RFAANSQGQLIKLRDEIM----AIWSHEGLMGFFSGCGSSMINIGLN 176
           + P D ++T    R +     ++ K  D       AI+   G  GF+SG    ++     
Sbjct: 228 TTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPA 287

Query: 177 TAIMFGVYESIKIF 190
           TAI +  YE  K F
Sbjct: 288 TAISWTAYEFAKHF 301

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 34/91 (37%), Gaps = 17/91 (18%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKRE--------------GIR 65
           + G +SG        PLD +K  LQV    K   V + + K+               G R
Sbjct: 215 LCGGISGAACAGLTTPLDCIKTALQVRGSEK---VSMEVFKQADTFKKATRAIYQVYGWR 271

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL 96
           GFW G  P  +  +      + +Y +   FL
Sbjct: 272 GFWSGVKPRILANMPATAISWTAYEFAKHFL 302

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 132/319 (41%), Gaps = 50/319 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI------------------KLQVTPHNKN-------AN 53
            +AG +SG+ +RTC AP D +K+                   L   PH K          
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 54  VLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL---RGGLDLNISPQLYS 110
            +I++ ++ GI+ F+ GN   ++        +FGS+      +       D     +L +
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIM----AIWSHEGLMGFFSGC 166
            + G LAG+ +  + YP D L+ R         +K R  ++     +++  GL  F+ G 
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 167 GSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLAT- 223
              ++ I    A+  G +  +K    + +  KL+ + +   L N +  P+  F+      
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 224 --FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
             +P++ +R R+Q + +                 Y+   F  V +  +Q+EG   L++G+
Sbjct: 444 VVYPINLLRTRLQAQGT-------------FAHPYRYDGFRDVLLKTIQREGYPGLFKGL 490

Query: 282 TMSLIKSVPSTAISLWSYE 300
             +L K  P+ +IS   YE
Sbjct: 491 VPTLAKVCPAVSISYLCYE 509

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 97/210 (46%), Gaps = 25/210 (11%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLIN 57
           M K ++ +  +++S  ++ +AG L+G+ A+  + P+DT+K ++Q  P N   K   ++I 
Sbjct: 306 MTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQ 365

Query: 58  ILKRE----GIRGFWKGNVPGSIMYIIYGGAQFGSYT-----YIGS----FLRGGLDLNI 104
             K      G++ F++G   G +    Y     G+++     YI S      +   D+ +
Sbjct: 366 TAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVEL 425

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEG 158
           S  L    +G+ +G   +   YP ++LRTR  A  QG           RD ++     EG
Sbjct: 426 S-NLVVLPMGAFSGTFGATVVYPINLLRTRLQA--QGTFAHPYRYDGFRDVLLKTIQREG 482

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
             G F G   ++  +    +I +  YE++K
Sbjct: 483 YPGLFKGLVPTLAKVCPAVSISYLCYENLK 512

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 92/214 (42%), Gaps = 37/214 (17%)

Query: 112 LVGSLAGMTSSLASYPFDVLRT------------------RFAANSQGQLIKLRD----E 149
           + G ++G+ S   + PFD L+                     A N   +  KLR      
Sbjct: 205 IAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKA 264

Query: 150 IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE 209
           I++++   G+  F+ G G + + +   ++I FG +E  K    +     D +D   L   
Sbjct: 265 IISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTF 324

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269
           +AG ++G  ++ + +P+DT++ R+Q   +P            +    K R+ +      +
Sbjct: 325 IAGGLAGVCAQFSVYPIDTLKFRMQC--AP------------LNAELKGRKLMIQTAKEM 370

Query: 270 QQEGPLSL-YRGVTMSLIKSVPSTAISLWSYELF 302
             EG L L YRGVT+ ++   P  A+ L ++ + 
Sbjct: 371 YTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSML 404

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 137/307 (44%), Gaps = 40/307 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKN-ANVLINILKREGIRGFWKGNV 72
           + VAG + G  +RT ++P++ VKI LQV    T +N    + +  + K EG++G ++GN 
Sbjct: 19  AFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNG 78

Query: 73  PGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
              +    Y   Q+  Y +  +  F  G             + G+L G  S L +YP D+
Sbjct: 79  INCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDL 138

Query: 131 LRTRFAANSQGQLIKLR--------------DEIMAIWSHEG-LMGFFSGCGSSMINIGL 175
           +RTR +  +   L KL               + +  I+  EG L G++ G   + + +  
Sbjct: 139 VRTRLSIQT-ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPISGFTSKLATFPLDTVRRRIQ 234
             A+ F +YE +K          D         +LA G +SG  ++   +P D +RRR Q
Sbjct: 198 FVALNFALYERLKALIPH-----DYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ 252

Query: 235 IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
           +      E   R      Y S  +  +     ++ +QEG    Y+G+T +L+K VP+ A+
Sbjct: 253 VLTMGQSELGFR------YASVADALW-----TIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 295 SLWSYEL 301
             + YEL
Sbjct: 302 QWFVYEL 308

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 80/176 (45%), Gaps = 24/176 (13%)

Query: 35  PLDTVKIKLQVTPHN-------KNANV-----LINILKR-----EGIRGFWKGNVPGSIM 77
           PLD V+ +L +   N       K  ++     ++ +L+R      G+RG+++G  P S+ 
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA 137
            + +    F  Y  + + +    D   S       +G+++G  +    YPFD+LR RF  
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAG-SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253

Query: 138 NSQGQ------LIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
            + GQ         + D +  I   EGL G++ G  ++++ +    A+ + VYE I
Sbjct: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309

>Kwal_55.21335
          Length = 317

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 139/310 (44%), Gaps = 47/310 (15%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLIN 57
           M+ KD L+          ++ GS++G   +    PLDT+K++LQ  P +    + + +  
Sbjct: 40  MDFKDALK---------DILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKY 90

Query: 58  ILKREG-IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116
             ++EG ++GF++G     +   +     F ++    +FL+     ++SP   + L G+ 
Sbjct: 91  TYQKEGFVKGFYQGVASPLVGAALENAVLFVTFNRAQNFLQQ--YESVSPLSQTVLSGAF 148

Query: 117 AGMTSSLASYPFDVLR-TRFAANSQGQLI---KLRDEIMAIWSHEGLMGFFSGCGSSMIN 172
           AG  +S    P ++++ T   +N +G      K+   +  I  H+G+ G + G  S+ I 
Sbjct: 149 AGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIR 208

Query: 173 IGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL--AGPISGFTSKLATFPLDTVR 230
                A+ F  YES+K +   R     R D      EL  +G  +G     + FP DT++
Sbjct: 209 ECAGGAVWFTTYESLKSYLARR-----RNDTENHTWELLASGASAGVAFNASIFPADTIK 263

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
              Q ++    +   R                     ++ + GP  LYRG+ ++LI++ P
Sbjct: 264 STAQTQHLGIVDATKR---------------------ILARSGPAGLYRGLGITLIRAAP 302

Query: 291 STAISLWSYE 300
           + AI  ++YE
Sbjct: 303 ANAIVFYTYE 312

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 93/197 (47%), Gaps = 22/197 (11%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTC----IAPLDTVKIKLQV-------TPHNKNA 52
           ++ L++ E VS  +  V   LSG FA  C    + P++ +K  LQV       T H+K  
Sbjct: 127 QNFLQQYESVSPLSQTV---LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIW 183

Query: 53  NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQLYS 110
             + +I++ +GI G W+G     I     G   F +Y  + S+L  R     N + +L +
Sbjct: 184 PTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLA 243

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
              G+ AG+  + + +P D +++     +Q Q + + D    I +  G  G + G G ++
Sbjct: 244 S--GASAGVAFNASIFPADTIKS----TAQTQHLGIVDATKRILARSGPAGLYRGLGITL 297

Query: 171 INIGLNTAIMFGVYESI 187
           I      AI+F  YE++
Sbjct: 298 IRAAPANAIVFYTYETL 314

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 136/319 (42%), Gaps = 50/319 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI---------------KLQVTPHNKNANV--------- 54
            +AG +SG+ +RTC AP D +K+               K  +   N NA++         
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 55  -LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTY---IGSFLRGGLDLNISPQLYS 110
            + ++ ++ GI+ F+ GN    I        +FGS+     I + L G  D     +  +
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK----LRDEIMAIWSHEGLMGFFSGC 166
            + G LAGM +  + YP D L+ R         +K    L      ++   GL  F+ G 
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGV 410

Query: 167 GSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTSKL--- 221
              ++ I    A+  G + ++K     ++   L+  +D  TL N +  P+  F+  +   
Sbjct: 411 TVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGAS 470

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
             +P++ +R R+Q + +             +Y  +K+     V +  +++EG   L++G+
Sbjct: 471 VVYPINLLRTRLQAQGTYAHPY--------VYNGFKD-----VLLKTLEREGYQGLFKGL 517

Query: 282 TMSLIKSVPSTAISLWSYE 300
             +L K  P+ +IS   YE
Sbjct: 518 VPTLAKVCPAVSISYLCYE 536

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 25/212 (11%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLIN 57
           M K +  R  +++S  ++ +AG L+G+ A+  + P+DT+K ++Q  P +   K  N+L  
Sbjct: 333 MTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQ 392

Query: 58  ILK---RE-GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQ---- 107
             K   RE G+R F++G   G +    Y     G+++ +  +   +    LN+ PQ    
Sbjct: 393 TAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNL-PQDQVT 451

Query: 108 ---LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEG 158
              L    +G+ +G   +   YP ++LRTR  A  QG           +D ++     EG
Sbjct: 452 LSNLVVLPMGAFSGTVGASVVYPINLLRTRLQA--QGTYAHPYVYNGFKDVLLKTLEREG 509

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
             G F G   ++  +    +I +  YE++K F
Sbjct: 510 YQGLFKGLVPTLAKVCPAVSISYLCYENLKKF 541

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 95/235 (40%), Gaps = 44/235 (18%)

Query: 87  GSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA--------- 137
           G  T I  F+RG             + G ++G+ S   + PFD L+    A         
Sbjct: 216 GDVTLINDFIRG---------FGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILL 266

Query: 138 NSQGQLIK-------------LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           NS+  L+              L   + +++   G+  F+ G G ++I +   ++I FG +
Sbjct: 267 NSKTDLLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSF 326

Query: 185 ESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH 244
           E  K    +     D +D       +AG ++G  ++ + +P+DT++ R+Q   +P +   
Sbjct: 327 EVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQC--APLDT-- 382

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
                    K   N         M ++ G    YRGVT+ ++   P  A+ L ++
Sbjct: 383 ---------KLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTF 428

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 134/314 (42%), Gaps = 42/314 (13%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-------NVLIN 57
           D+    E       L AG+ +G+   + + P+D +K ++Q      ++       N+L  
Sbjct: 7   DYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQ 66

Query: 58  ILK---REGIRGFWKGNVPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQLY 109
           I K    EG    WKG     +  ++ G        F +Y    S L    D      L 
Sbjct: 67  IAKISTTEGSLALWKG-----VQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLK 121

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           + L G+LA + +     PFD ++ R   +    + K     + ++  EG+  FF    ++
Sbjct: 122 TALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCA---VRMYQREGIAAFFYSYPTT 178

Query: 170 M-INIGLNTAIMFGVYES-IKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
           + +NI    A+ F +YES  KIF       S+  +P+  ++ L G ISG T    T PLD
Sbjct: 179 IAMNIPF-AALNFVIYESSTKIFNP-----SNNYNPW--IHCLCGGISGATCAAITTPLD 230

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
            V+  +QIR + + +         ++K     R     I   +  G    +RG+   +I 
Sbjct: 231 CVKTVLQIRGADSVQ-------SQLFKEADTFRKAASAIH--KTYGWSGFFRGLKPRIIS 281

Query: 288 SVPSTAISLWSYEL 301
           ++P+TAIS  SYE 
Sbjct: 282 NMPATAISWTSYEF 295

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 90/210 (42%), Gaps = 16/210 (7%)

Query: 4   KDHLRKDEEVSTTNSL---VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK 60
           K  L   E+  T   L   ++G+L+ + A   + P DT+K +LQ+ P +      + + +
Sbjct: 105 KSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAVRMYQ 164

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
           REGI  F+        M I +    F  Y           + N  P ++ CL G ++G T
Sbjct: 165 REGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYN--PWIH-CLCGGISGAT 221

Query: 121 SSLASYPFD----VLRTRFAANSQGQLIK----LRDEIMAIWSHEGLMGFFSGCGSSMIN 172
            +  + P D    VL+ R A + Q QL K     R    AI    G  GFF G    +I+
Sbjct: 222 CAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIIS 281

Query: 173 IGLNTAIMFGVYESIK--IFTEERSKLSDR 200
               TAI +  YE  K  +FT   + L + 
Sbjct: 282 NMPATAISWTSYEFAKHLLFTNSNAHLDNH 311

>Kwal_26.7972
          Length = 358

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 133/322 (41%), Gaps = 59/322 (18%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVT-PHN-KNANVLINILK-------REGIRGFWKG 70
           +AG ++G  A+T IAPLD +KI  Q + PH  K +   + +++        +GIRGF++G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           +    I    Y   +F +Y  I  F+    +     +  +   GS+AG+ S   +YP D+
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLAS--GSMAGLCSVFMTYPLDL 149

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSHEG---------------------------LMGFF 163
           +R R A  +    IK+   I  I++                              ++G  
Sbjct: 150 IRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMI 209

Query: 164 SGCGSSMINIGLNTAIM----FGVYESIKIFTEE---RSKLSDRRDPFTLLNELAGPISG 216
              G S     L   I+       Y  + I  EE   RSK    R   T    +AG ++G
Sbjct: 210 PYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAG 269

Query: 217 FTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYK-SYKNRRFLGVGISMVQQEGPL 275
             S+ A++P + +RRR+Q+        H+ +   D+ +  YK R + G            
Sbjct: 270 MASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRG------------ 317

Query: 276 SLYRGVTMSLIKSVPSTAISLW 297
             + G+++  IK  P  A S +
Sbjct: 318 -FFVGLSIGYIKVTPMVACSFF 338

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 78/216 (36%), Gaps = 45/216 (20%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRG---- 66
           E  +    L +GS++GL +     PLD ++++L          +L  I +    R     
Sbjct: 122 EYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESL 181

Query: 67  ---------------FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL----------- 100
                          F++G  P  +  I Y G  F ++   G  LR G            
Sbjct: 182 TSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISD 241

Query: 101 -DLNISPQLYSC---------LVGSLAGMTSSLASYPFDVLRTRF-----AANSQGQLIK 145
            +L I  +  S          + G LAGM S  ASYPF+++R R      +  S      
Sbjct: 242 EELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQT 301

Query: 146 LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           + D I  I+   G  GFF G     I +    A  F
Sbjct: 302 IPDMIRIIYKERGWRGFFVGLSIGYIKVTPMVACSF 337

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 89/214 (41%), Gaps = 40/214 (18%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA-------IWSHEGLM 160
           L S L G +AG  +     P D ++  F   S    +K     M        I +H+G+ 
Sbjct: 28  LRSGLAGGIAGSCAKTLIAPLDRIKILFQ-TSNPHYLKYSGSTMGLIRAGAHINAHDGIR 86

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPISGFTS 219
           GF+ G  +++I I    AI F  YE I+ F      +   ++  T    LA G ++G  S
Sbjct: 87  GFYQGHSATLIRIFPYAAIKFIAYEQIRHF------MIPSKEYETHARRLASGSMAGLCS 140

Query: 220 KLATFPLDTVRRRI-------QIRNSP-----NEERHDREFTKDIYKSYKNRRFLGVGIS 267
              T+PLD +R R+       +I+  P       ER     T    KSY  R F      
Sbjct: 141 VFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTS---KSYVPRWFAHW--- 194

Query: 268 MVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                   + YRG T +++  +P   +S ++++L
Sbjct: 195 -------CNFYRGFTPTVLGMIPYAGVSFFAHDL 221

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 199 DRRDPFTLLNE-LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           D+R    +L   LAG I+G  +K    PLD ++   Q  N P+  ++          S  
Sbjct: 20  DKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSN-PHYLKY----------SGS 68

Query: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
               +  G  +   +G    Y+G + +LI+  P  AI   +YE
Sbjct: 69  TMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYE 111

>Kwal_55.20868
          Length = 380

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 138/329 (41%), Gaps = 71/329 (21%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN--------VLINILKR 61
           D E++     ++G+++G  A   + PLD  K +LQ    + N +         L  I++ 
Sbjct: 74  DTEITA----LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRD 129

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYT-YIGSFLRGGLDLNISPQLYSCLVGSL---- 116
           EG RG +KG VP     II G   F ++  Y   + R       S +LY  +  S     
Sbjct: 130 EGARGLYKGLVP-----IIMG--YFPTWMIYFSVYER-------SKKLYPRIFPSFDFIS 175

Query: 117 -------AGMTSSLASYPFDVLRTRFAANSQ-----GQLIKLRDEIMAIWSHEGLMGFFS 164
                  AG  S++ + P  V++TR    +             D    +++ EGL  F++
Sbjct: 176 HSASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYA 235

Query: 165 GCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL--AGPISGFTSKLA 222
           G   S++ +  + AI F +YE +K++      +S   D    L  L  A   S   +   
Sbjct: 236 GLLPSLLGL-FHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTL 294

Query: 223 TFPLDTVRRRIQIRNSPNE--------ERHDR-EFTKDIYKSYKNRRFLGVGISMVQQEG 273
           T+P + +R R+Q++  P +         RH      K  YKS                EG
Sbjct: 295 TYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKS----------------EG 338

Query: 274 PLSLYRGVTMSLIKSVPSTAISLWSYELF 302
               Y G T +L +++P++AI+L S+E F
Sbjct: 339 LRGFYSGFTANLARTLPASAITLVSFEYF 367

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 131/323 (40%), Gaps = 50/323 (15%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP--HNKNANVLIN--- 57
           K +      +VS   S VAG L+   A T   P D VK ++Q+    H   A V  N   
Sbjct: 8   KHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQ 67

Query: 58  ----ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV 113
               I K EGI G  KG     +  I   G++ G Y  I    RG L+    P + S  V
Sbjct: 68  AFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPI----RGILNNVFYPNVESHKV 123

Query: 114 ---------GSLAGMTSSLASYPFDVLRTRFAANS-------QGQLIKLRDEIMAIWSHE 157
                    G+ +G+  +    P  +++TR  + S       Q       + +  I+  E
Sbjct: 124 QHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSE 183

Query: 158 GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGF 217
           G+ G F G  ++M+  G+ +A+   +Y   K F  +   ++D     T L+ L+  I+GF
Sbjct: 184 GIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDG----TGLHLLSSTIAGF 239

Query: 218 TSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSL 277
              +A  P D V  R+      N++ +      D +            I  V+ EG  +L
Sbjct: 240 GVGVAMNPWDVVLTRVY-----NQKGNLYSGPIDCF------------IKTVRNEGLSAL 282

Query: 278 YRGVTMSLIKSVPSTAISLWSYE 300
           Y+G    +++  P T + L   E
Sbjct: 283 YKGFGAQILRIGPHTVLCLTFME 305

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 81/201 (40%), Gaps = 20/201 (9%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTR------FAANSQGQLIKLRDEIMAIWSHEGLMGFF 163
           S + G LA   +   + PFD ++TR        AN+             I+ +EG+ G  
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 164 SGCGSS-MINIGLNTAIMFGVYESIKIFTEE--RSKLSDRRDPFTLLNELAGPISGFTSK 220
            G  S+ +  I LN + + G YE I+          +   +     +N  AG  SG    
Sbjct: 83  KGLASAYLYQIALNGSRL-GFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGA 141

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
               PL  V+ R+Q  ++         +T           F G+  ++ + EG   L+RG
Sbjct: 142 FIGSPLFLVKTRMQSYSNAIHIGQQTHYTSA---------FNGLA-TIFRSEGIKGLFRG 191

Query: 281 VTMSLIKSVPSTAISLWSYEL 301
           V  +++++   +A+ L  Y +
Sbjct: 192 VDAAMLRTGIGSAVQLPIYNI 212

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 134/302 (44%), Gaps = 43/302 (14%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQV------TPHN----KNANVLINILKREGIRGFWK 69
           ++G+L+GL +   + PLD  K +LQ       T  N     +   +  I++ EG+RG +K
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLR-GGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
           G VP  + Y       F  Y +    LR    + +     +S +    AG  S++ + P 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAIT---AGAVSTVVTNPI 189

Query: 129 DVLRTRFAANSQ-----GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
            V++TR    +             D    I + EG+   ++G   S++ + L+ AI F V
Sbjct: 190 WVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGL-LHVAIHFPV 248

Query: 184 YESIKI----FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNS- 238
           YE +K+    +  + S    + +   L+  LA  +S   + + ++P + +R R+Q+++  
Sbjct: 249 YERLKVSFKCYQRDESSNESKINLKRLI--LASSVSKMVASVLSYPHEILRTRLQLKSDL 306

Query: 239 PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
           P+ +R      K  Y                 QEG    Y G   +L +++P++AI+L S
Sbjct: 307 PSHQRRLIPLIKITYI----------------QEGIFGFYSGFGTNLFRTLPASAITLVS 350

Query: 299 YE 300
           +E
Sbjct: 351 FE 352

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 93/219 (42%), Gaps = 49/219 (22%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLS----GLFARTCIAPLDTVKIKLQVTPH--------NKN 51
           KD+LR +   S+  S V+ S S    G  +     P+  VK +L +  H           
Sbjct: 156 KDNLRTN---SSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGT 212

Query: 52  ANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS- 110
            +    I+ +EG++  + G VP S++ +++    F  Y            L +S + Y  
Sbjct: 213 YDAFKKIINQEGVKALYAGLVP-SLLGLLHVAIHFPVYE----------RLKVSFKCYQR 261

Query: 111 --------------CLVGSLAGMTSSLASYPFDVLRTRFAANS-----QGQLIKLRDEIM 151
                          L  S++ M +S+ SYP ++LRTR    S     Q +LI L   I 
Sbjct: 262 DESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPL---IK 318

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
             +  EG+ GF+SG G+++      +AI    +E ++ F
Sbjct: 319 ITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNF 357

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 28/186 (15%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI---------MAIWSHEGLM 160
           + + G+LAG+ S +   P DV +TR  A  QG   +  + +           I   EG+ 
Sbjct: 71  NAISGALAGLLSGIVVCPLDVAKTRLQA--QGLQTRTTENLYYRGSIGTMTTIVRDEGVR 128

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
           G + G    ++       I F VYE    F ++  + +     F + +  +   +G  S 
Sbjct: 129 GLYKGLVPIIMGYFPTWMIYFSVYE----FCKDNLRTNSSNWSF-VSHSFSAITAGAVST 183

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
           + T P+  V+ R+ ++          + T D +K             ++ QEG  +LY G
Sbjct: 184 VVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFK------------KIINQEGVKALYAG 231

Query: 281 VTMSLI 286
           +  SL+
Sbjct: 232 LVPSLL 237

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 14/121 (11%)

Query: 185 ESIKIFTEERSKLSDRRDPFTL----LNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN 240
           E+ K   +E  ++ +    FTL    +N ++G ++G  S +   PLD  + R+Q +    
Sbjct: 44  EAYKGLVQEVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQT 103

Query: 241 EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                   T+++Y     R  +G   ++V+ EG   LY+G+   ++   P+  I    YE
Sbjct: 104 RT------TENLYY----RGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYE 153

Query: 301 L 301
            
Sbjct: 154 F 154

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 131/306 (42%), Gaps = 45/306 (14%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI----------NILKREGIRGF 67
           +L+AG  +GLF   C  PLDT+K+++Q+  + ++A   I          NI   EG+   
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQI--YRRSALEGIKPPGFIKTGRNIYTEEGLLAL 70

Query: 68  WKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSS-LASY 126
           +KG     I  I     +F SY +  S L      ++S    + L G  AG T + L   
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTG-NTFLAGVGAGTTEAVLVVN 129

Query: 127 PFDVLRTRFAAN----SQGQLIKLRDEIMAIW---SHEGLMGFFSGCGSSMINIGLNTAI 179
           P +V++ R  A           + R+ + A +     EG+   + G   +      N   
Sbjct: 130 PMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGA 189

Query: 180 MFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSP 239
            F VY  +K F +E  K +D    +       G ISG     +  PLDT++ R+Q     
Sbjct: 190 NFTVYSKLKEFLQEHHK-TDALPSWE--TSCIGLISGAIGPFSNAPLDTIKTRLQ----- 241

Query: 240 NEERHDREFTKDIYKSYKN----RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
                     KD  KS  N     R + +G  ++++EG  +LY+G+T  +++  P  A++
Sbjct: 242 ----------KD--KSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVT 289

Query: 296 LWSYEL 301
              YE 
Sbjct: 290 FTVYEF 295

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 88/199 (44%), Gaps = 21/199 (10%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQV---------TPHNKNA-NVLI 56
           ++   VST N+ +AG  +G   A   + P++ VKI+LQ          +P  +NA     
Sbjct: 102 KQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACY 161

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116
            I+K EGI   ++G    +       GA F  Y+ +  FL+     +  P   +  +G +
Sbjct: 162 LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLI 221

Query: 117 AGMTSSLASYPFDVLRTRF-----AANSQG--QLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           +G     ++ P D ++TR       AN  G  +++ +  +++     EG    + G    
Sbjct: 222 SGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLI---KEEGFRALYKGITPR 278

Query: 170 MINIGLNTAIMFGVYESIK 188
           ++ +    A+ F VYE ++
Sbjct: 279 VMRVAPGQAVTFTVYEFVR 297

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 198 SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           S ++     +N +AG  +G    L   PLDT++ R+QI            + +   +  K
Sbjct: 3   SKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQI------------YRRSALEGIK 50

Query: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
              F+  G ++  +EG L+LY+G+   +I  +P  AI   SYE +
Sbjct: 51  PPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFY 95

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 10/101 (9%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-------ANVLI 56
           ++H + D   S   S + G +SG       APLDT+K +LQ      N         +  
Sbjct: 202 QEHHKTDALPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGK 260

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGA-QFGSYTYIGSFL 96
            ++K EG R  +KG  P  +M +  G A  F  Y ++   L
Sbjct: 261 QLIKEEGFRALYKGITP-RVMRVAPGQAVTFTVYEFVREHL 300

>Kwal_33.14050
          Length = 314

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 131/309 (42%), Gaps = 52/309 (16%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQ-----VTPHNKNANVLINILKR-------EG 63
           T+ L AG+ +G+   + + P+D +K ++Q     +   N  A +  NI+++       EG
Sbjct: 17  THQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEG 76

Query: 64  IRGFWKGNVPGSIMYIIYGGAQ-----FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG 118
               WKG     +  +I G        F +Y    S+L    D      L +   G  A 
Sbjct: 77  SMALWKG-----VQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAAT 131

Query: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLRDEIM-----AIWSHEGLMGFFSGCGSSM-IN 172
           + + L   PFD ++ R       QL     + M      I+ +EGL  FF    +++ +N
Sbjct: 132 VAADLLMNPFDTIKQRM------QLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMN 185

Query: 173 IGLNTAIMFGVYES-IKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRR 231
           I    A  F +YES  K F  E +      +P  L++ L G ISG T    T PLD ++ 
Sbjct: 186 IPF-AAFNFAIYESATKFFNPENT-----YNP--LIHCLCGGISGATCAAITTPLDCIKT 237

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
            +Q+R S             +++           IS V   G    +RG+   +I ++P+
Sbjct: 238 VLQVRGS-------ESVVDPLFRQADTFSRAASAISKVY--GWSGFWRGLKPRIISNMPA 288

Query: 292 TAISLWSYE 300
           TAIS  +YE
Sbjct: 289 TAISWTAYE 297

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 85/209 (40%), Gaps = 38/209 (18%)

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRF--------AANSQGQLI-KLRDEIMAIWS 155
           +P  +    G+ AG+      +P D ++TR         +AN+  +L   +  +I  I +
Sbjct: 14  APLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARIST 73

Query: 156 HEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPIS 215
            EG M  + G  S ++  G   A+ F  YE  K      S L D +D F     L    S
Sbjct: 74  TEGSMALWKGVQSVILGAGPAHAVYFATYEMCK------SYLIDPQD-FQTHQPLKTAAS 126

Query: 216 GFTSKLAT----FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQ 271
           G  + +A      P DT+++R+Q+R           F+KD        R   V   + + 
Sbjct: 127 GIAATVAADLLMNPFDTIKQRMQLRT----------FSKD--------RMWSVASRIYRN 168

Query: 272 EGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           EG  + +     ++  ++P  A +   YE
Sbjct: 169 EGLAAFFYSYPTTIAMNIPFAAFNFAIYE 197

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 51/323 (15%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV---------TPHNKNA- 52
           K + L+K+ +     + ++G+LSG  +   + P D  K +LQ          + H K   
Sbjct: 28  KLNRLKKNADPRV--AAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFF 85

Query: 53  NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL-NISPQLYSC 111
                I K EG  G +KG  P  + YI      F  Y +   +    +D+   SP L + 
Sbjct: 86  GTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKY---SVDIFPHSPFLSNA 142

Query: 112 LVGSLAGMTSSLASYPFDVLRTR---------FAANSQGQLIKLRDEIMAIWSHEGLMGF 162
                AG  S++A+ P  V++TR         ++ + +G +    D    I   EG    
Sbjct: 143 SSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTI----DTFRKIIQQEGAKAL 198

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKI---FTEERSKLSDRRDPFTLLNELAGPISGFTS 219
           ++G   +++ + LN AI F +YE++KI   ++E     +D          LA  +S   +
Sbjct: 199 YAGLVPALLGM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVA 257

Query: 220 KLATFPLDTVRRRIQIRNS-PNE-ERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSL 277
              T+P + +R R+Q+++  PN  +RH     K  Y+                QEG    
Sbjct: 258 STVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYR----------------QEGFAGF 301

Query: 278 YRGVTMSLIKSVPSTAISLWSYE 300
           Y G   +L+++VP+  ++L S+E
Sbjct: 302 YSGFATNLVRTVPAAVVTLVSFE 324

>Kwal_23.4731
          Length = 314

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 139/312 (44%), Gaps = 50/312 (16%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK-------------REGIR 65
           ++AG  +G        PLD VK++LQ+  +  +++    ++K             RE  R
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYR 76

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-RGGL-------------DLNISPQLYSC 111
           G     +  SI + +Y    FG Y +    + R G+             D  + P LY  
Sbjct: 77  GLGVNLIGNSIAWGLY----FGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLY-L 131

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGS 168
              +L+G+ +++ + P  V++TR  + S     + +   D I  +++HEG  GF+ G   
Sbjct: 132 ASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVP 191

Query: 169 SMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDT 228
           S+  +    AI F +Y+S++     R  +++      L N     +S   S  A +P   
Sbjct: 192 SLFGVA-QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQL 250

Query: 229 VRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKS 288
           ++  +Q  +    E+ D         SY   RF  +  S+ Q+EG   LY+G++ +L+++
Sbjct: 251 LKSNLQ--SFAAVEKRD---------SY---RFWNLVKSIHQKEGLQGLYKGLSANLLRA 296

Query: 289 VPSTAISLWSYE 300
           +PST I+   YE
Sbjct: 297 IPSTCITFCIYE 308

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 91/201 (45%), Gaps = 21/201 (10%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP------HNKNANVLIN 57
           +   +KD+ +  +  L + +LSGL       P+  +K ++  T       +    + +  
Sbjct: 116 QSSFQKDKAMGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRK 175

Query: 58  ILKREGIRGFWKGNVP-------GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS 110
           +   EG  GFW+G VP       G+I + IY   +   + Y     RG  +      L +
Sbjct: 176 VYAHEGFSGFWRGLVPSLFGVAQGAIYFTIYDSLR---HQYFAR--RGITEDEKMGNLEN 230

Query: 111 CLVGSLAGMTSSLASYPFDVLRTR---FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
             + S++ M S  A YPF +L++    FAA  +    +  + + +I   EGL G + G  
Sbjct: 231 IAITSVSKMLSVTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLS 290

Query: 168 SSMINIGLNTAIMFGVYESIK 188
           ++++    +T I F +YE+++
Sbjct: 291 ANLLRAIPSTCITFCIYENLR 311

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 134/303 (44%), Gaps = 42/303 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-----------EGIRG 66
           S VAG + G+ A     P D +K++ Q    N   + + NI+K              ++G
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKG 97

Query: 67  FWKGNVP-----GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTS 121
           F+KG +P       I  + + G   G      +  +GG +     Q+ +   G ++ + +
Sbjct: 98  FYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAA--GFISAIPT 155

Query: 122 SLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           +L + P + ++     +S+G  I+    I+      G+   F G  +++   G  +A+ F
Sbjct: 156 TLVTAPTERVKVVLQTSSKGSFIQAAKTIV---KEGGIASLFKGSLATLARDGPGSALYF 212

Query: 182 GVYESIKIFTEERSKLSD--RRDPFTLLNE-LAGPISGFTSKLATFPLDTVRRRIQIRNS 238
             YE  K +   R    D  + +P  +LN  LAG I+G +  LA FP+DT++ ++Q  ++
Sbjct: 213 ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASST 272

Query: 239 PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
               ++    TK+IY               +Q+ G    + G+  +L++S P+ A +   
Sbjct: 273 ---RQNMLSATKEIY---------------LQRGGIKGFFPGLGPALLRSFPANAATFLG 314

Query: 299 YEL 301
            E+
Sbjct: 315 VEM 317

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 88/201 (43%), Gaps = 30/201 (14%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWK 69
             E++      AG +S +      AP + VK+ LQ +           I+K  GI   +K
Sbjct: 136 SNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSFIQAAKTIVKEGGIASLFK 195

Query: 70  GNV-------PGSIMYIIYGGAQFGSYTYIGSFLR-------GGLD--LNISPQLYSCLV 113
           G++       PGS +Y       F SY    ++L         G D  +NI   L  CL 
Sbjct: 196 GSLATLARDGPGSALY-------FASYEISKNYLNSRQPRQDAGKDEPVNI---LNVCLA 245

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQ-LIKLRDEIMAIWSHEGLMGFFSGCGSSMI- 171
           G +AGM+  LA +P D ++T+  A+S  Q ++    EI       G+ GFF G G +++ 
Sbjct: 246 GGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIY--LQRGGIKGFFPGLGPALLR 303

Query: 172 NIGLNTAIMFGVYESIKIFTE 192
           +   N A   GV  +  +F +
Sbjct: 304 SFPANAATFLGVEMTHSLFKK 324

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN--ILKREGIRG 66
           KDE V+  N  +AG ++G+     + P+DT+K KLQ +   +N         L+R GI+G
Sbjct: 233 KDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKG 292

Query: 67  FWKGNVP 73
           F+ G  P
Sbjct: 293 FFPGLGP 299

>Kwal_23.3042
          Length = 542

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 133/319 (41%), Gaps = 50/319 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI---------------KLQVTPHNKNANV--------- 54
            +AG +SG+ +RTC AP D +K+               K  +   N NA++         
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 55  -LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSF---LRGGLDLNISPQLYS 110
               + ++ GIR F+ GN   ++        +FGS+         L G  D     +  +
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA----IWSHEGLMGFFSGC 166
            L G L G+ + L+ YP D L+ R          K R  +++    ++   GL  F+ G 
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGI 407

Query: 167 GSSMINIGLNTAIMFGVYESIKI-FTEERSKLSD-RRDPFTLLNE---LAGPISGFTSKL 221
              ++ I    A+  G + ++K  +   +++L+    D  T+ N    L G  SG     
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGAT 467

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
           A +P++ +R R+Q + +                 ++   F  V +  VQ+EG   L++G+
Sbjct: 468 AVYPVNLLRTRLQAQGT-------------FAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 282 TMSLIKSVPSTAISLWSYE 300
             +L K  P+ +IS   YE
Sbjct: 515 VPNLAKVCPAVSISYLCYE 533

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 92/197 (46%), Gaps = 23/197 (11%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLI----NILKREGIR 65
           +S  ++ +AG L G+ A+  + P+DT+K ++Q  P N   K   +LI    ++ K  G+R
Sbjct: 342 LSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLR 401

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYT-----YIGSFLR-GGL--DLNISPQLYSCLVGSLA 117
            F++G   G +    Y     G+++     YI    R  GL  D      ++  L+G+ +
Sbjct: 402 IFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFS 461

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEGLMGFFSGCGSSMI 171
           G   + A YP ++LRTR  A  QG           RD ++     EG  G F G   ++ 
Sbjct: 462 GTVGATAVYPVNLLRTRLQA--QGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLA 519

Query: 172 NIGLNTAIMFGVYESIK 188
            +    +I +  YE++K
Sbjct: 520 KVCPAVSISYLCYENLK 536

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 100/241 (41%), Gaps = 56/241 (23%)

Query: 87  GSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD------VLRTRFAA--- 137
           G  T I  F+RG             + G ++G+ S   + PFD      + RT  ++   
Sbjct: 213 GDVTLINDFIRG---------FGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFL 263

Query: 138 ---------NSQGQLIKLRDEIM----AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
                    N    L K++  ++     ++   G+  F+ G G + + +   +AI FG +
Sbjct: 264 KSKDIILEKNPNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSF 323

Query: 185 ESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSP-NEER 243
           E  K    +   + D          LAG + G  ++L+ +P+DT++ R+Q   +P N E 
Sbjct: 324 ELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQC--APLNTES 381

Query: 244 HDREF----TKDIYKSYKNRRFLGVGISMVQQEGPLSL-YRGVTMSLIKSVPSTAISLWS 298
             R+      KD+YK                 EG L + YRG+T+ ++   P  A+ L +
Sbjct: 382 KGRQLLISTAKDMYK-----------------EGGLRIFYRGITVGIMGIFPYAAMDLGT 424

Query: 299 Y 299
           +
Sbjct: 425 F 425

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 76.6 bits (187), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 138/323 (42%), Gaps = 51/323 (15%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK- 60
           +K D  R++ +     +LVAG + G+ A     P D +K++ Q        + +  ILK 
Sbjct: 13  HKTDAFRENMK-----ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKE 67

Query: 61  -----------------REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN 103
                            +  ++GF+KG +P  I         F  Y  IG  L      +
Sbjct: 68  ARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYD-IGKRLVTWKQAS 126

Query: 104 ISPQLYSCLV--GSLAGMTSSLASYPFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGL 159
            +P   + +   G ++ + ++L + P + ++     NS+  G  IK    I+   S  G+
Sbjct: 127 DAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIV---STGGV 183

Query: 160 MGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFT 218
              F+G  +++   G  +A+ F  YE  K F  +     D+ D   L N  LAG I+G +
Sbjct: 184 KSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDK-DEVNLANVCLAGGIAGMS 242

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
             L  FP+DT++ R+Q+  +P       + TKDIY               +Q+ G    +
Sbjct: 243 MWLVVFPIDTIKTRLQVATTPISM---VQATKDIY---------------IQRGGIKGFF 284

Query: 279 RGVTMSLIKSVPSTAISLWSYEL 301
            G+  +L++S P+ A +    EL
Sbjct: 285 PGLGPALLRSFPANAATFLGVEL 307

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--TPHNKNANVLINI 58
           +NK    +  +EV+  N  +AG ++G+     + P+DT+K +LQV  TP +         
Sbjct: 215 LNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMVQATKDIY 274

Query: 59  LKREGIRGFWKGNVPG 74
           ++R GI+GF+ G  P 
Sbjct: 275 IQRGGIKGFFPGLGPA 290

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 77.4 bits (189), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 132/309 (42%), Gaps = 46/309 (14%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-------ANVLINILKREGIRGF 67
           T  + V+G+L+G  +   + PLD  K +LQ                 L  IL+ EG+ G 
Sbjct: 84  TQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGL 143

Query: 68  WKGNVPGSIMYIIYGGAQFGSYTYIG----SFLRGGLDLNISPQLYSCLVGSLAGMTSSL 123
           +KG  P  + Y       F  Y        S+L GG   + +  L        AG  S+ 
Sbjct: 144 YKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASAL-------TAGAISTA 196

Query: 124 ASYPFDVLRTRFAANSQ-----GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178
            + P  V++TR    S             D    ++  EGL  F+SG   S+  +  + A
Sbjct: 197 LTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVA 255

Query: 179 IMFGVYESIKIFTEERSKLSD--RRDPFTL-LNEL--AGPISGFTSKLATFPLDTVRRRI 233
           I F VYE +KI+    +  +D  R D   L L+ L  A  +S   + + T+P + +R R+
Sbjct: 256 IHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM 315

Query: 234 QIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           Q+R+S             +  S  N   LG    +   EG +  Y G   +L+++VP++ 
Sbjct: 316 QVRHS------------GVPPSLLN--LLG---RIRASEGYVGFYSGFATNLVRTVPASV 358

Query: 294 ISLWSYELF 302
           I+L S+E F
Sbjct: 359 ITLVSFEYF 367

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 129/291 (44%), Gaps = 28/291 (9%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           GS++G    T + P+D VK ++Q     + +  + +    I  REGIRG + G  P    
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQ--- 581

Query: 78  YIIYGGAQFGSYTYIGSFLRGGL-DLNISPQLY-SCLVGSLAGMTSSLASYPFDVLRTRF 135
            +I    +      +  ++RG L D + + + Y   L G+ AG    + + P +V++ R 
Sbjct: 582 -LIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRL 640

Query: 136 AANSQ--GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFT 191
              S+  G ++K +   + +    G+ G + G  + ++     +AI F  Y  +K  +F 
Sbjct: 641 QVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFK 700

Query: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251
            +      R    T    +AG ++G  +   T P D ++ R+QI     E R++  F   
Sbjct: 701 YDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIF--- 757

Query: 252 IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
                          +++++E   S ++G +  +++S P    +L +YE+F
Sbjct: 758 -----------HAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIF 797

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 95/198 (47%), Gaps = 23/198 (11%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGF 162
           I   +Y+  +GS+AG   +   YP D+++TR  A  S  Q     D    I+S EG+ G 
Sbjct: 515 IFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGI 574

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTSKL 221
           +SG G  +I +    AI   V + +      R +L D+        E L+G  +G    +
Sbjct: 575 YSGLGPQLIGVAPEKAIKLTVNDYM------RGRLMDKHANLKWYFEILSGACAGACQVV 628

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            T PL+ V+ R+Q+R+         E+  D+ KS    +   +G+  ++Q G   LY+G+
Sbjct: 629 FTNPLEVVKIRLQVRS---------EYAGDVLKS----QVTALGV--IKQLGIKGLYKGI 673

Query: 282 TMSLIKSVPSTAISLWSY 299
              L++ VP +AI   +Y
Sbjct: 674 AACLMRDVPFSAIYFPTY 691

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 75/180 (41%), Gaps = 13/180 (7%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHN-----KNANVLINILKREGIRGFWKGNVP 73
           +++G+ +G        PL+ VKI+LQV         K+    + ++K+ GI+G +KG   
Sbjct: 616 ILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAA 675

Query: 74  GSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYS---CLVGSLAGMTSSLASYPF 128
             +  + +    F +Y ++    F     D     +L +    + G LAGM ++  + PF
Sbjct: 676 CLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPF 735

Query: 129 DVLRTRFAANSQGQLIKLRDEIMA---IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           DV++TR   + +    +      A   I   E    FF G  + ++            YE
Sbjct: 736 DVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 43/100 (43%), Gaps = 22/100 (22%)

Query: 6   HLRKD------------EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA- 52
           HL+KD             ++ T   LVAG L+G+ A     P D +K +LQ+ P      
Sbjct: 693 HLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETR 752

Query: 53  -----NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFG 87
                +    ILK E  + F+KG   GS   ++    QFG
Sbjct: 753 YEGIFHAARTILKEESFKSFFKG---GSAR-VLRSSPQFG 788

>Scas_691.4
          Length = 334

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 129/321 (40%), Gaps = 47/321 (14%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT-------PHNKNANVLINILKRE 62
           D++ S   +LVAG  +GLF   C  PLDT+K+++Q+        PH        NI   E
Sbjct: 8   DKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHG-FITTGRNIYSHE 66

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSS 122
           G    +KG     I  I     +F SY +  + L       I+    + L G  AG+T +
Sbjct: 67  GFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTG-NTFLAGVGAGITEA 125

Query: 123 -LASYPFDVLRTRFAANSQGQLI------------------KLRDEIMAIWS---HEGLM 160
            L   P +V++ R  A     LI                  K  + I A ++    EG  
Sbjct: 126 VLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAG 185

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
             + G   +      N    F VY  +K + +   K  +R    +      G ISG    
Sbjct: 186 ALYRGVSLTAARQATNQGANFTVYSYLKDYLQ---KYHNRESLPSWETSCIGLISGAIGP 242

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
            +  PLDT++ R+Q               K I  +   ++   +G  ++++EG  +LY+G
Sbjct: 243 FSNAPLDTIKTRLQK-------------DKSISSNSAWKKIYIIGTQLIKEEGFRALYKG 289

Query: 281 VTMSLIKSVPSTAISLWSYEL 301
           +T  +++  P  A++   YE 
Sbjct: 290 ITPRVMRVAPGQAVTFTVYEF 310

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 85/214 (39%), Gaps = 29/214 (13%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQVTPHN----------------- 49
           ++   ++T N+ +AG  +G+  A   + P++ VKI+LQ    N                 
Sbjct: 103 KETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAAT 162

Query: 50  ----KNANVL---INILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL 102
               K AN +     I+K EG    ++G    +       GA F  Y+Y+  +L+   + 
Sbjct: 163 VTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNR 222

Query: 103 NISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSH----EG 158
              P   +  +G ++G     ++ P D ++TR   +          +I  I +     EG
Sbjct: 223 ESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEG 282

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192
               + G    ++ +    A+ F VYE ++   E
Sbjct: 283 FRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLE 316

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
           L+N +AG  +G    L   PLDT++ R+QI       R                 F+  G
Sbjct: 14  LINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMR--------------PHGFITTG 59

Query: 266 ISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
            ++   EG L+LY+G+   +I  +P  AI   SYE +
Sbjct: 60  RNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFY 96

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 131/307 (42%), Gaps = 31/307 (10%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP-HNKNANVLINILKRE 62
           +DH  +D        L+AG+  G+       P DT K++LQ +      A V+ N+LK E
Sbjct: 15  EDHPGQDNG-RVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAEVVKNLLKNE 73

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-GLDLNIS---PQLYSCLVGSLAG 118
           G +GF+KG +   +        QFG    +  F     +D N +    Q Y C  G   G
Sbjct: 74  GPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLC--GLTGG 131

Query: 119 MTSSLASYPFDVLRTRF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
           MT+S  + P + +R R      + +Q +     D I  + S +GLM    G   +M+  G
Sbjct: 132 MTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREG 188

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
                 F VYE++      +        P+ L   L G +SG    L  +P+D V+  +Q
Sbjct: 189 HGCGTYFLVYEALVSKQINQGLKRTEIPPWKLC--LYGALSGTALWLMVYPIDVVKSVMQ 246

Query: 235 IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
                         T ++ K    +  + V  ++  +EG  + ++G   +++++ P+   
Sbjct: 247 --------------TDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGG 292

Query: 295 SLWSYEL 301
           +  ++EL
Sbjct: 293 TFATFEL 299

>Scas_632.9
          Length = 292

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 132/309 (42%), Gaps = 40/309 (12%)

Query: 5   DH-LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREG 63
           DH + K    +  + +V GS++G F +    P DTVK++LQ    +        I     
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYH 65

Query: 64  IRGFWKGNVPGSIMYIIYGGA-----QFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG 118
             G W+G   G I   ++G A      F SY    + L      N+SP     L G+ AG
Sbjct: 66  NEGVWRGFFQG-IGSPLFGAALENATLFVSYNQCSNVLEK--FTNVSPLSNILLSGAFAG 122

Query: 119 MTSSLASYPFDVLRTRFAANS-----QGQL--IKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
             +S    P ++++ +   ++     +GQ+   K+   +M +   +G++G + G  S+ I
Sbjct: 123 SCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFI 182

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRR 231
              L     F  YE +K   ++R K ++ +  + LL  ++G  +G     + FP DTV+ 
Sbjct: 183 RESLGGVAWFATYEVMKQGLKDRRKDTENKT-WELL--VSGASAGLAFNASIFPADTVKS 239

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
            +Q      E        K +  +Y                G    YRG+ ++LI++VP+
Sbjct: 240 MMQ-----TEHITLINAVKKVLTTY----------------GITGFYRGLGITLIRAVPA 278

Query: 292 TAISLWSYE 300
            A   + YE
Sbjct: 279 NATVFYMYE 287

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 89/183 (48%), Gaps = 16/183 (8%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVT----------PHNKNANVLINILKREGIR 65
           +N L++G+ +G  A   + P++ +K KLQV+           H K    L+ +L+ +GI 
Sbjct: 112 SNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGIL 171

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLA 124
           G W+G     I   + G A F +Y  +   L+     +   + +  LV G+ AG+  + +
Sbjct: 172 GLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRK-DTENKTWELLVSGASAGLAFNAS 230

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
            +P D +++      Q + I L + +  + +  G+ GF+ G G ++I      A +F +Y
Sbjct: 231 IFPADTVKSMM----QTEHITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 185 ESI 187
           E++
Sbjct: 287 ETL 289

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 132/312 (42%), Gaps = 51/312 (16%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN------------------VLINILK 60
           L+AG+ +G+   + + P+D +K ++Q     K A                    L+  + 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 61  R----EGIRGFWKGNVPGSIM-----YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC 111
           R    EG    W+G V   +M     + +Y    F +Y +    L    D N    L + 
Sbjct: 84  RISSTEGSLALWRG-VQSMVMGAGPAHAVY----FATYEFCKEQLIDAKDFNTHQPLKTA 138

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM- 170
           + G  A + +     PFD ++ R    S+     +      I+ +EG M FF    +++ 
Sbjct: 139 VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLA 198

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
           +NI    A+ F +YES   F       ++  +P+  ++ L G I+G T    T PLD ++
Sbjct: 199 MNIPF-AALNFVIYESSTKFFNP----TNAYNPW--IHCLCGGIAGATCAAVTTPLDCIK 251

Query: 231 RRIQIRNSPNEERHDREF-TKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
             +QIR S  +  H   F T + +K            ++ Q  G    +RG+   +I ++
Sbjct: 252 TVLQIRGS--DTVHVESFKTANTFKK--------AAQAIWQSYGWKGFWRGLQPRVISNI 301

Query: 290 PSTAISLWSYEL 301
           P+TAIS  SYE 
Sbjct: 302 PATAISWTSYEF 313

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 90/221 (40%), Gaps = 47/221 (21%)

Query: 103 NISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQ-------------------GQL 143
           + +P  Y  + G+ AG+      +P D L+TR  A S+                      
Sbjct: 16  DTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGA 75

Query: 144 IKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDP 203
             L  +I  I S EG +  + G  S ++  G   A+ F  YE    F +E+  L D +D 
Sbjct: 76  GTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYE----FCKEQ--LIDAKD- 128

Query: 204 FTLLNELAGPISGFTSKLAT----FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNR 259
           F     L   +SG  + +A      P DT+++R+Q+++    +  D    +  +  YKN 
Sbjct: 129 FNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQS----KSSDSSMWRMAFNIYKN- 183

Query: 260 RFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                       EGP++ +     +L  ++P  A++   YE
Sbjct: 184 ------------EGPMAFFYSYPTTLAMNIPFAALNFVIYE 212

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 89/210 (42%), Gaps = 19/210 (9%)

Query: 4   KDHLRKDEEVSTTNSL---VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVL---IN 57
           K+ L   ++ +T   L   V+G  + + A   + P DT+K +LQ+   + ++++     N
Sbjct: 120 KEQLIDAKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN 179

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           I K EG   F+        M I +    F  Y     F       N  P ++ CL G +A
Sbjct: 180 IYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYN--PWIH-CLCGGIA 236

Query: 118 GMTSSLASYPFDVLRT----RFAANSQGQLIK----LRDEIMAIWSHEGLMGFFSGCGSS 169
           G T +  + P D ++T    R +     +  K     +    AIW   G  GF+ G    
Sbjct: 237 GATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPR 296

Query: 170 MINIGLNTAIMFGVYESIK--IFTEERSKL 197
           +I+    TAI +  YE  K  +FT++   L
Sbjct: 297 VISNIPATAISWTSYEFAKHLLFTKQEPSL 326

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 123/294 (41%), Gaps = 35/294 (11%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLINILKREGI-RGFWKGNVPG 74
           ++ GS++G   +    P DTVK++LQ    N      + +    + EGI RGF++G    
Sbjct: 17  IINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIASP 76

Query: 75  SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTR 134
            +   +     F SY     FL      N+ P     + G +AG  +SL   P ++++ +
Sbjct: 77  LVGACLENATLFVSYNQCSKFLEK--HTNVFPLGQILISGGVAGSCASLVLTPVELVKCK 134

Query: 135 F------AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
                   A+++ +  K+   I AI +  GL G + G   + I         F  YE +K
Sbjct: 135 LQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVK 194

Query: 189 IFTEERSKLSD-RRDPFTLLNEL-AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDR 246
              ++R  L D +RD   +   L +G  +G     + FP DTV+  +Q      E     
Sbjct: 195 KSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQ-----TEHISLT 249

Query: 247 EFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
              K I+  +  + F                YRG+ ++L ++VP+ A   + +E
Sbjct: 250 NAVKKIFGKFGLKGF----------------YRGLGITLFRAVPANAAVFYIFE 287

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 87/184 (47%), Gaps = 20/184 (10%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV---------TPHNKNANVLINILKREGIRGFWK 69
           L++G ++G  A   + P++ VK KLQV         T H K    +  I+   G+ G W+
Sbjct: 111 LISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQ 170

Query: 70  GNVPGSIMYIIYGG-AQFGSYTYIGSFLRGGLDLNI----SPQLYSCLV-GSLAGMTSSL 123
           G   G+ +   +GG A F +Y  +   L+    L+       +++  L+ G  AG+  + 
Sbjct: 171 GQ-SGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNA 229

Query: 124 ASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
           + +P D +++      Q + I L + +  I+   GL GF+ G G ++       A +F +
Sbjct: 230 SIFPADTVKSVM----QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYI 285

Query: 184 YESI 187
           +E++
Sbjct: 286 FETL 289

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K +E      L++G  +GL     I P DTVK  +Q T H    N +  I  + G++GF+
Sbjct: 207 KRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQ-TEHISLTNAVKKIFGKFGLKGFY 265

Query: 69  KG 70
           +G
Sbjct: 266 RG 267

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRNS 238
           +L+ + G I+G   K+  FP DTV+ R+Q + S
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQAS 46

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 126/299 (42%), Gaps = 46/299 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR----EGIRGF 67
            + G +S   A+T  AP++ VK+ +Q           +     +++  KR    EGI  F
Sbjct: 17  FLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 68  WKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RGGLDLNISPQLYSCLVGSLAGMTSS 122
           W+GN    + Y       F     I S L     R G     +  L+S   G  AG  S 
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFS---GGAAGGLSL 133

Query: 123 LASYPFDVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
           L  Y  D  RTR AA+++G       Q   L D        +GL+G + G   S++ I +
Sbjct: 134 LFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIV 193

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
              + FG+Y+S K        L+   +   + + L G +    +  A++PLDTVRRR+ +
Sbjct: 194 YRGLYFGLYDSFKPVL-----LTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMM 248

Query: 236 RNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
             S    ++D     D  +             +VQ+EG  SL++G   ++ + V +  +
Sbjct: 249 -TSGQTIKYDGAL--DCLR------------KIVQKEGAYSLFKGCGANIFRGVAAAGV 292

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 89/184 (48%), Gaps = 23/184 (12%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLINI----LKREGIRGFWK 69
            AG LS LF    +  LD  + +L        +   +  N L+++    LK +G+ G ++
Sbjct: 127 AAGGLSLLF----VYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYR 182

Query: 70  GNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
           G VP  +  I+Y G  FG Y ++    L G L+ +    + S L+G +  M +S ASYP 
Sbjct: 183 GFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSF---VASFLLGWVITMGASTASYPL 239

Query: 129 DVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           D +R R    S GQ IK     D +  I   EG    F GCG+++   G+  A +  +Y+
Sbjct: 240 DTVRRRMMMTS-GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR-GVAAAGVISLYD 297

Query: 186 SIKI 189
            +++
Sbjct: 298 QLQL 301

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 100/197 (50%), Gaps = 11/197 (5%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNK--NANVLINI 58
           +N    +R D+++S+   L A + SG+       PL  +K ++    ++   +  VL ++
Sbjct: 96  INYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDL 155

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           +K +G++G WKG VP +++ +  G   F  Y T     +    D +    L +  V S++
Sbjct: 156 IKNDGVQGLWKGLVP-ALVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVS 214

Query: 118 GMTSSLASYPFDVLRTRF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
            M S+ A YPF +L++      A+ +  +L+ L      I+S  GL+GF+ G  ++++  
Sbjct: 215 KMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLSK---MIYSRSGLLGFYKGLSANLLRS 271

Query: 174 GLNTAIMFGVYESIKIF 190
             +T I F +YE+ K F
Sbjct: 272 VPSTCITFCIYENFKSF 288

 Score = 61.6 bits (148), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 132/304 (43%), Gaps = 54/304 (17%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNA--NVLINI------LKREGIRGFW 68
           L AGS++ L     + PLD  K++LQ  +T   K    N+   I      L RE  RG  
Sbjct: 16  LTAGSVTTLI----VHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRGLT 71

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RGGLDLNISPQLYSCLVGSLAGMTSSL 123
              V  +I + +Y    F SY     +L     R   D ++S  +Y     S +GM +++
Sbjct: 72  VNLVGNTIAWGLY----FASYRVAKDYLINYNHRIRNDKDLSSWMYLSASAS-SGMLTTV 126

Query: 124 ASYPFDVLRTRFAANSQGQLIK---LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
            + P  V++TR  + +   L     LRD I     ++G+ G + G   +++ +    A+ 
Sbjct: 127 LTNPLWVIKTRMMSKANSDLTSMKVLRDLI----KNDGVQGLWKGLVPALVGVS-QGALH 181

Query: 181 FGVYESIKIFTEERSKLSDR-RDPFTLLNELA-GPISGFTSKLATFPLDTVRRRIQIRNS 238
           F  Y+++K     +  L +R  D  T L  +A   +S   S  A +P   ++  +Q   +
Sbjct: 182 FTCYDTLK----HKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQA 237

Query: 239 PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
              +      +K IY                 + G L  Y+G++ +L++SVPST I+   
Sbjct: 238 SENDFKLLPLSKMIY----------------SRSGLLGFYKGLSANLLRSVPSTCITFCI 281

Query: 299 YELF 302
           YE F
Sbjct: 282 YENF 285

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 136/321 (42%), Gaps = 50/321 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI---------------KLQVTPHNKNANV--------- 54
            +AG  SG+ +RTC AP D +K+               K +V   N NA++         
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 55  -LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTY---IGSFLRGGLDLNISPQLYS 110
               + ++ GIR F+ GN    I        +FGS+     + + L G    +   +  +
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA----IWSHEGLMGFFSGC 166
            + G + G+ +  + YP D L+ R         +K  + +++    ++   GL  F+ G 
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 167 GSSMINIGLNTAIMFGVYESI-KIFTEERSKLSD-RRDPFTLLNELAGPISGFTSKL--- 221
              ++ I    A+  G + ++ K +   ++K++    D  T+ N +  P+  F+  +   
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGAT 438

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
             +P++ +R R+Q + +     H   +T           F  V    VQ+EG   L++G+
Sbjct: 439 VVYPINLLRTRLQAQGT---YAHPHTYTG----------FRDVLWKTVQREGYQGLFKGL 485

Query: 282 TMSLIKSVPSTAISLWSYELF 302
             +L K  P+ +IS   YE F
Sbjct: 486 VPNLAKVCPAVSISYLCYENF 506

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 85/198 (42%), Gaps = 23/198 (11%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLINILKRE----GI 64
           E+S  ++ +AG + G+ A+  + P+DT+K ++Q  P +   K   +LI+  ++     G+
Sbjct: 312 ELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGL 371

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG--------GLDLNISPQLYSCLVGSL 116
           + F++G   G +    Y     G+++ +  +            +D           +G+ 
Sbjct: 372 KLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAF 431

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEGLMGFFSGCGSSM 170
           +G   +   YP ++LRTR  A  QG           RD +      EG  G F G   ++
Sbjct: 432 SGTVGATVVYPINLLRTRLQA--QGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNL 489

Query: 171 INIGLNTAIMFGVYESIK 188
             +    +I +  YE+ K
Sbjct: 490 AKVCPAVSISYLCYENFK 507

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 75.1 bits (183), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 131/290 (45%), Gaps = 26/290 (8%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           GS++G      + P+D VK ++Q     + +  + + L+ IL +EG+RG + G  P  I 
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIG 590

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA 137
                  +     ++ + L  G D  +S      + G+ AG    + + P ++++ R   
Sbjct: 591 VAPEKAIKLTVNDHMRATL-AGRDGKLSLPC-EIISGATAGACQVVFTNPLEIVKIRLQV 648

Query: 138 NSQGQLIKLRDEIMAI--WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFTEE 193
            S       R+ + AI    + GL+G + G G+ ++     +AI F  Y  IK  +F  +
Sbjct: 649 KSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFD 708

Query: 194 RSKLSDRRDPFTLLNEL-AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDI 252
             K SD+R+       L +G ++G  +   T P D ++ R+QI         D +  + +
Sbjct: 709 -PKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQI---------DPKKGESV 758

Query: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           Y             +++++EG  S ++G    +++S P    +L +YE+F
Sbjct: 759 YNG-----IWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 27/200 (13%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI---MAIWSHEGLM 160
           I   +Y+  +GS+AG   ++  YP D+++TR  A  Q    K ++ I   + I S EG+ 
Sbjct: 521 IFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQA--QRDFSKYKNSIDCLLKILSKEGVR 578

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTS 219
           G +SG G  +I +    AI   V + +      R+ L+ R    +L  E ++G  +G   
Sbjct: 579 GLYSGLGPQLIGVAPEKAIKLTVNDHM------RATLAGRDGKLSLPCEIISGATAGACQ 632

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYR 279
            + T PL+ V+ R+Q+++         ++  D  ++  N       IS+++  G + LYR
Sbjct: 633 VVFTNPLEIVKIRLQVKS---------DYVADAARNSVN------AISVIKNLGLIGLYR 677

Query: 280 GVTMSLIKSVPSTAISLWSY 299
           G    L++ +P +AI   +Y
Sbjct: 678 GAGACLLRDIPFSAIYFPTY 697

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 18/199 (9%)

Query: 5   DHLR-----KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH-----NKNANV 54
           DH+R     +D ++S    +++G+ +G        PL+ VKI+LQV         +N+  
Sbjct: 603 DHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVN 662

Query: 55  LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS----FLRGGLDLNISPQLYS 110
            I+++K  G+ G ++G     +  I +    F +Y +I S    F     D       + 
Sbjct: 663 AISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQ 722

Query: 111 CLV-GSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIK--LRDEIMAIWSHEGLMGFFSGC 166
            LV G LAGM ++  + PFDV++TR   +  +G+ +   + D    I   EG+  FF G 
Sbjct: 723 LLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGG 782

Query: 167 GSSMINIGLNTAIMFGVYE 185
            + ++            YE
Sbjct: 783 PARVLRSSPQFGFTLAAYE 801

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 128/301 (42%), Gaps = 33/301 (10%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLI---NILKREGIRGFW 68
           +L+AG  +GLF   C  PLDT+K+++Q+        H K    +     I ++EG    +
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSS-LASYP 127
           KG     I  I     +F SY +  + L    +  I     + + G  AG+T + L   P
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNK-ESGIVSTGNTFVAGVGAGITEAVLVVNP 131

Query: 128 FDVLRTRFAA-----NSQGQLIKLRDEIMAIWS---HEGLMGFFSGCGSSMINIGLNTAI 179
            +V++ R  A     +      K  + I A ++    EG+   + G   +      N   
Sbjct: 132 MEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGA 191

Query: 180 MFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSP 239
            F VY  +K F +   ++       T      G ISG     +  PLDT++ R+Q   S 
Sbjct: 192 NFTVYSKLKEFLQNYHQMDVLPSWET---SCIGLISGAIGPFSNAPLDTIKTRLQKDKSI 248

Query: 240 NEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
           + E+               ++ + +G  ++++EG  +LY+G+T  +++  P  A++   Y
Sbjct: 249 SLEKQS-----------GMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVY 297

Query: 300 E 300
           E
Sbjct: 298 E 298

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 88/194 (45%), Gaps = 18/194 (9%)

Query: 13  VSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQ---VTPHNKNANVLIN--------ILK 60
           VST N+ VAG  +G+  A   + P++ VKI+LQ   +TP   NA    N        I+K
Sbjct: 108 VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
            EG+   ++G    +       GA F  Y+ +  FL+    +++ P   +  +G ++G  
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAI 227

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLR--DEIMAIWSH----EGLMGFFSGCGSSMINIG 174
              ++ P D ++TR   +    L K     +I+ I +     EG    + G    ++ + 
Sbjct: 228 GPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVA 287

Query: 175 LNTAIMFGVYESIK 188
              A+ F VYE ++
Sbjct: 288 PGQAVTFTVYEYVR 301

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 11/96 (11%)

Query: 207 LNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGI 266
           +N +AG  +G    L   PLDT++ R+QI        H            K   F+  G 
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEH-----------VKPPGFIKTGR 60

Query: 267 SMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           ++ Q+EG L+LY+G+   +I  +P  AI   SYE +
Sbjct: 61  TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFY 96

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQ---------VTPHNKNANVLINILKREGIRGFWKGNV 72
           G +SG       APLDT+K +LQ          +   K   +   +LK EG R  +KG  
Sbjct: 221 GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGIT 280

Query: 73  PGSIMYIIYGGA-QFGSYTYIGSFLR 97
           P  +M +  G A  F  Y Y+   L 
Sbjct: 281 P-RVMRVAPGQAVTFTVYEYVREHLE 305

>Scas_578.3*
          Length = 524

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 23/198 (11%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN--ANVLI-----NILKREGI 64
           ++S   + VAG ++G+ A+  I P+DT+K ++Q  P   N   N L+      + K  GI
Sbjct: 323 DLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGI 382

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQ------LYSCLVGSL 116
           R F++G + G++    Y     G+++ +  +   R    LNI  +      L    +G+ 
Sbjct: 383 RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAF 442

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEGLMGFFSGCGSSM 170
           +G   + A YP ++LRTR  A  QG           RD  M     EG+ GF+ G   ++
Sbjct: 443 SGTVGATAVYPINLLRTRLQA--QGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTL 500

Query: 171 INIGLNTAIMFGVYESIK 188
           + +    +I +  YE  K
Sbjct: 501 VKVCPAVSIGYLCYEKFK 518

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 137/320 (42%), Gaps = 50/320 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI------KLQVTPHNKNANVLI---------------- 56
            +AG LSG+ +RTC APLD +K+       L  T  N   ++ I                
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 57  -NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTY---IGSFLRGGLDLNISPQLYSCL 112
            ++ ++ G+R F+ GN             +FG++     + + L G   +N   +L + +
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 113 VGSLAGMTSSLASYPFDVLRTR-----FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
            G +AG+ + ++ YP D L+ R        N +G  + L      ++   G+  F+ G  
Sbjct: 332 AGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNAL-LISTAKEMYKEGGIRVFYRGVL 390

Query: 168 SSMINIGLNTAIMFGVYESI-KIFTEERSKLSDRRDPFTLLNEL----AGPISGFTSKLA 222
              + I    A+  G + ++ K + + +SK  +  +   +L+ L     G  SG     A
Sbjct: 391 LGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATA 450

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVT 282
            +P++ +R R+Q + +     H   +T           F  V +  +++EG    Y+G+ 
Sbjct: 451 VYPINLLRTRLQAQGT---YAHPYTYTG----------FRDVFMQTLKREGVPGFYKGLV 497

Query: 283 MSLIKSVPSTAISLWSYELF 302
            +L+K  P+ +I    YE F
Sbjct: 498 PTLVKVCPAVSIGYLCYEKF 517

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT-----PHNKNA--NVLINILK 60
            KD  +S    L  G+ SG    T + P++ ++ +LQ       P+      +V +  LK
Sbjct: 426 EKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLK 485

Query: 61  REGIRGFWKGNVP 73
           REG+ GF+KG VP
Sbjct: 486 REGVPGFYKGLVP 498

>Scas_602.8
          Length = 885

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 129/293 (44%), Gaps = 31/293 (10%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQ----VTPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           GS++G    T + P+D +K ++Q    +T +  + + L+ I  +EGIRG + G  P    
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQ--- 561

Query: 78  YIIYGGAQFGSYTYIGSFLRGGL-DLNISPQL-YSCLVGSLAGMTSSLASYPFDVLRTRF 135
            +I    +      +  F+R  L D   + QL    L G+ AG    + + P ++++ R 
Sbjct: 562 -LIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEIVKIRL 620

Query: 136 AANSQ---GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IF 190
              S+     + K +     I     L+G + G G+ ++     +AI F  Y  +K  +F
Sbjct: 621 QVKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVF 680

Query: 191 TEERSKLSDRRDPFTLLNEL-AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFT 249
             + +   D+RD       L AG ++G  +   T P D ++ R+QI     E R+     
Sbjct: 681 QFDPND-KDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRY----- 734

Query: 250 KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
                       L    +++++E   S ++G    +++S P    +L +YELF
Sbjct: 735 ---------TGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELF 778

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 95/200 (47%), Gaps = 26/200 (13%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI---MAIWSHEGLM 160
           I   +++  +GS+AG   +   YP D ++TR  A  Q  L K ++ I   + I+  EG+ 
Sbjct: 495 IFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQA--QRSLTKYKNSIDCLVKIFGKEGIR 552

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTS 219
           G +SG G  +I +    AI   V + +      R  L D++    L  E L+G  +G   
Sbjct: 553 GLYSGLGPQLIGVAPEKAIKLTVNDFM------RKSLVDKKGNLQLGAEVLSGATAGACQ 606

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYR 279
            + T PL+ V+ R+Q+++         E+T  +    +   F      ++++   + LY+
Sbjct: 607 VVFTNPLEIVKIRLQVKS---------EYTNAMIPKSQLTAF-----QIIKELKLIGLYK 652

Query: 280 GVTMSLIKSVPSTAISLWSY 299
           GV   L++ VP +AI   +Y
Sbjct: 653 GVGACLLRDVPFSAIYFPTY 672

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 81/210 (38%), Gaps = 36/210 (17%)

Query: 19  LVAGSLSGLFARTC----IAPLDTVKIKLQVTPHNKNANV------LINILKREGIRGFW 68
           L A  LSG  A  C      PL+ VKI+LQV     NA +         I+K   + G +
Sbjct: 592 LGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLIGLY 651

Query: 69  KG-------NVPGSIMYIIYGGAQFGSYTYIG----SFLRGGLDLNISPQLYSCL-VGSL 116
           KG       +VP S +Y       F +Y ++      F     D     + +  L  G+L
Sbjct: 652 KGVGACLLRDVPFSAIY-------FPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGAL 704

Query: 117 AGMTSSLASYPFDVLRTRFAANS---QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
           AG+ ++  + PFDV++TR        + +   +   +  I   E    FF G  + ++  
Sbjct: 705 AGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRS 764

Query: 174 GLNTAIMFGVYESIKIFTEERSKLSDRRDP 203
                     YE  K        +SD + P
Sbjct: 765 SPQFGFTLAAYELFK----NMFNISDDKQP 790

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP------HNKNANVL 55
           N KD   K + + T   L AG+L+G+ A     P D +K +LQ+ P      +    + +
Sbjct: 685 NDKD---KRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAV 741

Query: 56  INILKREGIRGFWKG 70
             ILK E  R F+KG
Sbjct: 742 RTILKEESFRSFFKG 756

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 130/325 (40%), Gaps = 57/325 (17%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVT-PHNKN--------ANVLINILKREGIRG 66
             S +AG ++G  A+T +APLD +KI  Q + P                  I+  +G RG
Sbjct: 20  VKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRG 79

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
           F++G+    +    Y   +F +Y  I S +               L GSLAG+ S   +Y
Sbjct: 80  FFQGHSATLLRIFPYAAIKFIAYEQIRSVVIP--TWRHESHWRRLLSGSLAGLCSVFVTY 137

Query: 127 PFDVLRTRFAANSQGQLIKLRDEIMAIWSH---EGLM------------GFFSGCGSSMI 171
           P D++R R A  ++    K+R  +  I++    E L              F+ G   ++I
Sbjct: 138 PLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVI 197

Query: 172 NIGLNTAIMFGVY------------ESIKIFTEERSKLSDRRDPFTLLNEL-AGPISGFT 218
            +     + F  +            E   + +   S   DR  P     +L AG ++G  
Sbjct: 198 GMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMA 257

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG--ISMVQQEGPL- 275
           S+ A +P + +RRR+Q+    +  R               R F+G+     ++  EG   
Sbjct: 258 SQTAAYPFEIIRRRLQVSAITDPTR---------------RHFVGINEIAKIIYTEGGWR 302

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYE 300
             + G+++  IK  P  A S + YE
Sbjct: 303 GFFVGLSIGYIKVTPMVACSFFIYE 327

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 89/218 (40%), Gaps = 39/218 (17%)

Query: 14  STTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV------LINILKREGIR-- 65
           S    L++GSL+GL +     PLD V+++L       +A V      + N    E +R  
Sbjct: 117 SHWRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKW 176

Query: 66  ----------GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR------------GG---L 100
                      F++G  P  I  I Y G  F ++       R            GG    
Sbjct: 177 YIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAY 236

Query: 101 DLNISPQLYSCLV-GSLAGMTSSLASYPFDVLRTRFAANS-----QGQLIKLRDEIMAIW 154
           D  +  + ++ LV G LAGM S  A+YPF+++R R   ++     +   + + +    I+
Sbjct: 237 DRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIY 296

Query: 155 SHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192
           +  G  GFF G     I +    A  F +YE  K + +
Sbjct: 297 TEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP-------HNKNANVLINILKRE-GI 64
           + T   LVAG L+G+ ++T   P + ++ +LQV+        H    N +  I+  E G 
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGW 301

Query: 65  RGFWKG 70
           RGF+ G
Sbjct: 302 RGFFVG 307

>Kwal_47.18216
          Length = 333

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 136/337 (40%), Gaps = 60/337 (17%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI----NIL 59
           RK+      N LVAG  +GLF   C  PLDT+K+++Q+        + A   I    +I 
Sbjct: 4   RKNSSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGM 119
            +EG    +KG     I  I     +F SY +  + L       +     + + G  AG+
Sbjct: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-ADRQTGVVSTGNTFVAGVGAGI 121

Query: 120 TSS-LASYPFDVLRTRFAANS------QGQLI------------------------KLRD 148
           T + +   P +V++ R  A        + QL                         K R+
Sbjct: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRN 181

Query: 149 EIMA---IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFT 205
            I A   I   EG    + G   +      N    F VY ++K   +E  + +D    + 
Sbjct: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ-TDMLPSWE 240

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
               L G ISG     +  PLDT++ R+Q          D+  +KD   S    R L +G
Sbjct: 241 --TSLIGLISGALGPFSNAPLDTIKTRLQ---------KDKSTSKDSGWS----RILAIG 285

Query: 266 ISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
             ++++EG  +LY+G+T  +++  P  A++   YEL 
Sbjct: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 86/222 (38%), Gaps = 41/222 (18%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQV--------------------- 45
           R+   VST N+ VAG  +G+  A   + P++ VKI+LQ                      
Sbjct: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSA 161

Query: 46  --------------TPHNKNA-NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYT 90
                         TP  +NA      I+K EG R  ++G    +       GA F  Y+
Sbjct: 162 TFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221

Query: 91  YIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI 150
            + S L+     ++ P   + L+G ++G     ++ P D ++TR   +           I
Sbjct: 222 TLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281

Query: 151 MAIWSH----EGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           +AI       EG    + G    ++ +    A+ F VYE I+
Sbjct: 282 LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 134/297 (45%), Gaps = 39/297 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQ----VTPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           GS++G    T + P+D +K ++Q    +  +  + + L+ I+ REGI+G + G  P    
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQ--- 593

Query: 78  YIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGSLAGMTSSLASYPFDVLR 132
            +I    +      +  F+R  L      L++ P++ S   G+ AG    + + P ++++
Sbjct: 594 -LIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIIS---GASAGACQVIFTNPLEIVK 649

Query: 133 TRFAANSQ--GQLIKLRDEIMA-IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
            R    S   G+ I+  +E    I    GL G ++G  + ++     +AI F  Y  +K 
Sbjct: 650 IRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKK 709

Query: 190 ----FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHD 245
               F        +R   + LL   AG I+G  +   T P D ++ R+QI     E +++
Sbjct: 710 DLFDFDPNDKTKRNRLKTWELLT--AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYN 767

Query: 246 REFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
                 I+ + +         +++++E   S ++G    +++S P    +L +YELF
Sbjct: 768 -----GIFHAIR---------TILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELF 810

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 22/198 (11%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGF 162
           I   LY+  +GS+AG   +   YP D ++TR  A  S  Q     D ++ I S EG+ G 
Sbjct: 527 IFDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGL 586

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTSKL 221
           +SG G  +I +    AI   V + +      R++L+D+    +L  E ++G  +G    +
Sbjct: 587 YSGLGPQLIGVAPEKAIKLTVNDFM------RNRLTDKNGKLSLFPEIISGASAGACQVI 640

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            T PL+ V+ R+Q+++               Y     ++       +V++ G   LY GV
Sbjct: 641 FTNPLEIVKIRLQVQSD--------------YVGENIQQANETATQIVKKLGLRGLYNGV 686

Query: 282 TMSLIKSVPSTAISLWSY 299
              L++ VP +AI   +Y
Sbjct: 687 AACLMRDVPFSAIYFPTY 704

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 82/197 (41%), Gaps = 16/197 (8%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV------LINILKRE 62
           K+ ++S    +++G+ +G        PL+ VKI+LQV       N+         I+K+ 
Sbjct: 618 KNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL 677

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ-----LYSCL-VGSL 116
           G+RG + G     +  + +    F +Y ++   L    D N   +      +  L  G++
Sbjct: 678 GLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDL-FDFDPNDKTKRNRLKTWELLTAGAI 736

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINI 173
           AGM ++  + PFDV++TR   + +    K       I  I   E    FF G G+ ++  
Sbjct: 737 AGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRS 796

Query: 174 GLNTAIMFGVYESIKIF 190
                     YE  K F
Sbjct: 797 SPQFGFTLAAYELFKGF 813

>Kwal_47.17321
          Length = 881

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 96/198 (48%), Gaps = 23/198 (11%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQ-GQLIKLRDEIMAIWSHEGLMGF 162
           I   +Y+ L+GS+AG   + A YP D+++TR  A     Q     D  + I+S EG+ G 
Sbjct: 497 IFDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGI 556

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTL-LNELAGPISGFTSKL 221
           +SG G  ++ +    AI   V + +      R  L D  +  TL L  ++G  +G    +
Sbjct: 557 YSGLGPQLVGVAPEKAIKLTVNDYV------RKLLMDENNRLTLPLEIISGAAAGACQVI 610

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            T PL+ V+ R+Q+R+         E+   + KS    +   +G+  V+  G   LY+G+
Sbjct: 611 FTNPLEIVKIRLQVRS---------EYADSLPKS----QLTALGV--VKSLGLRGLYKGL 655

Query: 282 TMSLIKSVPSTAISLWSY 299
              L++ VP +AI   +Y
Sbjct: 656 VACLMRDVPFSAIYFPTY 673

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 123/294 (41%), Gaps = 26/294 (8%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWKGNVP 73
           + + GS++G    T + P+D VK ++Q     + +  + +  + I  REGIRG + G  P
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGP 562

Query: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQL-YSCLVGSLAGMTSSLASYPFDVLR 132
             +        +     Y+   L   +D N    L    + G+ AG    + + P ++++
Sbjct: 563 QLVGVAPEKAIKLTVNDYVRKLL---MDENNRLTLPLEIISGAAAGACQVIFTNPLEIVK 619

Query: 133 TRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK-- 188
            R    S+    L K +   + +    GL G + G  + ++     +AI F  Y  +K  
Sbjct: 620 IRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKRD 679

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREF 248
           IF  +    + R    T     AG ++G  +   T P D ++ R+QI     E R+    
Sbjct: 680 IFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRY---- 735

Query: 249 TKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
                        L    +++++E   S ++G    +++S P    +L +YE+F
Sbjct: 736 ----------TGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIF 779

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 96/217 (44%), Gaps = 19/217 (8%)

Query: 5   DHLRK---DEEVSTTNSL--VAGSLSGLFARTCIAPLDTVKIKLQVTPHN-----KNANV 54
           D++RK   DE    T  L  ++G+ +G        PL+ VKI+LQV         K+   
Sbjct: 579 DYVRKLLMDENNRLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLT 638

Query: 55  LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYS-- 110
            + ++K  G+RG +KG V   +  + +    F +Y ++    F     D N   +L++  
Sbjct: 639 ALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWE 698

Query: 111 -CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA---IWSHEGLMGFFSGC 166
               G LAGM ++  + PFDV++TR   + +    +    + A   I   E    FF G 
Sbjct: 699 LLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGG 758

Query: 167 GSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRD 202
           G+ ++            YE  + +F  + S+ ++ R+
Sbjct: 759 GARVLRSSPQFGFTLAAYEIFQNMFPLQHSENNESRE 795

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 134/330 (40%), Gaps = 63/330 (19%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVT-PHN-KNA-------NVLINILKREGIRGFWKG 70
           +AG ++G  A+T IAPLD +KI  Q + PH  K A       N  ++I  R+ +RG ++G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           +    +    Y   +F +Y  I + +    +            GSLAG+ S   +YP D+
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYET--HFRRLCSGSLAGLCSVFCTYPLDL 175

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSH---EGL-------------MGFFSGCGSSMINIG 174
           +R R A  ++   +++   +  I+S    E L               F+ G   ++I + 
Sbjct: 176 IRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVIGMI 235

Query: 175 LNTAIMFGVY-----------------------ESIKIFTEERSKLSDRRDPFTLLNE-L 210
               + F  +                       ++  +  + ++  + +R P     E L
Sbjct: 236 PYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELL 295

Query: 211 AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQ 270
           AG ++G  S+ A +P + +RRR+Q+    N   H      ++ K             +  
Sbjct: 296 AGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAK------------IIFH 343

Query: 271 QEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           + G    + G+++  IK  P  A S + YE
Sbjct: 344 ERGWRGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 86/223 (38%), Gaps = 51/223 (22%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQ-VTPHNK-NANVLINILKREGIR----------- 65
           L +GSL+GL +  C  PLD ++++L  VT H+K     L+  +  E              
Sbjct: 156 LCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPK 215

Query: 66  ------GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL---------------DLNI 104
                  F++G +P  I  I Y G  F ++      LR  +               DL +
Sbjct: 216 WFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKV 275

Query: 105 SPQ------------LYSCLVGSLAGMTSSLASYPFDVLRTRFAANS-----QGQLIKLR 147
             Q                L G LAGM S  A+YPF+++R R    +     + +   + 
Sbjct: 276 DVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMS 335

Query: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
           +    I+   G  GFF G     I +    A  F VYE +K +
Sbjct: 336 EMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWY 378

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 83/203 (40%), Gaps = 16/203 (7%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANS------QGQLIKLRDEIMAIWSHEGLMG 161
           L S L G +AG  +     P D ++  F  ++       G    L +  + IWS + L G
Sbjct: 54  LKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRG 113

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTS 219
            F G  ++++ I    A+ F  YE I+  I   +  +   RR         +G ++G  S
Sbjct: 114 VFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-------LCSGSLAGLCS 166

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYR 279
              T+PLD +R R+      ++ R      K IY    +                 + YR
Sbjct: 167 VFCTYPLDLIRVRLAYVTEHHKVR-VWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYR 225

Query: 280 GVTMSLIKSVPSTAISLWSYELF 302
           G   ++I  +P   +S ++++LF
Sbjct: 226 GYIPTVIGMIPYAGVSFFAHDLF 248

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 45/97 (46%), Gaps = 11/97 (11%)

Query: 204 FTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLG 263
           + L + LAG ++G  +K    PLD ++   Q  N P+  ++   F          +  L 
Sbjct: 52  YILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSN-PHYVKYAGSF----------QGLLN 100

Query: 264 VGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
            G+ +  ++    +++G + +L++  P  A+   +YE
Sbjct: 101 AGVHIWSRDRLRGVFQGHSATLLRIFPYAAVKFIAYE 137

>Kwal_26.7653
          Length = 325

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 125/307 (40%), Gaps = 42/307 (13%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP---------HNKNANVLINILKR 61
           ++VS T S +AG ++   A T   P++ VK ++Q+           +      L  I K 
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ-----LYSCLVGSL 116
           EGIRG  KG     I  I   G++ G Y  I S L       + P        + + G+ 
Sbjct: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS-------HEGLMGFFSGCGSS 169
           +G+  ++   P  +++TR  + S    I  +    +IW+        EG  G + G  ++
Sbjct: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199

Query: 170 MINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
           ++  G  +++   +Y + K F  +     D     T L+ +A  +SGF   +   P D +
Sbjct: 200 ILRTGAGSSVQLPIYNTAKHFLLKH----DLMKEGTGLHLVASTVSGFGVGVVMNPWDVI 255

Query: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
             R+  +              ++YK       L   +  V+ EG  +LY+G    + +  
Sbjct: 256 LTRVYNQKG------------NLYKGP-----LDCFVKTVRIEGIGALYKGFEAQIFRIA 298

Query: 290 PSTAISL 296
           P T + L
Sbjct: 299 PHTILCL 305

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 86/201 (42%), Gaps = 24/201 (11%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRF------AANSQGQLIKLRDEIMAIWSHEGLMGFF 163
           S + G +A   +   + P ++++TR       +A++Q         +  I+ +EG+ G  
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 164 SGCGSSMI-NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTL----LNELAGPISGFT 218
            G   + I  IGLN +   G YE I+    +        DP  +    +N ++G  SG  
Sbjct: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVLNK--TFYPAMDPHKVQNVAVNVVSGATSGII 143

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
             +   PL  ++ R+Q  ++  +      +T  I+             S+ + EG   LY
Sbjct: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT-SIWNGLS---------SIYRAEGFKGLY 193

Query: 279 RGVTMSLIKSVPSTAISLWSY 299
           RGV  +++++   +++ L  Y
Sbjct: 194 RGVDAAILRTGAGSSVQLPIY 214

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 127/320 (39%), Gaps = 52/320 (16%)

Query: 4   KDHLRKD--EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---- 57
           +D ++K   ++VS   S  AG L+   A T   P++ VKI++Q+      AN  I     
Sbjct: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64

Query: 58  -----ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS-- 110
                + + EGIRG  KG V   I  I   G++ G Y  I    R  ++    P   S  
Sbjct: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPI----RAVMNKTFYPDQESHK 120

Query: 111 -------CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS-------H 156
                     G+ +G+  ++   P  +++TR  + S    I  +     +W+        
Sbjct: 121 VQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMT 180

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG 216
           EG+ G F G  ++++  G  +++   +Y + K F      + D       L+  A  ISG
Sbjct: 181 EGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPS----LHLTASTISG 236

Query: 217 FTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLS 276
               +   P D +  RI  +              D+YK       +   +  V+ EG  +
Sbjct: 237 LGVAVVMNPWDVILTRIYNQKG------------DLYKGP-----IDCLVKTVKIEGITA 279

Query: 277 LYRGVTMSLIKSVPSTAISL 296
           LY+G    + +  P T + L
Sbjct: 280 LYKGFEAQVFRIGPHTILCL 299

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 137/297 (46%), Gaps = 39/297 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQ----VTPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           GS++G    T + P+D VK ++Q    ++ +  + +  + IL REGIRG + G  P    
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQ--- 606

Query: 78  YIIYGGAQFGSYTYIGSFLRGGL-DLNISPQLYSCLV-GSLAGMTSSLASYPFDVLRTRF 135
            +I    +      +  ++R  L D N    L S ++ G+ AG    + + P ++++ R 
Sbjct: 607 -LIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRL 665

Query: 136 AANSQGQLIKLRDE-----IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK-- 188
               +G+ +    E      + I    GL G + G  + ++     +AI F  Y  +K  
Sbjct: 666 QV--KGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRD 723

Query: 189 IFT---EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHD 245
           +F     +++K S R + + LL+  AG ++G  +   T P D ++ R+QI         D
Sbjct: 724 LFNFDPNDKNKRS-RLNTWELLS--AGALAGMPAAYLTTPFDVIKTRLQI---------D 771

Query: 246 REFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
            +  + IYK       +    +++++E   S ++G    +++S P    +L +YELF
Sbjct: 772 PKKGETIYKG-----IIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

 Score = 69.7 bits (169), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 94/198 (47%), Gaps = 22/198 (11%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGF 162
           I   LY+  +GS+AG   +   YP D ++TR  A  S  Q     D  + I S EG+ G 
Sbjct: 540 IFDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGV 599

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTSKL 221
           +SG G  +I +    AI   V + +      R+KL D+     LL+E ++G  +G    +
Sbjct: 600 YSGLGPQLIGVAPEKAIKLTVNDYM------RNKLKDKNGKLGLLSEIISGASAGACQVI 653

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            T PL+ V+ R+Q++               + ++ +N +     + ++++ G   LY+G 
Sbjct: 654 FTNPLEIVKIRLQVKGEY------------VAENAENAKL--TALQIIKRLGLPGLYKGA 699

Query: 282 TMSLIKSVPSTAISLWSY 299
              L++ VP +AI   +Y
Sbjct: 700 AACLLRDVPFSAIYFPTY 717

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 84/191 (43%), Gaps = 14/191 (7%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV-----TPHNKNANVL-INILKRE 62
           K+ ++   + +++G+ +G        PL+ VKI+LQV       + +NA +  + I+KR 
Sbjct: 631 KNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL 690

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYS---CLVGSLA 117
           G+ G +KG     +  + +    F +Y ++    F     D N   +L +      G+LA
Sbjct: 691 GLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA---IWSHEGLMGFFSGCGSSMINIG 174
           GM ++  + PFDV++TR   + +      +  I A   I   E    FF G  + ++   
Sbjct: 751 GMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSS 810

Query: 175 LNTAIMFGVYE 185
                    YE
Sbjct: 811 PQFGFTLAAYE 821

>Kwal_33.15446
          Length = 305

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 128/303 (42%), Gaps = 33/303 (10%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILKREGIR 65
           +E  S     V+G  SG+       P DT+K++LQ +          + +   ++++GIR
Sbjct: 13  NEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIR 72

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAGMTSSL 123
           GF+ G  P  + +I+      G        L+  +  +     L  C++ G LAG + S 
Sbjct: 73  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSF 132

Query: 124 ASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
            + P ++ + +       Q  + R   D I  +++ +G+ G + G  S++I    +    
Sbjct: 133 IAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI-FRTHFVYW 191

Query: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG-FTSKLATFPLDTVRRRIQIRNSP 239
           +G YE +  + +  + LSD     T +N  AG  S  F      +P D +++ I   +  
Sbjct: 192 WGSYELLTRWFKANTNLSD-----TAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKY 246

Query: 240 NEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
           +   R  R    DI+++   R F                ++G   S ++S P+ A +L S
Sbjct: 247 DGSLRSWRNAASDIWRTRGIRGF----------------FKGFVPSFLRSFPANAAALAS 290

Query: 299 YEL 301
           +E 
Sbjct: 291 FEF 293

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 78/174 (44%), Gaps = 16/174 (9%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLI 56
           KK   + +E++  +  +++G L+G       AP++  K KLQV      T +    +V+ 
Sbjct: 104 KKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIK 163

Query: 57  NILKREGIRGFWKGNVPGSIM--YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVG 114
            +   +GIRG +KG V   I   + +Y    +GSY  +  + +   + N+S    +   G
Sbjct: 164 KVYAADGIRGMYKGLVSTLIFRTHFVY---WWGSYELLTRWFKA--NTNLSDTAINFWAG 218

Query: 115 SL-AGMTSSLASYPFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSG 165
              A       +YP DV++     N +  G L   R+    IW   G+ GFF G
Sbjct: 219 GFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKG 272

>Scas_667.4
          Length = 308

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 130/313 (41%), Gaps = 41/313 (13%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNAN 53
           M+ K+ ++K+   +     + G +S   A+T  +P++ VK+ +Q           +    
Sbjct: 1   MSSKEEVKKESNFAI--DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYK 58

Query: 54  VLINILKR----EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLY 109
            +I   +R    EGI  FW+GN    I Y       F     I +      +        
Sbjct: 59  GIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFA 118

Query: 110 SCLV-GSLAGMTSSLASYPFDVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMG 161
             L  G  AG  S L  Y  D  RTR AA+++        Q   L D      + +G+ G
Sbjct: 119 GNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
            + G   S++ I +   + FG+Y+S+K      + L+   +   L + L G I    +  
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLK-----PAVLTGSLEGSFLASFLLGWIVTTGAST 233

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
           A++PLDTVRRR+ +  S    ++D  F  D ++             +V  EG  SL++G 
Sbjct: 234 ASYPLDTVRRRMMM-TSGQAVKYDGAF--DCFR------------KVVAAEGVSSLFKGC 278

Query: 282 TMSLIKSVPSTAI 294
             ++++ V    +
Sbjct: 279 GANILRGVAGAGV 291

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 89/184 (48%), Gaps = 23/184 (12%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLINILKR----EGIRGFWK 69
            AG LS LF    +  LD  + +L     +      +    LI++ K+    +G+ G ++
Sbjct: 126 AAGGLSLLF----VYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYR 181

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIG-SFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
           G +P  +  I+Y G  FG Y  +  + L G L+ +    L S L+G +    +S ASYP 
Sbjct: 182 GFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSF---LASFLLGWIVTTGASTASYPL 238

Query: 129 DVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           D +R R    S GQ +K     D    + + EG+   F GCG++++  G+  A +  +Y+
Sbjct: 239 DTVRRRMMMTS-GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR-GVAGAGVISMYD 296

Query: 186 SIKI 189
            +++
Sbjct: 297 QLQM 300

>Scas_709.9
          Length = 365

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 131/300 (43%), Gaps = 34/300 (11%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQV-------TPHNKNA-NVLINILKREGIRGFWKGN 71
           ++G+L+G  +   + PLD  K +LQ         P+ +     +  I+  EG+RG +KG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVL 131
           +P  + Y       F  Y +        L  N     +SC   + AG  S++ + P  V+
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLP-NSDFISHSCSAIT-AGAASTVLTNPIWVV 186

Query: 132 RTRFA-----ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYES 186
           +TR         S+       D    I + EG+   ++G   SM  + L+ AI F VYE 
Sbjct: 187 KTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHVAIHFPVYEK 245

Query: 187 IK--IFTEERSKLSDRRDPFTLLNEL--AGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
           +K  +  +  +   + ++    L  L  A   S   + + T+P + +R R+Q+++     
Sbjct: 246 LKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKS----- 300

Query: 243 RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
             D+             + L +     + EG L  Y G   +L+++VP++AI+L S+E F
Sbjct: 301 --DKLLIS-------KHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEYF 351

>Scas_582.7
          Length = 329

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 135/303 (44%), Gaps = 45/303 (14%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-------EGIRGFW 68
           ++ L+AG+ +G+   + + P+D +K ++Q T          +I+K+       EG    W
Sbjct: 37  SHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALW 96

Query: 69  KGNVPGSIMYIIYG-GAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS-- 125
           KG     +  +I G G     Y     F +  L  +   + +  +  +++G T+++AS  
Sbjct: 97  KG-----VQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDF 151

Query: 126 --YPFDVLRTRFAANSQGQLIKLRDEIM-----AIWSHEGLMGFFSGCGSSM-INIGLNT 177
              PFD ++ R       Q+  L+ E +      I++ EGL  F+    +++ +NI    
Sbjct: 152 FMNPFDTIKQRM------QISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPF-A 204

Query: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237
           A  F +YES   F           +P  L++ L G ISG  +   T PLD ++  IQIR 
Sbjct: 205 AFNFMIYESASKFFNPL----HHYNP--LIHCLCGGISGAIAAAVTTPLDCIKTVIQIRG 258

Query: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
           S          + ++ K     +     I MV   G    +RG+   ++ ++P+TAIS  
Sbjct: 259 S-------SVVSLEVMKKANTFKKATSAILMVY--GWKGFWRGLQPRILANMPATAISWT 309

Query: 298 SYE 300
           +YE
Sbjct: 310 AYE 312

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 68/154 (44%), Gaps = 11/154 (7%)

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN----SQGQLIKLRDEIMAIWSHEGLM 160
           +P  +  L G+ AG+      +P D L+TR  +     ++     +  +I  I + EG +
Sbjct: 34  APLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSL 93

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTS 219
             + G  S ++  G   A+ F  YE    FT+       +R+    +   ++G  +   S
Sbjct: 94  ALWKGVQSVILGAGPAHAVYFATYE----FTKAHLIPDSQRETHQPIKVAVSGATATVAS 149

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIY 253
                P DT+++R+QI +   E+ ++    K IY
Sbjct: 150 DFFMNPFDTIKQRMQISDLKKEKVYN--VAKKIY 181

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 125/293 (42%), Gaps = 40/293 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR----EGIRGFWKG 70
           G +S   ++T  AP++ VK+ +Q           ++  N +++  KR    EG+  FW+G
Sbjct: 16  GGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVISFWRG 75

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS--CLVGSLAGMTSSLASYPF 128
           N    I Y       F     I +      +++   + ++     G  AG  S L  Y  
Sbjct: 76  NTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFVYSL 135

Query: 129 DVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           D  RTR AA+S+        Q   L D      + +G+ G + G   S++ I +   + F
Sbjct: 136 DYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYF 195

Query: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNE 241
           G+Y+S+K        L+   +   + + L G      +  A++PLDTVRRR+ +  S   
Sbjct: 196 GMYDSLKPLL-----LTGNLESSFIASFLLGWAVTTGASTASYPLDTVRRRMMM-TSGQA 249

Query: 242 ERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
            ++D  F  D ++             +V  EG  SL++G   ++++ V    +
Sbjct: 250 VKYDGAF--DAFR------------KIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (47%), Gaps = 23/184 (12%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLINILKR----EGIRGFWK 69
            AG LS LF    +  LD  + +L     +      +  N L+++ K+    +GI G ++
Sbjct: 123 AAGGLSLLF----VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGS-FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
           G +P  +  ++Y G  FG Y  +    L G L+   S  + S L+G      +S ASYP 
Sbjct: 179 GFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLE---SSFIASFLLGWAVTTGASTASYPL 235

Query: 129 DVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           D +R R    S GQ +K     D    I + EG+   F GCG++++  G+  A +  +Y+
Sbjct: 236 DTVRRRMMMTS-GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILR-GVAGAGVISLYD 293

Query: 186 SIKI 189
            +++
Sbjct: 294 QLQL 297

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 197 LSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSY 256
           +SD +    L+N + G +S   SK A  P++ V+  IQ     N++   ++ + D     
Sbjct: 1   MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQ-----NQDEMLKQGSLD----- 50

Query: 257 KNRRFLGVGISM---VQQEGPLSLYRGVTMSLIKSVPSTAISL 296
             RR+ G+          EG +S +RG T ++I+  P+ A++ 
Sbjct: 51  --RRYNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNF 91

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 129/319 (40%), Gaps = 43/319 (13%)

Query: 4   KDHLRKD-EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN--------- 53
           K+H +   ++VS   S +AG L+   A T   P + VK ++Q+       N         
Sbjct: 11  KEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQ 70

Query: 54  VLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCL 112
            L  I K EG++G  +G V   +  I   G++ G Y  I + L         P +L +  
Sbjct: 71  ALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVA 130

Query: 113 VGSLAGMTS----SLASYPFDVLRTRFAANS-------QGQLIKLRDEIMAIWSHEGLMG 161
           V   AG TS    ++   P  +++TR  + S       Q     + + +  I+  EG++G
Sbjct: 131 VNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLG 190

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
            F G  ++++  G  +++   +Y + K F  +    +D     T L+ L+  ++G    +
Sbjct: 191 LFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQ----NDIMKEGTALHLLSSTVTGLGVGI 246

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
              P D V  R+         +    +   I   +K  +  G+G          +LY+G 
Sbjct: 247 VMNPWDVVLTRVY-------NQKGNTYKGPIDCMFKTIKIEGIG----------ALYKGF 289

Query: 282 TMSLIKSVPSTAISLWSYE 300
              L +  P T + L   E
Sbjct: 290 GAQLFRIAPHTILCLTFME 308

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 128/319 (40%), Gaps = 50/319 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKI---------------KLQVTPHNKNANV--------- 54
            +AG  SG+ +RTC AP D +K+               K  +   N NA++         
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 55  -LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTY---IGSFLRGGLDLNISPQLYS 110
               + ++ G+R F+ GN    +        +FGS+     I + L    D +   +L +
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK----LRDEIMAIWSHEGLMGFFSGC 166
            + G L G+ +  + YP D L+ R         +K    L      ++   G+  F+ G 
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 167 GSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLAT- 223
              ++ I    A+  G + ++K     +E  K     D   + N +  P+  F+  +   
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 224 --FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
             +P++ +R R+Q + +         F+  + K+             +Q+EG   L++G+
Sbjct: 443 LVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKT-------------IQREGYQGLFKGL 489

Query: 282 TMSLIKSVPSTAISLWSYE 300
             +L K  P+ +IS   YE
Sbjct: 490 VPNLAKVCPAVSISYLCYE 508

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 96/209 (45%), Gaps = 23/209 (11%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN---ANVLIN 57
           M + ++++   E+S  ++ +AG L G+ A+  + P+DT+K ++Q  P N N   +++L+ 
Sbjct: 305 MARLENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQ 364

Query: 58  ILK----REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL------RGGL--DLNIS 105
             K    + GIR F++G   G +    Y     G+++ +  +       + GL  D  I 
Sbjct: 365 TAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVII 424

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEGL 159
             L    +G+ +G   +   YP ++LRTR  A  QG            D +      EG 
Sbjct: 425 SNLIVLPMGAFSGTVGATLVYPINLLRTRLQA--QGTYAHPHTYNGFSDVLKKTIQREGY 482

Query: 160 MGFFSGCGSSMINIGLNTAIMFGVYESIK 188
            G F G   ++  +    +I +  YE++K
Sbjct: 483 QGLFKGLVPNLAKVCPAVSISYLCYENLK 511

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 94/235 (40%), Gaps = 44/235 (18%)

Query: 87  GSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLR-------------- 132
           G  T I  F++G             + G  +G+ S   + PFD ++              
Sbjct: 188 GDVTLINDFIKG---------FGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLL 238

Query: 133 ----TRFAANSQGQLIKLRDEIM----AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
               T  A N    L K++  ++     ++   GL  F+ G G +++ +   +AI FG +
Sbjct: 239 NSKDTLLAKNPNADLSKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSF 298

Query: 185 ESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH 244
           E  K        + D  +   L   +AG + G  ++ + +P+DT++ RIQ   +P     
Sbjct: 299 EMAKRIMARLENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQC--AP----- 351

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
                 ++ KS      L     M QQ G    YRGV + ++   P  A+ L ++
Sbjct: 352 ---LNTNLKKS---SILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTF 400

>Scas_589.10
          Length = 316

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 98/236 (41%), Gaps = 26/236 (11%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVT-----------------PHNKNANVLINILKR 61
            ++G+++G+     + PLD VK + Q+                   H+   + L  ILK 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTS 121
           EG +  +KG  P  +M +     +F S       +     L       + L G+ AG+T 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITE 136

Query: 122 SLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           SL   PF++++ R           +R     I  ++GL G ++G  S++    +  A  F
Sbjct: 137 SLIVVPFELVKIRLQDAQSDYRSPIRCT-RTIIENQGLFGIYAGFESTIWRNTIWNASYF 195

Query: 182 GVYESIKIF---TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
           G+   +K F    +  +K    R+ F     L G I+G  S   + P D V+ R+Q
Sbjct: 196 GLIFQVKKFIPRAKSTTKFQGIRNDF-----LVGAIAGCMSCFLSVPFDVVKTRMQ 246

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 90/207 (43%), Gaps = 14/207 (6%)

Query: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--NI 58
           M KK  L+   EV++T +L+AG+ +G+     + P + VKI+LQ    +  + +     I
Sbjct: 111 MMKKFKLK---EVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTI 167

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-RGGLDLNISPQLYSCLVGSLA 117
           ++ +G+ G + G         I+  + FG    +  F+ R              LVG++A
Sbjct: 168 IENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIA 227

Query: 118 GMTSSLASYPFDVLRTRFAAN---SQGQLIKLR-DEIMAIWSHEGLMGFFSGCGSSMINI 173
           G  S   S PFDV++TR   +   S G         +  I+  EG+ G + G    +   
Sbjct: 228 GCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRY 287

Query: 174 GLNTAIMFGVYESIKIFTEERSKLSDR 200
           G    ++  V+  +     E  ++SD 
Sbjct: 288 GPGGGLLLVVFNGV----NELFRMSDH 310

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 17/143 (11%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF--------------AANSQGQLIKLRDEIM 151
           P +Y  + G++AGM+ ++  YP DV++TRF              A   Q +   +   + 
Sbjct: 12  PFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLS 71

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA 211
            I   EG    + G    ++      A+ F   E  +    ++ KL +     TL   LA
Sbjct: 72  KILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTL---LA 128

Query: 212 GPISGFTSKLATFPLDTVRRRIQ 234
           G  +G T  L   P + V+ R+Q
Sbjct: 129 GTFAGITESLIVVPFELVKIRLQ 151

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 201 RDPFTL---LNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           +DP  L      ++G ++G +  +  +PLD V+ R Q++ +   ++     +  + K  +
Sbjct: 6   KDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQIN---KKALATSSVAVPKQPE 62

Query: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           +   L     ++++EG  +LY+G++  L+  VP  A+   S E F
Sbjct: 63  HSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQF 107

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 125/290 (43%), Gaps = 34/290 (11%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMY 78
           ++ GS++G   +    P DTVK++LQ  P +        I       G W+G   G I  
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQG-IGS 68

Query: 79  IIYGGAQFGSYTYIGSFLRGG--LDLN--ISPQLYSCLVGSLAGMTSSLASYPFDVLRTR 134
            + G A   +  ++ SF +    LD+   +SP   +   G+ AG  +S    P ++++ +
Sbjct: 69  PLAGAALENAVLFV-SFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVELIKCK 127

Query: 135 FA----ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
                 + ++    K+   I ++ S  G +G + G   + I      A  F  YE +K +
Sbjct: 128 LQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNY 187

Query: 191 TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTK 250
              R + +++   + LL   +G  +G     + FP DT++  +Q              T 
Sbjct: 188 LASRRQ-AEQNTTWELLA--SGASAGLAFNASIFPADTIKSTMQ--------------TD 230

Query: 251 DIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
            I  S   R+       +  ++G    YRG+ ++LI++VP+ A   ++YE
Sbjct: 231 HIDLSSATRK-------IYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 15/181 (8%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQV-------TPHNKNANVLINILKREGIRGFW 68
           + ++ AG+ +G  A   + P++ +K KLQV       T H K    + ++L   G  G W
Sbjct: 101 SKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLW 160

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
           +G     I     G A F +Y  + ++L  R   + N + +L +   G+ AG+  + + +
Sbjct: 161 QGQSGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLAS--GASAGLAFNASIF 218

Query: 127 PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYES 186
           P D +++      Q   I L      I++ +G+ GF+ G G ++I      A +F  YE+
Sbjct: 219 PADTIKSTM----QTDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYET 274

Query: 187 I 187
           +
Sbjct: 275 L 275

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGF 67
           R+ E+ +T   L +G+ +GL     I P DT+K  +Q T H   ++    I  R+GI GF
Sbjct: 192 RQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQ-TDHIDLSSATRKIYARQGIAGF 250

Query: 68  WKG 70
           ++G
Sbjct: 251 YRG 253

>Scas_667.22
          Length = 306

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 122/302 (40%), Gaps = 29/302 (9%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGF 67
           K +       L+AG+  G+       P DT K++LQ +     A  V+  +LK EG +GF
Sbjct: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGF 78

Query: 68  WKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-----PQLYSCLVGSLAGMTSS 122
           +KG +   I        QFG    +  F       + S     PQ Y C  G   G+T+S
Sbjct: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYIC--GLTGGITNS 136

Query: 123 LASYPFDVLRTRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
             + P + +R R    +  G  ++ +  +  I       GF  G   +M+  G      F
Sbjct: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYF 196

Query: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN--SP 239
            VYE+  +   E +K   R +       L G +SG T  +  +PLD ++  +Q  N  SP
Sbjct: 197 LVYEA--MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP 254

Query: 240 NEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
                     K +Y         G+G          + ++G   +++++ P+   +  ++
Sbjct: 255 KYGNSISSVAKTLYAKG------GLG----------AFFKGFGPTMLRAAPANGATFATF 298

Query: 300 EL 301
           EL
Sbjct: 299 EL 300

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 80/198 (40%), Gaps = 14/198 (7%)

Query: 1   MNKKDHLRKDEEVSTTNSL----VAGSLSGLFARTCIAPLDTVKIKLQVT----PHNKNA 52
           M +  H R  +  S   SL    + G   G+      +P++ V+I+LQ      P+ +  
Sbjct: 103 MKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162

Query: 53  NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSC 111
             L  I K     GF +G  P  +      G  F  Y   + + +  G      P    C
Sbjct: 163 GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLC 222

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAI----WSHEGLMGFFSGCG 167
           L G+L+G T  +  YP DV+++    ++  +  K  + I ++    ++  GL  FF G G
Sbjct: 223 LFGALSGTTLWMMVYPLDVIKSVMQTDNL-KSPKYGNSISSVAKTLYAKGGLGAFFKGFG 281

Query: 168 SSMINIGLNTAIMFGVYE 185
            +M+         F  +E
Sbjct: 282 PTMLRAAPANGATFATFE 299

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 133/329 (40%), Gaps = 37/329 (11%)

Query: 3   KKDHLRK-----DEEVSTT-NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI 56
           K D L K     DE++S   + +V+G + G    + +  LDTVK + Q  P+ K    +I
Sbjct: 35  KDDKLHKKRGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMI 94

Query: 57  N----ILKREGIR-GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC 111
           +    I   EG+R G + G +   +         FG+Y Y    +    D  I+  +   
Sbjct: 95  SAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIE--DWQINDTITHL 152

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQL-----------IKLRDEIMAIWSHEGLM 160
             G L    SS    P +VL+TR     QG+              LR+ I  +   EG  
Sbjct: 153 SAGFLGDFISSFVYVPSEVLKTRLQL--QGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFR 210

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTS 219
             F G  +++      +A+ F  YE  +    +  +   R    ++ NE L G  +G  +
Sbjct: 211 SLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLA 270

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISM-------VQQE 272
            + T P+D V+ R+Q +  P++       T   +    N R   +  S+        Q E
Sbjct: 271 GIITTPMDVVKTRVQTQQPPSQSNKSYSVT---HPHVTNGRPAALSNSISLSLRTVYQSE 327

Query: 273 GPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           G L  + GV    + +   ++I L  Y++
Sbjct: 328 GVLGFFSGVGPRFVWTSVQSSIMLLLYQM 356

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 100/212 (47%), Gaps = 23/212 (10%)

Query: 97  RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG--QLIKLRDEIMA-- 152
           RG  D ++SP  +  + G + G     A +  D ++TR     QG   + K R+ I A  
Sbjct: 43  RGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTR----QQGAPNVKKYRNMISAYR 98

Query: 153 -IWSHEGLM-GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL 210
            IW  EG+  G + G  ++M+    + AI FG YE  K     R+ + D +   T+ +  
Sbjct: 99  TIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTK-----RTMIEDWQINDTITHLS 153

Query: 211 AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQ 270
           AG +  F S     P + ++ R+Q++      R +  F +  Y +Y N R      ++++
Sbjct: 154 AGFLGDFISSFVYVPSEVLKTRLQLQG-----RFNNPFFQSGY-NYSNLR--NAIKTVIK 205

Query: 271 QEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           +EG  SL+ G   +L + +P +A+    YE F
Sbjct: 206 EEGFRSLFFGYKATLARDLPFSALQFAFYEKF 237

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 122/291 (41%), Gaps = 34/291 (11%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPHNKN--ANVLINILKREGIRGFWKGNVPGSIMYI 79
           G  +G+FA     PLD  K++LQ  P  K     +L +ILK EGI G + G     +   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 80  IYGGAQFGSYTYIGSFL--RGGLDLNISPQLYSCLV-GSLAGMTSSLASYPFDVLRTRFA 136
            Y  A+FG Y  +   +  R  L  N+   L + +V G+L G+  + A    D++  R  
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLT-NMWYLLGASMVSGALGGLAGNFA----DLINIRMQ 127

Query: 137 ANSQGQLIKLR------DEIMAIWSHEGLMG-FFSGCGSSMINIGLNTAIMFGVYESIKI 189
            +S   L K R      D ++ I+  EG    F +G   +M+   L TA     Y+  K 
Sbjct: 128 NDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKN 187

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFT 249
           F   +  +  +++   L + L   ++GF +     P D ++  +   +      HD  F 
Sbjct: 188 FLVTKYNMDPKKNSTHLTSSL---LAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFK 244

Query: 250 KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                         + +  + +EGP  ++RG   S  +  P T +  ++ E
Sbjct: 245 --------------ILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 94/197 (47%), Gaps = 22/197 (11%)

Query: 109 YSCLVGSLAGMTSSLASYPFDVLRTRFAANS--QGQLIKLRDEIMAIWSHEGLMGFFSGC 166
           Y    G  AG+ + + ++P D+ + R  A    +  ++++   I+    +EG++G ++G 
Sbjct: 8   YPWWYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSIL---KNEGIVGLYAGL 64

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPL 226
            +S++     T   FG+Y+++K     R KL++    + LL   A  +SG    LA    
Sbjct: 65  SASLLRQCTYTTARFGMYDALKEHVIPRDKLTNM---WYLLG--ASMVSGALGGLAGNFA 119

Query: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY-RGVTMSL 285
           D +  R+Q         +D     D  ++YKN   +   + + + EG  SL+  G   ++
Sbjct: 120 DLINIRMQ---------NDSALPLDKRRNYKNA--IDGMVKIYKAEGAKSLFLTGWKPNM 168

Query: 286 IKSVPSTAISLWSYELF 302
           ++ V  TA  + +Y++F
Sbjct: 169 VRGVLMTASQVVTYDMF 185

>Kwal_27.12599
          Length = 304

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 120/289 (41%), Gaps = 24/289 (8%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77
           L+AG+  G+       P DT K++LQ +     A  V+  ++K EG+RGF+KG +   + 
Sbjct: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVG 87

Query: 78  YIIYGGAQFGSYTYIGSFLRGG-LDLNIS---PQLYSCLVGSLAGMTSSLASYPFDVLRT 133
                  QFG    +  F RG   D + +   PQ Y C  G + G+ +S  + P + +R 
Sbjct: 88  VGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYIC--GFVGGVANSFLASPIEHVRI 145

Query: 134 RFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192
           R     + G + + +  +  I           G   +++      A  F  YE++     
Sbjct: 146 RLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEAL--VAN 203

Query: 193 ERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDI 252
           +  K   R D       L G +SG T  L  +PLD ++  +Q  N  N  R         
Sbjct: 204 QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVR--------- 254

Query: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                 +  + V   +  + G  S ++G   +++++ P+   +  ++EL
Sbjct: 255 -----GKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 5/132 (3%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           L   L G+  GM   L   PFD  + R   ++        + +  +  +EGL GF+ G  
Sbjct: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--TTAVEVVKKLVKNEGLRGFYKGTL 82

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPL 226
           + ++ +G   +  FGV E++K F   R   +D     TL    + G + G  +     P+
Sbjct: 83  TPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLTLPQYYICGFVGGVANSFLASPI 140

Query: 227 DTVRRRIQIRNS 238
           + VR R+Q + +
Sbjct: 141 EHVRIRLQTQTA 152

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 133/309 (43%), Gaps = 39/309 (12%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR------------EGIRG 66
           +++G  +G        PLD VK++LQ+   NK      +++KR            E  RG
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRG 71

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL---------DLNISPQLYSCLVGSLA 117
                +  S+ + +Y G    S  ++  +    +         D  ++  +Y  L  +++
Sbjct: 72  LGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY-LLAAAMS 130

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIG 174
           G+ +S+ + P  V++TR  + S       R   D I  ++  EGL GF+ G   S+  + 
Sbjct: 131 GVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGVS 190

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPISGFTSKLATFPLDTVRRRI 233
              AI F VY+++K +    +K  D++   + L  +    +S   S  A +PL  ++  +
Sbjct: 191 -QGAIYFTVYDTLK-YHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNL 248

Query: 234 QIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           Q                 +     + R   +  ++  ++G   LY+G+  +LI++VPST 
Sbjct: 249 QSFE-----------VSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTC 297

Query: 294 ISLWSYELF 302
           I+   YE F
Sbjct: 298 ITFCVYENF 306

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 89/197 (45%), Gaps = 16/197 (8%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT------PHNKNANVLINILK 60
           +  D+E+++   L+A ++SG+       P+  +K ++  T       +    + +  + +
Sbjct: 112 MNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYR 171

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS---CLVGSLA 117
            EG+ GFW+G VP S+  +  G   F  Y  +         ++   +L +     + SL+
Sbjct: 172 IEGLAGFWRGLVP-SLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLS 230

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLI------KLRDEIMAIWSHEGLMGFFSGCGSSMI 171
            M S  A YP  +L++   +     +I      ++   I  I+  +G+ G + G  +++I
Sbjct: 231 KMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLI 290

Query: 172 NIGLNTAIMFGVYESIK 188
               +T I F VYE+ +
Sbjct: 291 RAVPSTCITFCVYENFR 307

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 15/169 (8%)

Query: 103 NISPQLYSCLVGSLAGMTSSLASYPFDVLRTR---FAANS--QGQLIKLRDEIMAIWSHE 157
           + SP     + G  AG  ++++++P D+++ R    A N   QG    ++  +     H 
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 158 GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEE---------RSKLSDRRDPFTLLN 208
                + G G +++   +   + FG+Y + K +  +          + +++ ++  +L+ 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY 123

Query: 209 ELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
            LA  +SG  + + T P+  ++ RI +  S  + R  R     I K Y+
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRI-MSTSFVDSRSYRSTVDGIKKLYR 171

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 9/74 (12%)

Query: 6   HLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ-------VTPHNKN--ANVLI 56
           H+ K +++S    +   SLS + + T + PL  +K  LQ       + P   +    ++ 
Sbjct: 211 HVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLIT 270

Query: 57  NILKREGIRGFWKG 70
            I  R+G+ G +KG
Sbjct: 271 TIYVRDGVTGLYKG 284

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 127/332 (38%), Gaps = 67/332 (20%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNK-------------------------NA 52
           +LVAG  +GLF   C  PLDT+K+++Q+                              +A
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 53  NVLI----------NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL 102
              I          NI  +EG    +KG     I  I     +F SY +  + L      
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-ADKQT 132

Query: 103 NISPQLYSCLVGSLAGMTSS-LASYPFDVLRTRFAA---NSQGQLIKLR--DEIMA---I 153
            +     + + G  AG+T + L   P +V++ R  A   N    L K +  + + A   I
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 154 WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGP 213
              EG+   + G   +      N    F VY  ++ F +E           T      G 
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWET---SCIGL 249

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKN----RRFLGVGISMV 269
           ISG     +  PLDT++ R+Q               KD   S+K     +R   +G  ++
Sbjct: 250 ISGAIGPFSNAPLDTIKTRLQ---------------KDKSTSFKGESGWKRIAHIGTQLL 294

Query: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           ++EG  +LY+G+T  +++  P  A++   YE 
Sbjct: 295 KEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 326

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 81/194 (41%), Gaps = 18/194 (9%)

Query: 13  VSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQVTPHNKNANVL-----------INILK 60
           VST+N+ +AG  +G+  A   + P++ VKI+LQ    N N ++              I+K
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
            EGI   ++G    +       GA F  Y+ +  FL+        P   +  +G ++G  
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAI 254

Query: 121 SSLASYPFDVLRTRFAANS------QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
              ++ P D ++TR   +       +    ++      +   EG    + G    ++ + 
Sbjct: 255 GPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

Query: 175 LNTAIMFGVYESIK 188
              A+ F VYE ++
Sbjct: 315 PGQAVTFTVYEFVR 328

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 47/112 (41%), Gaps = 15/112 (13%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRN---------------SPNEERHDREFTK 250
           ++N +AG  +G    L   PLDT++ R+QI                              
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 251 DIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           D   + K   F+  G ++  QEG L+LY+G+   +I  +P  AI   SYE +
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFY 123

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 126/312 (40%), Gaps = 52/312 (16%)

Query: 27  LFARTCIAPLDTVKIKL---------------QVTPHNKNAN----------VLINILKR 61
           + +RTC AP D +K+ L               Q+  HN  A+             ++ ++
Sbjct: 187 VVSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQ 246

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG----GLDLNISPQLYSCLVGSLA 117
            G+R F+ GN    I        +FGS+      L G    G    +S +L + + G L 
Sbjct: 247 GGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELS-RLSTYVAGGLG 305

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIK----LRDEIMAIWSHEGLMGFFSGCGSSMINI 173
           G+ +  + YP D L+ R          +    L      ++   GL  F+ G G  ++ +
Sbjct: 306 GIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGV 365

Query: 174 GLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLAT---FPLDT 228
               A+  G + ++K    T   + L    +   + N +  P+  F+  +     +P++ 
Sbjct: 366 FPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINL 425

Query: 229 VRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKS 288
           +R R+Q + +     H  +  +D+++              VQ+EG   LY+G+  +L K 
Sbjct: 426 LRTRLQAQGT-YAHPHRYDGFQDVFRK------------TVQREGLPGLYKGLVPTLAKV 472

Query: 289 VPSTAISLWSYE 300
            P+ AIS   YE
Sbjct: 473 CPAVAISYLCYE 484

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 23/198 (11%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK------RE-GI 64
           E+S  ++ VAG L G+ A+  + P+DT+K ++Q  P +     L  ++K      RE G+
Sbjct: 292 ELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGL 351

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQ--LYSCLV----GSL 116
           R F++G   G +    Y     G+++ +  +   R    L IS    + S LV    G+ 
Sbjct: 352 RLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAF 411

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIK------LRDEIMAIWSHEGLMGFFSGCGSSM 170
           +G   +   YP ++LRTR  A  QG           +D        EGL G + G   ++
Sbjct: 412 SGTVGATVVYPINLLRTRLQA--QGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

Query: 171 INIGLNTAIMFGVYESIK 188
             +    AI +  YE++K
Sbjct: 470 AKVCPAVAISYLCYENLK 487

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 127/308 (41%), Gaps = 45/308 (14%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR 61
           K +E +   + + G +S   A+T  +P++ VKI +Q           +K  + +++  KR
Sbjct: 6   KQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKR 65

Query: 62  ----EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYI----GSFLRGGLDLNISPQLYSCLV 113
               EG+  FW+GN    I Y       F     I    G     G     +  L S   
Sbjct: 66  TAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLAS--- 122

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGC 166
           G  AG  S L  Y  D  RTR AA+++        Q   L D        +G+ G + G 
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPL 226
             S++ I +   + FG+++S+K        L+   D   L + L G +    +   ++PL
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLV-----LTGSLDGSFLASFLLGWVVTTGASTCSYPL 237

Query: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLI 286
           DTVRRR+ +  S    +++     D  K             +V  EG  SL++G   +++
Sbjct: 238 DTVRRRMMM-TSGQAVKYNGAI--DCLK------------KIVASEGVGSLFKGCGANIL 282

Query: 287 KSVPSTAI 294
           +SV    +
Sbjct: 283 RSVAGAGV 290

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query: 207 LNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGI 266
           +N L G +S   +K A  P++ V+  IQ     N++   ++ T D  K Y     +    
Sbjct: 14  INFLMGGVSAAIAKTAASPIERVKILIQ-----NQDEMIKQGTLD--KKYSG--IVDCFK 64

Query: 267 SMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
              +QEG +S +RG T ++I+  P+ A++ 
Sbjct: 65  RTAKQEGLISFWRGNTANVIRYFPTQALNF 94

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 67.8 bits (164), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 123/300 (41%), Gaps = 40/300 (13%)

Query: 14  STTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVP 73
           S    +  GS++G   +    P DTVK++LQ  P +        I       G WKG   
Sbjct: 6   SALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQ 65

Query: 74  GSIMYIIYGGA-----QFGSYTYIGSFLRGGLDLN-ISPQLYSCLVGSLAGMTSSLASYP 127
           G I   ++G A      F S+    +FL     L  ++  +YS   G+ AG  +S    P
Sbjct: 66  G-IASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYS---GAFAGACASFILTP 121

Query: 128 FDVLRTRFA----ANSQGQLIK---LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
            ++++ +      +NS  Q  +   +   I ++   +GL+G + G  S+ +   L  A+ 
Sbjct: 122 VELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVW 181

Query: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN 240
           F  YE +K+              + LL  ++G  +G     + FP DTV+   Q  +   
Sbjct: 182 FTTYEIMKMKFASLHPAEKENHTWELL--VSGASAGVLFNASVFPADTVKSVCQTEHV-- 237

Query: 241 EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                      I  + K          +++  G    YRG+ ++LI++ P+ A   ++YE
Sbjct: 238 ----------SIVNALKK---------VLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 82/184 (44%), Gaps = 15/184 (8%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQV----------TPHNKNANVLINILKREGIR 65
           T ++ +G+ +G  A   + P++ VK KLQV          T H      + +++K +G+ 
Sbjct: 102 TKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLL 161

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLA 124
           G W+G +   +   + G   F +Y  +                +  LV G+ AG+  + +
Sbjct: 162 GLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNAS 221

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
            +P D +++      Q + + + + +  +    G+ GF+ G G ++I      A +F  Y
Sbjct: 222 VFPADTVKSV----CQTEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTY 277

Query: 185 ESIK 188
           E++K
Sbjct: 278 ETLK 281

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWK 69
           ++E  T   LV+G+ +G+     + P DTVK   Q T H    N L  +L+  GI GF++
Sbjct: 199 EKENHTWELLVSGASAGVLFNASVFPADTVKSVCQ-TEHVSIVNALKKVLRTHGITGFYR 257

Query: 70  G 70
           G
Sbjct: 258 G 258

>Kwal_23.2913
          Length = 320

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 91/195 (46%), Gaps = 19/195 (9%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K   ++T+   +AG  S +      AP + VK+ LQ +           +++  G+R  +
Sbjct: 135 KLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTLIREGGVRSLF 194

Query: 69  KGNV-------PGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTS 121
           +G +       PGS +Y       F SY     FL    D +    +  C+ G +AGM+ 
Sbjct: 195 QGTLATLARDGPGSALY-------FASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSM 247

Query: 122 SLASYPFDVLRTRFAANSQGQ-LIKLRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAI 179
            +  +P D ++T+  ++S+ Q +++   E   I++  GL GFF G G +++ +   N A 
Sbjct: 248 WIGVFPIDTIKTKLQSSSRSQSMVQAARE---IYTRAGLRGFFPGLGPALMRSFPANAAT 304

Query: 180 MFGVYESIKIFTEER 194
             GV  + ++F + R
Sbjct: 305 FLGVEFTHQLFKQNR 319

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/307 (19%), Positives = 121/307 (39%), Gaps = 48/307 (15%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREG----------IRG 66
            SL AG + G+ A     P D +K++ Q    +   + +  +L              I+G
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIKG 89

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR----------GGLDLNISPQLYS--CLVG 114
           F++G +P  +         F  Y  +G  L            G    ++P   S   L G
Sbjct: 90  FYRGVIPPLLGVTPIFAVSFWGYD-VGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAG 148

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
             + + ++L + P + ++     +  G  +     ++      G+   F G  +++   G
Sbjct: 149 FFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTLI---REGGVRSLFQGTLATLARDG 205

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
             +A+ F  YE  K F   R++ +D     ++   +AG ++G +  +  FP+DT++ ++Q
Sbjct: 206 PGSALYFASYEVSKRFLS-RNQDTDALSVVSIC--VAGGVAGMSMWIGVFPIDTIKTKLQ 262

Query: 235 IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
              S +  +   +  ++IY     R F                + G+  +L++S P+ A 
Sbjct: 263 ---SSSRSQSMVQAAREIYTRAGLRGF----------------FPGLGPALMRSFPANAA 303

Query: 295 SLWSYEL 301
           +    E 
Sbjct: 304 TFLGVEF 310

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 126/303 (41%), Gaps = 40/303 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--------NILKREGIRGFWK 69
           +L+AG  +GL    C  PLDT+K+++Q+  +   + V           I + EG   F+K
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           G     I        +F SY +  + L       +S    + + G  AG+T ++      
Sbjct: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAVVVVNPM 131

Query: 130 VL-RTRFAA---NSQGQLIKLRDEIMAIWS---HEGLMGFFSGCGSSMINIGLNTAIMFG 182
            + + R  A   N      K ++ + A ++    EG    + G   +      N    F 
Sbjct: 132 EVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191

Query: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
           VY  +K F +      ++    +    L G ISG     +  PLDT++ R+Q        
Sbjct: 192 VYSKLKEFLQ---GYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-------- 240

Query: 243 RHDREFTKDIYKSYKN----RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
                  KD  KS KN    +R   +G  ++Q+EG  +LY+G+T  +++  P  A++  +
Sbjct: 241 -------KD--KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291

Query: 299 YEL 301
           YE 
Sbjct: 292 YEF 294

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 14/195 (7%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKLQV--------TPHNKNA-NVLIN 57
           ++  +VST N+ +AG  +G+  A   + P++ VKI+LQ          P  KNA      
Sbjct: 102 KETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYT 161

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
           I+K EG    ++G    +       GA F  Y+ +  FL+G  +  + P   + L+G ++
Sbjct: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLIS 221

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSH----EGLMGFFSGCGSSMINI 173
           G     ++ P D ++TR   +   + +     I  I       EG    + G    ++ +
Sbjct: 222 GAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRV 281

Query: 174 GLNTAIMFGVYESIK 188
               A+ F  YE I+
Sbjct: 282 APGQAVTFTAYEFIR 296

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 198 SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           S ++     +N +AG  +G    L   PLDT++ R+QI            +   +    K
Sbjct: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI------------YKNAVGSGVK 50

Query: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
              F+  G  + + EG L+ Y+G+   +I   P  AI   SYE +
Sbjct: 51  APGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFY 95

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 122/305 (40%), Gaps = 48/305 (15%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLINILKREG-IRGFWKGNVPG 74
           ++ GS++G   +    P DTVK++LQ    +      + +    K EG I+GF++G    
Sbjct: 17  ILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASP 76

Query: 75  SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTR 134
                I   A F SY     FL+     N+S      + G+ AG  +S    P ++++ +
Sbjct: 77  LAGAAIENAALFLSYNQCSKFLQH--YTNVSDLTNILISGAFAGSCASFVLTPVELIKCK 134

Query: 135 FAANSQGQL--------------IKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
              ++   L               ++   I A+  + G +G + G   + I         
Sbjct: 135 LQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAW 194

Query: 181 FGVYESIKIFTEERSKLSDRRDP-----FTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
           F  YE +K + + R  + D   P     + LL   +G  +G     + FP DTV+  +Q 
Sbjct: 195 FATYELMKKYLKSRHNIEDPSLPNDNKTWELLA--SGASAGLAFNASIFPADTVKSMMQ- 251

Query: 236 RNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
                E    +   K I+                 ++G    YRG+ ++LI+++P+ A  
Sbjct: 252 ----TEHLGLKTAIKKIFV----------------EKGLRGFYRGLGITLIRAIPANATV 291

Query: 296 LWSYE 300
            + YE
Sbjct: 292 FYVYE 296

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 92/197 (46%), Gaps = 31/197 (15%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP-----------------HNKNANVLINI 58
           TN L++G+ +G  A   + P++ +K KLQV+                  H +    +  +
Sbjct: 108 TNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAV 167

Query: 59  LKREGIRGFWKGNVPGSIMYIIYGG-AQFGSYTYIGSFLRGGLDLNISPQL------YSC 111
           +K  G  G W+G   G+ +   +GG A F +Y  +  +L+   ++   P L      +  
Sbjct: 168 IKNRGFIGLWQGQ-SGTFIRESFGGVAWFATYELMKKYLKSRHNIE-DPSLPNDNKTWEL 225

Query: 112 LV-GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
           L  G+ AG+  + + +P D +++      Q + + L+  I  I+  +GL GF+ G G ++
Sbjct: 226 LASGASAGLAFNASIFPADTVKSMM----QTEHLGLKTAIKKIFVEKGLRGFYRGLGITL 281

Query: 171 INIGLNTAIMFGVYESI 187
           I      A +F VYE++
Sbjct: 282 IRAIPANATVFYVYETL 298

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 3   KKDHLRKDEEVSTTNS----LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINI 58
           K  H  +D  +   N     L +G+ +GL     I P DTVK  +Q T H      +  I
Sbjct: 206 KSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQ-TEHLGLKTAIKKI 264

Query: 59  LKREGIRGFWKG 70
              +G+RGF++G
Sbjct: 265 FVEKGLRGFYRG 276

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 120/293 (40%), Gaps = 41/293 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQ--------VTPHNKNANVLINILKR----EGIRGFWK 69
           G +S   A+T  +P++ VK+ +Q         T   K A +L +  KR    EG+  FW+
Sbjct: 30  GGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGIL-DCFKRTATQEGVISFWR 88

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLASYPF 128
           GN    I Y       F     I +      +   +      L  G  AG  S L  Y  
Sbjct: 89  GNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSL 148

Query: 129 DVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           D  RTR AA+S+        Q   L D        +G+ G + G   S++ I +   + F
Sbjct: 149 DYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYF 208

Query: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNE 241
           G+Y+S+K        L+   +   L + L G +    +   ++PLDTVRRR+ +  S   
Sbjct: 209 GMYDSLKPLL-----LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM-TSGQA 262

Query: 242 ERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
            ++D  F  D  +             +V  EG  SL++G   ++++ V    +
Sbjct: 263 VKYDGAF--DCLR------------KIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 86/180 (47%), Gaps = 15/180 (8%)

Query: 20  VAGSLSGLF------ARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVP 73
            AG+LS LF      ART +A       K      N   +V    LK +G+ G ++G +P
Sbjct: 136 AAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLP 195

Query: 74  GSIMYIIYGGAQFGSYTYIGS-FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLR 132
             +  ++Y G  FG Y  +    L G L+ +    L S L+G +    +S  SYP D +R
Sbjct: 196 SVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSF---LASFLLGWVVTTGASTCSYPLDTVR 252

Query: 133 TRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
            R    S GQ +K     D +  I + EG+   F GCG++++  G+  A +  +Y+ +++
Sbjct: 253 RRMMMTS-GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR-GVAGAGVISMYDQLQM 310

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 15/94 (15%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
           L++ L G +S   +K A  P++ V+  IQ     N++   ++ T D       R++ G+ 
Sbjct: 24  LIDFLMGGVSAAVAKTAASPIERVKLLIQ-----NQDEMLKQGTLD-------RKYAGIL 71

Query: 266 ISM---VQQEGPLSLYRGVTMSLIKSVPSTAISL 296
                   QEG +S +RG T ++I+  P+ A++ 
Sbjct: 72  DCFKRTATQEGVISFWRGNTANVIRYFPTQALNF 105

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 18/70 (25%)

Query: 19  LVAGSLSGLF-------------ARTCIAPLDTVKIKL-----QVTPHNKNANVLINILK 60
           L+ GSL G F             A TC  PLDTV+ ++     Q   ++   + L  I+ 
Sbjct: 218 LLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVA 277

Query: 61  REGIRGFWKG 70
            EG+   +KG
Sbjct: 278 AEGVGSLFKG 287

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 126/307 (41%), Gaps = 33/307 (10%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI-NILKRE 62
           +  ++V  T S VAG+L+G    +   P +  K +LQ+    +  ++N  VLI N  K +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-PQLYSCLVGSLAGMTS 121
           G+   + G     +        +F  Y  I + L+      +S P+    L G  AG+  
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPR--GVLAGLGAGLLE 120

Query: 122 SL-ASYPFDVLRTRFAANSQGQLIKLRDE-------IMAIWSHEGLMGFFSGCGSSMINI 173
           S+ A  PF+ ++T    + Q    K ++         +++   EG  G + G     +  
Sbjct: 121 SVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQ 180

Query: 174 GLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI 233
             N A+  G Y  IK+  ++ +     +   + L  + G  SG  +  AT P+DTV+ R+
Sbjct: 181 AANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 234 QIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           Q   +         FT  IYK                +EG  + ++G T  L + + S  
Sbjct: 241 QSLTASKYSSTLNCFT-TIYK----------------EEGLKTFWKGATPRLGRLILSGG 283

Query: 294 ISLWSYE 300
           I    YE
Sbjct: 284 IVFTIYE 290

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (46%), Gaps = 20/200 (10%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKI-----KLQVTPHNKN-----ANVLI 56
           +K  E+S    ++AG  +GL  +   + P + +K      K  V P  +N     A   I
Sbjct: 99  KKTGELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYI 158

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ---LYSCL- 112
           +++K EG RG + G +P S+        + G Y  I   ++   D   +P+   L S L 
Sbjct: 159 SLVKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQ---DYTGAPKDKPLTSGLT 215

Query: 113 --VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
             VG+ +G+ +  A+ P D ++TR  + +  +     +    I+  EGL  F+ G    +
Sbjct: 216 FIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRL 275

Query: 171 INIGLNTAIMFGVYESIKIF 190
             + L+  I+F +YE++ ++
Sbjct: 276 GRLILSGGIVFTIYENVLLY 295

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 98/231 (42%), Gaps = 21/231 (9%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV---TP-----------HNKNANVLINILKREGI 64
            ++G+++G+   T + PLD VK + Q+   TP           +N   + L  I+K+EG 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
              ++G     +M       +F          +   + N + Q  S   G+ AGMT +  
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAV 135

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV- 183
             PF++++ R   + +   +   D +     +EG+MG + G  S+M    L     FGV 
Sbjct: 136 IVPFELIKIRM-QDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
           Y+        ++K    R+     + +AG I G    +   P D V+ RIQ
Sbjct: 195 YQVRNSMPVAKTKGQKTRN-----DLIAGAIGGTVGTMLNTPFDVVKSRIQ 240

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 84/197 (42%), Gaps = 18/197 (9%)

Query: 6   HLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREG 63
           +L    E +   S+ AG+ +G+     I P + +KI++Q   + +    + L   +K EG
Sbjct: 109 NLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEG 168

Query: 64  IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RGGLDLNISPQLYSCLVGSLAG 118
           I G +KG         ++ G  FG    + + +     +G    N        + G++ G
Sbjct: 169 IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRN------DLIAGAIGG 222

Query: 119 MTSSLASYPFDVLRTRF-AANSQGQLIKLRD----EIMAIWSHEGLMGFFSGCGSSMINI 173
              ++ + PFDV+++R  + ++    +K  +     ++ I+  EG    + G    +  +
Sbjct: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282

Query: 174 GLNTAIMFGVYESIKIF 190
               ++M  V+  +  F
Sbjct: 283 APGGSLMLVVFTGMMNF 299

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 83/205 (40%), Gaps = 40/205 (19%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF-------AANSQGQLIK----LRDEIMAIW 154
           P +Y  + G++AG++     YP DV++TRF        A + G+ ++    + D +  I 
Sbjct: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70

Query: 155 SHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI-KIFTEERSKLSDRRDPFTLLNELAGP 213
             EG    + G  S M+      A  F   +   KIF      L +  +    ++  AG 
Sbjct: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF----KNLFNTNETTQKISIAAGA 126

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEG 273
            +G T      P + ++ R+Q                D+  SY     +      ++ EG
Sbjct: 127 SAGMTEAAVIVPFELIKIRMQ----------------DVKSSYLGP--MDCLKKTIKNEG 168

Query: 274 PLSLYRGVTMSLIKSVPSTAISLWS 298
            + LY+G+  ++ ++      +LW+
Sbjct: 169 IMGLYKGIESTMWRN------ALWN 187

>Scas_721.129
          Length = 323

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 123/307 (40%), Gaps = 42/307 (13%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---------ILKR 61
           ++VS   S +AG ++   A T   P++ VKI++Q+          +          I + 
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRN 76

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN-----ISPQLYSCLVGSL 116
           EGIRG  KG V   I  I   G++ G Y  I + L      N     I     +   G+ 
Sbjct: 77  EGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS-------HEGLMGFFSGCGSS 169
           +G+  ++   P  +++TR  + S    I  +     +W+        EG  G F G  ++
Sbjct: 137 SGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAA 196

Query: 170 MINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
           ++  G  +++   +Y + K F  +   + D       L+  A  ISG    +   P D +
Sbjct: 197 ILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPG----LHLTASTISGLGVAVVMNPWDVI 252

Query: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
             RI      N++ +  +   D +            +  V+ EG  +LY+G    +++  
Sbjct: 253 LTRIY-----NQKGNLYKGPVDCF------------VKTVRTEGISALYKGFQAQILRIA 295

Query: 290 PSTAISL 296
           P T I L
Sbjct: 296 PHTIICL 302

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 109/288 (37%), Gaps = 32/288 (11%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--NILKREGIRGFWKGNVPGSIMYI 79
           G   G+ A     PLD  K++LQ  P  K   V +   IL+ EG+ G + G     +   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 80  IYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANS 139
            Y  A+FG Y ++         LN    L  C     +G    L   P DV+  R   N 
Sbjct: 75  TYTTARFGVYDFVKERYIPKEYLNSMLYLLPC--SMFSGAVGGLIGNPADVVNIRM-QND 131

Query: 140 QGQLIKLR-------DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTE 192
                +LR       D +  I S EG+   F+G   +++   L T+     Y+  K +  
Sbjct: 132 SSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYLV 191

Query: 193 ERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDI 252
           +   L          + L   ++G  +     P D ++ R+      N  +H  +    I
Sbjct: 192 QNVGLDKDNKSTHFASSL---LAGLVATTVCSPADVIKTRVM-----NAHKHSHDSAVRI 243

Query: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
                        +  V+QEGP  ++RG   S ++  P+T +   + E
Sbjct: 244 L------------LDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 82/184 (44%), Gaps = 21/184 (11%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQ--------VTPHNKNA-NVLINILKREGIRGFW 68
           S+ +G++ GL       P D V I++Q        +  + KNA + L  I   EG+   +
Sbjct: 107 SMFSGAVGGLIGN----PADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLF 162

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDL-NISPQLYSCLVGSLAGMTSSLAS 125
            G  P  +  I+   +Q  +Y    ++L    GLD  N S    S L   LAG+ ++   
Sbjct: 163 TGWQPNLVRGILMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSL---LAGLVATTVC 219

Query: 126 YPFDVLRTRFA-ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
            P DV++TR   A+       +R  + A+   EG    F G   S + +G NT ++F   
Sbjct: 220 SPADVIKTRVMNAHKHSHDSAVRILLDAV-KQEGPSFMFRGWLPSFVRLGPNTILIFLTV 278

Query: 185 ESIK 188
           E ++
Sbjct: 279 EQLR 282

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 125/308 (40%), Gaps = 33/308 (10%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI-NILKR 61
           + + ++V  + S +AG L+G    +   P +  K +LQ+    +  ++N  VLI N  K 
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKT 60

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-PQLYSCLVGSLAGMT 120
           +GI   + G     +      G +F  +  I + LR      +S P+    + G  AG+ 
Sbjct: 61  QGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPR--GVIAGLGAGLL 118

Query: 121 SSL-ASYPFDVLRTRFAANSQGQLIKLRDE-------IMAIWSHEGLMGFFSGCGSSMIN 172
            S+ A  PF+ ++T    + Q    K  +          A+   +GL G + G     + 
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

Query: 173 IGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRR 232
              N A+  G Y  IK+  ++ +     +   + L  + G  SG  +   T P+DTV+ R
Sbjct: 179 QAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTR 238

Query: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292
           +Q  +S         FT                 ++ ++EG  + ++G T  L +   S 
Sbjct: 239 MQSLDSKRYSSTINCFT-----------------TIFKEEGLKAFWKGATPRLGRLFLSG 281

Query: 293 AISLWSYE 300
            I    YE
Sbjct: 282 GIVFTVYE 289

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 90/200 (45%), Gaps = 16/200 (8%)

Query: 4   KDHLR--KDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKL-----QVTP--HNKNAN 53
           K+ LR  K  E+S    ++AG  +GL  +   + P + +K  L       TP  HN    
Sbjct: 92  KNLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKG 151

Query: 54  VLIN---ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS 110
           +L N   +++++G+ G ++G +P S+        + G Y  I   ++   +      L S
Sbjct: 152 MLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSS 211

Query: 111 CL---VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
            L   VG+ +G+ +   + P D ++TR  +    +     +    I+  EGL  F+ G  
Sbjct: 212 GLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGAT 271

Query: 168 SSMINIGLNTAIMFGVYESI 187
             +  + L+  I+F VYE +
Sbjct: 272 PRLGRLFLSGGIVFTVYEKV 291

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 132/323 (40%), Gaps = 54/323 (16%)

Query: 5   DHLRKDEEVSTT--------NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH--NKNANV 54
           D+ ++D+++  T         S VAG L+   A T   P++ +KI++Q+        A V
Sbjct: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63

Query: 55  LIN-------ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ 107
             N       I K EGI+G  KG     I  I   G++ G Y  I S L      +  P 
Sbjct: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123

Query: 108 L-----YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDE---------IMAI 153
                  +   G+ +G+  ++   P  +++TR  + S  + IK+ ++         ++ I
Sbjct: 124 KVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYS--EFIKIGEQTHYTGVWNGLVTI 181

Query: 154 WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGP 213
           +  EG+ G F G  ++++  G  +++   +Y + K    +   + D       L+  A  
Sbjct: 182 FKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG----PALHLTAST 237

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEG 273
           ISG    +   P D +  RI  +              D+YK       +   +  V+ EG
Sbjct: 238 ISGLGVAVVMNPWDVILTRIYNQKG------------DLYKGP-----IDCLVKTVRIEG 280

Query: 274 PLSLYRGVTMSLIKSVPSTAISL 296
             +LY+G    + +  P T + L
Sbjct: 281 VTALYKGFAAQVFRIAPHTIMCL 303

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/340 (24%), Positives = 138/340 (40%), Gaps = 74/340 (21%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV--------------- 54
           D E++     ++G+L+G  A   + PLD  K +LQ      N  V               
Sbjct: 102 DTEITA----LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKY 157

Query: 55  -------LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIG-SFLRGGLDLNISP 106
                  L  I++ E IRG +KG VP  + Y       F  Y     S+ R     N S 
Sbjct: 158 YSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPR---YFNNSE 214

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK-------LRDEIMAIWSHEGL 159
            L   +    AG  S+  + P  V++TR    S G+ IK         D  + I+  EG+
Sbjct: 215 FLSHSMSALTAGAISTTLTNPIWVVKTRLMLQS-GKNIKGMTHYKNTLDAFIKIYKVEGI 273

Query: 160 MGFFSGCGSSMINIGLNTAIMFGVYESIKIF---------TEERSKLSDRRDPFTLLNE- 209
             F+SG   S+  + L+ AI F VYE +K            +E   ++   +P T  +  
Sbjct: 274 KSFYSGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTN 332

Query: 210 -------LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFL 262
                  +A   S   +   T+P + +R R+Q+++             D+  S K+    
Sbjct: 333 FQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKS-------------DMKPSIKS---- 375

Query: 263 GVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
            +  +   +EG    Y G   ++ ++VP++AI+L S+E F
Sbjct: 376 -IIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLVSFEYF 414

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 127/308 (41%), Gaps = 33/308 (10%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILK 60
           + L  +E  S     VAG  SG+       P DT+K++LQ + +        + +    +
Sbjct: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAG 118
            +GIRGF+ G  P  + +I+      G        +   +  N     L  C++ G LAG
Sbjct: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132

Query: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            + S  + P ++ + +          + +   D I  I+S +G+ G + G  S++I    
Sbjct: 133 WSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRT 191

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG-FTSKLATFPLDTVRRRIQ 234
           +    +G YE +  +  E +K+S+       +N  AG  S  F      +P D V++ + 
Sbjct: 192 HFVYWWGSYELLTRWFRENTKMSE-----AAINFWAGGFSASFGFWTTAYPSDVVKQVVL 246

Query: 235 IRNSPNEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
             +  +   +  R   KDIY                Q +G    ++G   S ++S P+ A
Sbjct: 247 CNDKYDGSFKSWRTAVKDIY----------------QSKGINGFFKGFVPSFLRSFPANA 290

Query: 294 ISLWSYEL 301
            +L ++E 
Sbjct: 291 AALAAFEF 298

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 118/294 (40%), Gaps = 25/294 (8%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGS 75
             + AG++ G+       P DT K++LQ +        V+ N+L+ EG   F+KG +   
Sbjct: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87

Query: 76  IMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL-------VGSLAGMTSSLASYPF 128
           +   I    QFG    +  F        + PQ +  L        G   G+ +S  + P 
Sbjct: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPI 147

Query: 129 DVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
           + +R R     SQG   + +     I           G   +MI  G      F  YE++
Sbjct: 148 EHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEAL 207

Query: 188 KIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDRE 247
            +   E+    ++   + L +   G +SG    L  +P+D V+  +Q  +  N +     
Sbjct: 208 VVKEFEKGTPRNQIPAWKLCS--FGALSGTILWLTVYPVDVVKSVLQTDSIENPK----- 260

Query: 248 FTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                   YKN   +    ++ +Q G  + ++G   ++I++ P+ A +  S+E+
Sbjct: 261 --------YKNS-IIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305

>Scas_718.24
          Length = 337

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 127/323 (39%), Gaps = 53/323 (16%)

Query: 2   NKKDHLRKDEEVSTTN--------SLVAGSLSGLFARTCIAPLDTVKIKLQ--------- 44
           N +DH  +   + +T           + G +S   A+T  +P++ VK+ +Q         
Sbjct: 21  NGQDHKIQSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQG 80

Query: 45  --VTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYI----GSFLRG 98
              T +    +      ++EGI  FW+GN    I Y       F     I    G     
Sbjct: 81  TLDTKYKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKED 140

Query: 99  GLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG-------QLIKLRDEIM 151
           G     +  L S   G  AG  S L  Y  D  RTR AA+S+        Q   L D   
Sbjct: 141 GYGKWFAGNLAS---GGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYK 197

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA 211
                +G+ G + G   S++ I +   + FG+Y+SIK        L+   +   L + L 
Sbjct: 198 KTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVL-----LTGSLEGSFLASFLL 252

Query: 212 GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQ 271
           G +    +   ++PLDTVRR++ +  S    ++   F  D +K             +V  
Sbjct: 253 GWVVTTGASTCSYPLDTVRRKMMM-TSGQAVKYKGAF--DCFK------------KIVAA 297

Query: 272 EGPLSLYRGVTMSLIKSVPSTAI 294
           EG  SL++G   ++++ V    +
Sbjct: 298 EGVASLFKGCGANILRGVAGAGV 320

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 80/166 (48%), Gaps = 9/166 (5%)

Query: 28  FARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFG 87
           FART +A       K      N   +V    LK +G+ G ++G +P  +  I+Y G  FG
Sbjct: 169 FARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFG 228

Query: 88  SYTYIGS-FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKL 146
            Y  I    L G L+ +    L S L+G +    +S  SYP D +R +    S GQ +K 
Sbjct: 229 LYDSIKPVLLTGSLEGSF---LASFLLGWVVTTGASTCSYPLDTVRRKMMMTS-GQAVKY 284

Query: 147 R---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
           +   D    I + EG+   F GCG++++  G+  A +  +Y+ +++
Sbjct: 285 KGAFDCFKKIVAAEGVASLFKGCGANILR-GVAGAGVISMYDQLQM 329

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 207 LNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGI 266
           ++ L G +S   +K A  P++ V+  IQ +N   ++       K I   ++         
Sbjct: 44  IDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRR-------- 95

Query: 267 SMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
              QQEG +S +RG T ++I+  P+ A++ 
Sbjct: 96  -TAQQEGIISFWRGNTANVIRYFPTQALNF 124

>Kwal_27.12481
          Length = 304

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 119/292 (40%), Gaps = 39/292 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR----EGIRGFWKG 70
           G +S   ++T  AP++ VK+ +Q           ++    +    KR    EGI  FW+G
Sbjct: 17  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASFWRG 76

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLASYPFD 129
           N    I Y       F     I +      +   +      L  G  AG  S +  Y  D
Sbjct: 77  NTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGGLSLMFVYSLD 136

Query: 130 VLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
             RTR AA+S+G       Q   L D      + +G+ G + G   S++ I +   + FG
Sbjct: 137 YARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFG 196

Query: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
            Y+S+K        L+   +   L + L G      +  A++PLDTVRRR+ +  S    
Sbjct: 197 GYDSLKPLL-----LTGSLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMM-TSGQAV 250

Query: 243 RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
           +++  F  D ++             +V  EG  SL++G   ++++ V    +
Sbjct: 251 KYNGAF--DAFR------------KIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 93/199 (46%), Gaps = 21/199 (10%)

Query: 7   LRKDEEVST--TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLINI 58
            +K+E  +     +L +G  +G  +   +  LD  + +L            +  N L+++
Sbjct: 104 FKKEEGYAKWFAGNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDV 163

Query: 59  LKR----EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS-FLRGGLDLNISPQLYSCLV 113
            K+    +GI G ++G +P  +  ++Y G  FG Y  +    L G L+ +    L S L+
Sbjct: 164 YKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSF---LASFLL 220

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSM 170
           G      +S ASYP D +R R    S GQ +K     D    I + EG+   F GCG+++
Sbjct: 221 GWAVTTGASTASYPLDTVRRRMMMTS-GQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANI 279

Query: 171 INIGLNTAIMFGVYESIKI 189
           +  G+  A +  +Y+ +++
Sbjct: 280 LR-GVAGAGVISMYDQLQM 297

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 15/90 (16%)

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISM- 268
           L G +S   SK A  P++ V+  IQ     N++   ++ + D       RR+ G+G    
Sbjct: 15  LMGGVSAAVSKTAAAPIERVKLLIQ-----NQDEMIKQGSLD-------RRYTGIGECFK 62

Query: 269 --VQQEGPLSLYRGVTMSLIKSVPSTAISL 296
                EG  S +RG T ++I+  P+ A++ 
Sbjct: 63  RTAANEGIASFWRGNTANVIRYFPTQALNF 92

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 10/194 (5%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-- 61
           ++    D +++++  LV+   SGL       P+  +K ++  T  ++    ++N + R  
Sbjct: 112 QNKFMNDRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIY 171

Query: 62  --EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIG-SFLRGGLDLNISPQLYSCLVG--SL 116
             EG++ FW+G VP S+  +  G   F  Y  +   +L    D+          +G  SL
Sbjct: 172 TEEGLKTFWRGLVP-SLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISL 230

Query: 117 AGMTSSLASYPFDVLRTRFAA--NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
           + M S  + YP  +L+T          +  K+   I +IW   G+ GF+ G  ++++   
Sbjct: 231 SKMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAI 290

Query: 175 LNTAIMFGVYESIK 188
            +T I FGVYE  K
Sbjct: 291 PSTCITFGVYEHFK 304

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 133/311 (42%), Gaps = 50/311 (16%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-------------EGIR 65
           +++G  +G        PLD +K++LQ+   +   +   N ++R             E  R
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSF-----LRGGL--DLNISPQLYSCLVGSLAG 118
           G     +  ++ + +Y G    S   + S      L+     D  ++  +Y    G+ +G
Sbjct: 76  GLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGA-SG 134

Query: 119 MTSSLASYPFDVLRTRFAANSQGQ-LIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           + ++L + P  V++TR  +    Q    + + I  I++ EGL  F+ G   S+  +    
Sbjct: 135 LATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLFGVT-QG 193

Query: 178 AIMFGVYESIKI-FTEERSKLSDRRDPFTLLN--ELAGPIS--GFTSKLATFPLDTVRRR 232
           A+ F +Y+++K+ +  +R+ + +RR     LN  E  G IS     S  + +PL  ++  
Sbjct: 194 ALYFAIYDTLKLKYLHDRNDIQERR-----LNAVETIGIISLSKMISVSSVYPLQLLKTN 248

Query: 233 IQ-IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
           +Q  R   NE        + I+ +                 G    Y+G+  +L++++PS
Sbjct: 249 LQTFRTEHNENSKMNSLIRSIWHT----------------NGIAGFYKGLFANLVRAIPS 292

Query: 292 TAISLWSYELF 302
           T I+   YE F
Sbjct: 293 TCITFGVYEHF 303

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 111/263 (42%), Gaps = 17/263 (6%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILKREGIRG 66
           E  S     V+G  SG+       P DT+K++LQ +  +       + +     ++GIRG
Sbjct: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAGMTSSLA 124
           F+ G  P  + +I+      G        L+  +  N     L  C++ G +AG + S  
Sbjct: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175

Query: 125 SYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           + P ++ + +       +  K     D I  ++S  G+ G + G  S++I    N    +
Sbjct: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI-FRTNFVFWW 234

Query: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG-FTSKLATFPLDTVRRRIQIRNSPN 240
           G YE +  + +E + +SD     T +N  +G  S  F      +P D +++ +   +  +
Sbjct: 235 GSYELLTRWFKEHTNMSD-----TAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYD 289

Query: 241 EE-RHDREFTKDIYKSYKNRRFL 262
              R  +   KDI+++   R F 
Sbjct: 290 GTFRSWKLAAKDIWRTRGYRGFF 312

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 76/172 (44%), Gaps = 12/172 (6%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLI 56
           KK     +E++  +  +++G ++G       AP++  K KLQV      T +    +V+ 
Sbjct: 146 KKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIK 205

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL-NISPQLYSCLVGS 115
            +    G+RG +KG +  ++++       +GSY  +  + +   ++ + +   +S    +
Sbjct: 206 KVYSSNGVRGLYKG-LTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSA 264

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSG 165
             G  ++  +YP DV++     N +  G     +     IW   G  GFF G
Sbjct: 265 SFGFWTT--AYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKG 314

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 47/213 (22%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV-------LINILKRE----- 62
           T N L  G+++ +FA T IAPL+ VK KLQ  P +  +         L+N  ++E     
Sbjct: 158 TLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVG 217

Query: 63  GIRGFWKG-------NVPGSIMYIIYGGAQFGSYT------YIGSFLRGGLDLNISPQLY 109
             R  +KG       +VP S +Y       + SY       ++ S      D N    + 
Sbjct: 218 PSRALFKGLEITLWRDVPFSAIY-------WSSYELCKERLWLDSTRFASKDANWVHFIN 270

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRF-----------AANSQGQLIKLRDEIMAIWSHEG 158
           S   G ++GM +++ ++PFDV +TR+             N    + K  +    IW  EG
Sbjct: 271 SFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLE---TIWRTEG 327

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYE-SIKIF 190
           L   ++G  + +I I  + AIM   YE S K+F
Sbjct: 328 LAALYTGLAARVIKIRPSCAIMISSYEISKKVF 360

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 114/274 (41%), Gaps = 32/274 (11%)

Query: 48  HNKNANVLIN--------ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGG 99
           H KN+++  N        I   EGI   W+G     +M I      F  Y YI       
Sbjct: 94  HCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDV---S 150

Query: 100 LDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRF-----AANSQGQLIKLRDEIMAIW 154
              +  P L     G++A + ++ +  P ++++T+      ++ S    + ++D +    
Sbjct: 151 PIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETR 210

Query: 155 SHEGLMG----FFSGCGSSMINIGLNTAIMFGVYESIK--IFTEERSKLSDRRDPFTLLN 208
               ++G     F G   ++      +AI +  YE  K  ++ +     S   +    +N
Sbjct: 211 QEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFIN 270

Query: 209 ELA-GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGIS 267
             A G ISG  + + T P D  + R QI    N +      +++++K      FL    +
Sbjct: 271 SFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFK------FLE---T 321

Query: 268 MVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           + + EG  +LY G+   +IK  PS AI + SYE+
Sbjct: 322 IWRTEGLAALYTGLAARVIKIRPSCAIMISSYEI 355

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 131/300 (43%), Gaps = 30/300 (10%)

Query: 14  STTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWK 69
            + ++   GS++G    T + P+D VK ++Q       +  + + ++ I + +GIRG + 
Sbjct: 503 DSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYS 562

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQL---YSCLVGSLAGMTSSLASY 126
           G  P     +I    +      +  F+R    +N S  +      L G+ AG    + + 
Sbjct: 563 GLGPQ----LIGVAPEKAIKLTVNDFMRQYF-MNKSRTIKWYQEILSGATAGACQVVFTN 617

Query: 127 PFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           P ++++ R    S   G+  + +   + I    GL G + G  + ++     +AI F  Y
Sbjct: 618 PLEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTY 677

Query: 185 ESIK--IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
             +K  +F  + +  + R    T    LAG I+G  +   T P D ++ R+QI    +  
Sbjct: 678 AHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQI----DPR 733

Query: 243 RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           + +  +T  I+             +++++E   S ++G    +++S P    +L ++E+F
Sbjct: 734 KGETTYTGVIH----------AARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMF 783

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 89/197 (45%), Gaps = 21/197 (10%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG-QLIKLRDEIMAIWSHEGLMGF 162
           I   +++  +GS+AG   +   YP D+++TR  A     Q     D ++ I+  +G+ G 
Sbjct: 501 IFDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGL 560

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLA 222
           +SG G  +I +    AI   V + ++ +   +S+             L+G  +G    + 
Sbjct: 561 YSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEI-----LSGATAGACQVVF 615

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVT 282
           T PL+ V+ R+Q+R+               Y     R  LG  + +++Q G   LY+G  
Sbjct: 616 TNPLEIVKIRLQMRSD--------------YVGENARPQLG-AVGIIRQLGLRGLYKGAA 660

Query: 283 MSLIKSVPSTAISLWSY 299
             L++ VP +AI   +Y
Sbjct: 661 ACLLRDVPFSAIYFPTY 677

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 74/172 (43%), Gaps = 13/172 (7%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV-----LINILKR 61
           + K   +     +++G+ +G        PL+ VKI+LQ+       N       + I+++
Sbjct: 590 MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQ 649

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYS---CLVGSL 116
            G+RG +KG     +  + +    F +Y ++    F     D N   +L +    L G +
Sbjct: 650 LGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGI 709

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA---IWSHEGLMGFFSG 165
           AGM ++  + PFDV++TR   + +         I A   I   E +  FF G
Sbjct: 710 AGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 36/245 (14%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-EGIRGFWKGNVPGSIM 77
           LV+G   GL +   + PLD +K +LQ       A+ L ++L+     R  W+G +P ++ 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQ----QAQASSLRSVLREVRTTRELWRGTLPSALR 67

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDL----NISPQLYS---CLVGSLAGMTSSLASYPFDV 130
             I          Y  S L  G +     ++ P+L S    L G+L+     L + P  V
Sbjct: 68  TSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITV 127

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
           ++ R+ +        L +    IW  EG  GFF G  ++     L  A   G+Y    + 
Sbjct: 128 IKVRYESTLYAY-NGLAEATRHIWRSEGARGFFKGAAATT----LRDAPYAGLY---VLL 179

Query: 191 TEERSKLSDRRDPFTLL-----NELAGPISGFTSKLATF-----------PLDTVRRRIQ 234
            E+  ++  R  P TLL      +L  P S   + ++ F           P DT++ R+Q
Sbjct: 180 YEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQ 239

Query: 235 IRNSP 239
           +++ P
Sbjct: 240 LQSHP 244

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 128/328 (39%), Gaps = 49/328 (14%)

Query: 5   DHLRKDEEVSTTNS------------LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA 52
           D L   ++V+T N             + AG++ G+       P DT K++LQ        
Sbjct: 12  DELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT 71

Query: 53  -NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG----------GLD 101
             VL N++K EG+  F+KG +   +   I    QFG    +  F +             D
Sbjct: 72  LEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQD 131

Query: 102 LNIS-------PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN-SQGQLIKLRDEIMAI 153
           +++S        Q Y C  G   G+ +S  + P + +R R     S G   + +     I
Sbjct: 132 VDLSRSNTLPLSQYYVC--GLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI 189

Query: 154 WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGP 213
              +   G   G   +MI  G      F VYE++           +   P+ L   L G 
Sbjct: 190 KKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC--LFGA 247

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEG 273
            SG    L  +PLD V+  IQ     N++    ++   I  SY       V  ++  +EG
Sbjct: 248 FSGTMLWLTVYPLDVVKSIIQ-----NDDLRKPKYKNSI--SY-------VAKTIYAKEG 293

Query: 274 PLSLYRGVTMSLIKSVPSTAISLWSYEL 301
             + ++G   ++++S P    +  ++EL
Sbjct: 294 IRAFFKGFGPTMVRSAPVNGATFLTFEL 321

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 85/207 (41%), Gaps = 28/207 (13%)

Query: 9   KDEEVSTTNSL------VAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLI 56
           +D ++S +N+L      V G   G+      +P++ ++I+LQ    N      K     I
Sbjct: 130 QDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCI 189

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-----GLDLNISPQLYSC 111
             LK +G  G  +G  P     +I  G   G+Y  +   L       GL  N  P    C
Sbjct: 190 KKLKAQG--GLMRGLFP----TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLC 243

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI----MAIWSHEGLMGFFSGCG 167
           L G+ +G    L  YP DV+++    N   +  K ++ I      I++ EG+  FF G G
Sbjct: 244 LFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFG 302

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEER 194
            +M+         F  +E +  F  E 
Sbjct: 303 PTMVRSAPVNGATFLTFELVMRFLGEE 329

>Scas_721.27
          Length = 374

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 133/315 (42%), Gaps = 60/315 (19%)

Query: 31  TCIAPLDTVKIKLQ---------------VTPHN-KNANVLI--------------NILK 60
           TC  P D VK +LQ                  HN K AN L+              N+ K
Sbjct: 70  TC--PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
           REG R  +KG  P  +  I      F +Y           +      L   +  + AG  
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWA 187

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           +S A+ P  +++TR   +  G   K +   D +  +   EG+ G + G  +S +   +  
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLG-SIEG 246

Query: 178 AIMFGVYESIKIFTEERS--------KLSDRR-DPFTLLNELAGP--ISGFTSKLATFPL 226
            + + +YE +K   ++RS        +L+  R +      + +G   ++ F + + T+P 
Sbjct: 247 ILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPH 306

Query: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLI 286
           + VR R+  R  P E    + +T  + +S++          ++++EG  S+Y G+T  L+
Sbjct: 307 EVVRTRL--RQMPMENGKPK-YT-GLVQSFR---------VIIKEEGLASMYSGLTPHLM 353

Query: 287 KSVPSTAISLWSYEL 301
           ++VP++ I   ++EL
Sbjct: 354 RTVPNSIIMFGTWEL 368

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 85/191 (44%), Gaps = 25/191 (13%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV-----TPHNKNA-NVLINILKREGIRGFWKGNV 72
           L++ + +G    T   P+  +K ++Q+     T   KN+ + L  +LK EGI G ++G +
Sbjct: 178 LMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRG-L 236

Query: 73  PGSIMYIIYGGAQFGSYTYIGSFLR----------GGLDLNISPQLYS-CLVGSLAGMT- 120
             S +  I G  Q+  Y  +   ++          G L  + + ++   C     AG+  
Sbjct: 237 SASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAK 296

Query: 121 --SSLASYPFDVLRTRF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
             +S+ +YP +V+RTR       N + +   L      I   EGL   +SG    ++   
Sbjct: 297 FIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTV 356

Query: 175 LNTAIMFGVYE 185
            N+ IMFG +E
Sbjct: 357 PNSIIMFGTWE 367

>Kwal_27.12081
          Length = 369

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 130/309 (42%), Gaps = 55/309 (17%)

Query: 31  TCIAPLDTVKIKLQVT---------PHNKNANV--------------LINILKREGIRGF 67
           TC  P D VK +LQ            HNK++NV              + N+ K EG R  
Sbjct: 70  TC--PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 68  WKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYP 127
           +KG  P  +  I      F +Y           +          +  + AG  +S A+ P
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNP 187

Query: 128 FDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
             +++TR   +  G   + +   D +  I   EG  G + G  +S +   +   + + +Y
Sbjct: 188 IWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-SVEGILQWLLY 246

Query: 185 ESIKIFTEERS------------KLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRR 232
           E +K   + RS              S++   +   +  AG ++ F + + T+P + VR R
Sbjct: 247 EQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAG-LAKFLASIVTYPHEVVRTR 305

Query: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292
           +  R +P E  +D+     + +S++          ++++EG  S+Y G+T  L+++VP++
Sbjct: 306 L--RQAPLE--NDKLKYTGLIQSFR---------VIIKEEGLASMYGGLTPHLLRTVPNS 352

Query: 293 AISLWSYEL 301
            I   ++EL
Sbjct: 353 IIMFGTWEL 361

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 23/190 (12%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV-----TPHNKNA-NVLINILKREGIRGFWKG-- 70
           L++ + +G    T   P+  +K +LQ+     T   KN+ + L +I+++EG  G +KG  
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLS 230

Query: 71  -----NVPGSIMYIIYGGAQ----FGSYTYIGSFLRGGLDLNISPQLYSCLVGS--LAGM 119
                +V G + +++Y   +      S    G    G  + +   + +    GS  LA  
Sbjct: 231 ASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKF 290

Query: 120 TSSLASYPFDVLRTRFAA----NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            +S+ +YP +V+RTR       N + +   L      I   EGL   + G    ++    
Sbjct: 291 LASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVP 350

Query: 176 NTAIMFGVYE 185
           N+ IMFG +E
Sbjct: 351 NSIIMFGTWE 360

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 119/262 (45%), Gaps = 29/262 (11%)

Query: 54  VLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV 113
           ++ N+ ++EG R  +KG  P  +  I      F +Y          L+          L 
Sbjct: 116 IIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLA 175

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR--DEIMAIWSHEGLMGFFSGCGSSMI 171
            + AG  +S  + P  +++TR   +  G        D I ++  +EG++G + G  +S +
Sbjct: 176 AATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL 235

Query: 172 NIGLNTAIMFGVYESIKIFTEERS------------KLSDRRDPFTLLNELAGPISGFTS 219
              +   + + +YE +K   +ERS              SD+   +   +  AG ++ F +
Sbjct: 236 G-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAG-LAKFVA 293

Query: 220 KLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYR 279
            + T+P + VR R+  R +P E  + +     + +S++          ++++EG +S+Y 
Sbjct: 294 SIVTYPHEVVRTRL--RQAPTE--NGKLKYTGLVQSFR---------VIIKEEGLVSMYS 340

Query: 280 GVTMSLIKSVPSTAISLWSYEL 301
           G+T  L+++VP++ I   ++EL
Sbjct: 341 GLTPHLLRTVPNSIIMFGTWEL 362

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 84/190 (44%), Gaps = 24/190 (12%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNA-NVLINILKREGIRGFWKG--- 70
           L+A + +G    T   P+  VK +LQ+    T   KN+ + + +++K EG+ G +KG   
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 71  ----NVPGSIMYIIYGGAQ-------FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGM 119
               +V G + +I+Y   +          + +I    +   D  +           LA  
Sbjct: 233 SYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSD-KVKEWCQRSGSAGLAKF 291

Query: 120 TSSLASYPFDVLRTRF--AANSQGQL--IKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            +S+ +YP +V+RTR   A    G+L    L      I   EGL+  +SG    ++    
Sbjct: 292 VASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVP 351

Query: 176 NTAIMFGVYE 185
           N+ IMFG +E
Sbjct: 352 NSIIMFGTWE 361

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 44/188 (23%)

Query: 127 PFDVLRTRF------------AANSQG---------QLIKLRDE---IMAIWSHEGLMGF 162
           PFDV++TR             A  + G          L+  ++    I  ++  EG    
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
           F G G +++ +    +I F  Y + K I++  R+  + +  P+  L  LA   +G+ +  
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYS--RTLNNGQEAPWIHL--LAAATAGWATST 185

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            T P+  V+ R+Q+         D+  T    K+YKN   L    S+V+ EG L LY+G+
Sbjct: 186 VTNPIWLVKTRLQL---------DKAGT----KTYKNS--LDCIKSVVKNEGVLGLYKGL 230

Query: 282 TMSLIKSV 289
           + S + SV
Sbjct: 231 SASYLGSV 238

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 93/197 (47%), Gaps = 26/197 (13%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA------NVLINILKREG 63
           D ++++   L AG+ SGL       P+  +K ++  T            N +  +L+ +G
Sbjct: 120 DHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDG 179

Query: 64  IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR---------GGLDLNISPQLYSCLVG 114
            +G WKG VP      ++G +Q   Y  +   L+          GLD++++  L +  + 
Sbjct: 180 FQGLWKGLVPA-----LFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLT-NLETIEIT 233

Query: 115 SLAGMTSSLASYPFDVLRTR---FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           SL  M S    YPF +L++    F AN Q    +L   I  I +++G +G + G  ++++
Sbjct: 234 SLGKMVSVTLVYPFQLLKSNLQSFRANEQK--FRLFPLIKLIIANDGFVGLYKGLSANLV 291

Query: 172 NIGLNTAIMFGVYESIK 188
               +T I F VYE++K
Sbjct: 292 RAIPSTCITFCVYENLK 308

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 132/325 (40%), Gaps = 51/325 (15%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT------PHNKNANVLINI 58
           DH     +    + L AGS++ L     + PLD +K++LQ++       H     V+  I
Sbjct: 3   DHQWTPLQKEVISGLSAGSVTTL----VVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEI 58

Query: 59  LKREGIRG------FWKGNVPGSIMYIIYGGAQFGSYTYIGSF------------LRG-G 99
           ++     G       ++G         I  G  FG Y                  L+G G
Sbjct: 59  IRSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVG 118

Query: 100 LDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANS---QGQLIKLRDEIMAIWSH 156
            D  ++  +Y    G+ +G+ +++ + P  V++TR  + S   QG    + + +  +   
Sbjct: 119 NDHKMNSLIYLS-AGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRT 177

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPIS 215
           +G  G + G   ++  +    A+ F VY+++K     R + +      T L  +    + 
Sbjct: 178 DGFQGLWKGLVPALFGVS-QGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLG 236

Query: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275
              S    +P   ++  +Q   + NE++                R   +   ++  +G +
Sbjct: 237 KMVSVTLVYPFQLLKSNLQSFRA-NEQKF---------------RLFPLIKLIIANDGFV 280

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYE 300
            LY+G++ +L++++PST I+   YE
Sbjct: 281 GLYKGLSANLVRAIPSTCITFCVYE 305

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 92/203 (45%), Gaps = 16/203 (7%)

Query: 4   KDHLRKDE--EVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKL-----QVTP--HNKNAN 53
           KD LR  E  E+S T  ++AG  +GL  +   + P + +K  L       TP  HN    
Sbjct: 95  KDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRG 154

Query: 54  VLIN---ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS 110
           V+ N   +++ +G  G ++G +P S+        + G Y  I + ++   D      L S
Sbjct: 155 VVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSS 214

Query: 111 CL---VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
            L   VG+ +G+ +  ++ P D ++TR  +    +     +    I+  EGL  F+ G  
Sbjct: 215 GLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGAT 274

Query: 168 SSMINIGLNTAIMFGVYESIKIF 190
             +  + L+  I+F +YE + + 
Sbjct: 275 PRLGRLVLSGGIVFTIYEKVLVM 297

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 123/303 (40%), Gaps = 33/303 (10%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIA-PLDTVKIKLQV----TPHNKNANVLI-NILKREGIR 65
           +V   +S +AGSL+G  A  CI  P +  K +LQ+    +  ++N  VLI    K +GI 
Sbjct: 9   DVDPLHSFLAGSLAGA-AEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIG 67

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125
             + G     I      G +F  +  I   LR      +S      + G  AG+  S+A+
Sbjct: 68  SIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGT-RGVIAGLGAGLLESVAA 126

Query: 126 Y-PFDVLRTRFAANSQGQLIKLRDE-------IMAIWSHEGLMGFFSGCGSSMINIGLNT 177
             PF+ ++T    + Q    K  +          ++   +G  G + G     +    N 
Sbjct: 127 VTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQ 186

Query: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237
           A+  G Y  IK   ++ +     +   + L  L G  SG  +  +T PLDTV+ R+Q  +
Sbjct: 187 AVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLD 246

Query: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
           S              Y S  N        ++ ++EG  + ++G T  L + V S  I   
Sbjct: 247 STK------------YSSTMN-----CFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFT 289

Query: 298 SYE 300
            YE
Sbjct: 290 IYE 292

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 124/301 (41%), Gaps = 55/301 (18%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHN---KNANVLINILKREGI-RGFWKGNVPG 74
           L+ G ++G   +    P DTVK++LQ           + + +  K+EG+ RGF++G    
Sbjct: 12  LLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASP 71

Query: 75  SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC-------LVGSLAGMTSSLASYP 127
                +     F S+    + L            YSC         G++AG  +S    P
Sbjct: 72  VFGAFLEHAVLFVSFNRAQAVLE---------NCYSCGPLEKVVFAGAIAGACTSYVLTP 122

Query: 128 FDVLRTRFAAN-----SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
            ++++ +   +     S  +   +   + AI    GL G + G   + I      A+ F 
Sbjct: 123 VELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFT 182

Query: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
            YE +K +   R + S     + LL   AG  + F + +  FP DTV+  +Q  +     
Sbjct: 183 AYEVLKGWLARR-RGSTENTVWELLASGAGAGAAFHASI--FPADTVKSTMQTEH----- 234

Query: 243 RHDREFTKDIYKSYKNRRFLGVGISM---VQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
                              LG+G ++   +++ GP   YRGV ++L++++P+ A+  + Y
Sbjct: 235 -------------------LGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

Query: 300 E 300
           E
Sbjct: 276 E 276

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 79/177 (44%), Gaps = 16/177 (9%)

Query: 21  AGSLSGLFARTCIAPLDTVKIKLQVTP--------HNKNANVLINILKREGIRGFWKGNV 72
           AG+++G      + P++ VK KLQV+         +      L  I+K+ G+ G W+G  
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQS 167

Query: 73  PGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
              I     G   F +Y  +  +L  R G   N   +L +   G+ A   +S+  +P D 
Sbjct: 168 GTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASI--FPADT 225

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
           +++      Q + + L   +  +    G  GF+ G G +++      A++F VYES+
Sbjct: 226 VKSTM----QTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESL 278

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 122/304 (40%), Gaps = 23/304 (7%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKRE 62
           ++H + D        L+AG+  G+       P DT K++LQ +     A  V+  +L  E
Sbjct: 15  EEHPQHDN-ARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE 73

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-GLDLNIS---PQLYSCLVGSLAG 118
           G RGF+KG +   I        QFG    +  F      D++ +   PQ Y+C  G   G
Sbjct: 74  GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGG 131

Query: 119 MTSSLASYPFDVLRTRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           + +S  + P + +R R    +  G   + +  +  I           G   +++  G   
Sbjct: 132 IVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGC 191

Query: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237
              F VYE++      + +  +R+D       + G +SG    L  +PLD ++  +Q   
Sbjct: 192 GTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ--- 248

Query: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
                      T ++ K         V  ++    G  + ++G   +++++ P+   +  
Sbjct: 249 -----------TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297

Query: 298 SYEL 301
           ++EL
Sbjct: 298 TFEL 301

>Scas_714.18
          Length = 305

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 125/316 (39%), Gaps = 66/316 (20%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTP---HNKNANVLINILKREGI-RGFWKGNVPG 74
           ++AGS++G   +    P DTVK++LQ           + +    + EGI  GF++G    
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGIESP 75

Query: 75  SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTR 134
            I   +     F +Y    SFL    +   S  L   +    AG  +S    P ++++ +
Sbjct: 76  LIGAALENAILFLAYNQCSSFLNAFTEF--SAFLIILISAGFAGSCASFVLTPVELIKCK 133

Query: 135 FAANS-------------------------QGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
              ++                         +G+  ++   I +I   +GL G + G  S+
Sbjct: 134 LQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSST 193

Query: 170 MINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-----LAGPISGFTSKLATF 224
            I   + + + F  YE +K            RDP + +N      ++G  +G     + F
Sbjct: 194 FIRESIGSVVWFATYELMK---------QTLRDPKSEVNTTWQLLISGATAGLAFNGSVF 244

Query: 225 PLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMS 284
           P DTV+  +Q  +    E                        S+++++G    YRG+ ++
Sbjct: 245 PADTVKSIMQTEHLALMETVR---------------------SILERDGVAGFYRGLGIT 283

Query: 285 LIKSVPSTAISLWSYE 300
           L+++VPS A   ++YE
Sbjct: 284 LLRAVPSNAAVFYTYE 299

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 86/204 (42%), Gaps = 16/204 (7%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLM-GFFSGC 166
           L   L GS+AG       YPFD ++ R               I   + +EG++ GF+ G 
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPL 226
            S +I   L  AI+F  Y     F    ++ S     F ++   AG  +G  +     P+
Sbjct: 73  ESPLIGAALENAILFLAYNQCSSFLNAFTEFS----AFLIILISAG-FAGSCASFVLTPV 127

Query: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG---------ISMVQQEGPLSL 277
           + ++ ++QI N  +   HD +  +   +       +G G          S+++++G   L
Sbjct: 128 ELIKCKLQISN-LHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGL 186

Query: 278 YRGVTMSLIKSVPSTAISLWSYEL 301
           ++G + + I+    + +   +YEL
Sbjct: 187 WQGQSSTFIRESIGSVVWFATYEL 210

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 85/198 (42%), Gaps = 35/198 (17%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTP----------------------------HNK 50
           L++   +G  A   + P++ +K KLQ++                             H +
Sbjct: 110 LISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTR 169

Query: 51  NANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-GLDLNISPQLY 109
               + +I+K +G+ G W+G     I   I     F +Y  +   LR    ++N + QL 
Sbjct: 170 IIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQL- 228

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
             + G+ AG+  + + +P D +++      Q + + L + + +I   +G+ GF+ G G +
Sbjct: 229 -LISGATAGLAFNGSVFPADTVKSIM----QTEHLALMETVRSILERDGVAGFYRGLGIT 283

Query: 170 MINIGLNTAIMFGVYESI 187
           ++    + A +F  YE +
Sbjct: 284 LLRAVPSNAAVFYTYEKL 301

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 4   KDHLR--KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR 61
           K  LR  K E  +T   L++G+ +GL     + P DTVK  +Q T H      + +IL+R
Sbjct: 212 KQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPADTVKSIMQ-TEHLALMETVRSILER 270

Query: 62  EGIRGFWKG 70
           +G+ GF++G
Sbjct: 271 DGVAGFYRG 279

>Kwal_27.11419
          Length = 298

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 126/304 (41%), Gaps = 45/304 (14%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMY 78
            + G + GL +   + P D +K +LQ    NK++N+L  +   E     WKG +P ++  
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQ---QNKSSNLLDVVRSIETPGQLWKGTLPSALRT 67

Query: 79  IIYGGAQFGSYTYI------GSFLRGGLDLNIS----PQL--YSCLV-GSLAGMTSSLAS 125
            + G A F S   I         ++G    N S    PQL  Y  L+ G++      +A+
Sbjct: 68  SV-GSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT 126

Query: 126 YPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
            P  VL+ RF + +      L +    I+  EG+ G FSGCG++++       +    YE
Sbjct: 127 MPITVLKVRFES-TMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYE 185

Query: 186 SIKI---------FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIR 236
             K+           E            T++N +A   S   +   T P DT++ R+Q+ 
Sbjct: 186 QSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQLN 245

Query: 237 NSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
            S                  +   F+    S+++ E P +L+ G+++ L +   S  I+ 
Sbjct: 246 PS------------------QYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAW 287

Query: 297 WSYE 300
             YE
Sbjct: 288 GIYE 291

>Scas_489.4
          Length = 297

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 126/307 (41%), Gaps = 33/307 (10%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI-NILKRE 62
           ++ + V   +S +AG+L+G    +   P +  K +LQ+    +  ++N  VLI N  K +
Sbjct: 3   QEKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQ 62

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-PQLYSCLVGSLAGMTS 121
           G    + G     +      G +F  +  I + LR  +   +S P+    + G  AG+  
Sbjct: 63  GTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPR--GVVAGLGAGLLE 120

Query: 122 SL-ASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSH-------EGLMGFFSGCGSSMINI 173
           S+ A  PF+ ++T    + Q    K ++    +  +       +G+MG + G     +  
Sbjct: 121 SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQ 180

Query: 174 GLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI 233
             N A+  G Y  IK   ++ +     R   + L  + G  SG  +   T P+DTV+ R+
Sbjct: 181 AANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRM 240

Query: 234 QIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           Q  ++         F K                 + ++EG  + ++G T  L + + S  
Sbjct: 241 QSLDATKYTSTVNCFAK-----------------IFKEEGLKTFWKGATPRLGRLILSGG 283

Query: 294 ISLWSYE 300
           I    YE
Sbjct: 284 IVFTIYE 290

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTPHNKNANVLINILKREGIR 65
           KD  +S+  + + G+ SG+       P+DTVK ++Q    T +    N    I K EG++
Sbjct: 206 KDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLK 265

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL 96
            FWKG  P     I+ GG  F  Y  +  FL
Sbjct: 266 TFWKGATPRLGRLILSGGIVFTIYENVLVFL 296

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 16/194 (8%)

Query: 12  EVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKL-----QVTP--HNKNANVLIN---ILK 60
           E+S    +VAG  +GL  +   + P + +K  L      + P   N    +L N   +++
Sbjct: 103 ELSGPRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVR 162

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSY----TYIGSFLRGGLDLNISPQLYSCLVGSL 116
            +GI G ++G +P S+        + G Y    T +  +     D  +S  L + +VG+ 
Sbjct: 163 DQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGL-TFIVGAF 221

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLN 176
           +G+ +   + P D ++TR  +    +     +    I+  EGL  F+ G    +  + L+
Sbjct: 222 SGVVTVYTTMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILS 281

Query: 177 TAIMFGVYESIKIF 190
             I+F +YE++ +F
Sbjct: 282 GGIVFTIYENVLVF 295

>Kwal_26.8669
          Length = 296

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 123/292 (42%), Gaps = 38/292 (13%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVT------PHNKNA-NVLINILKREGIRGFWKGN 71
             AG+++G+     + PLD VK ++Q+       P  K   + +  I+ +EG    +KG 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVL 131
               +M       +F          +    +    Q  S L G+ AG   +    PF+++
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132

Query: 132 RTRF---AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           + R    +++ +G +    D +  I + EG++  ++G  S++   G+  A  FG+   ++
Sbjct: 133 KIRLQDVSSSYKGPI----DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188

Query: 189 -IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDRE 247
            +  E +SK    R+     + +AG I G    L + P D V+ RIQ  N+       R+
Sbjct: 189 ALLPEAKSKSQQTRN-----DLIAGSIGGTIGSLMSTPFDVVKSRIQ--NTAVVAGGARK 241

Query: 248 FT---KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
           +      I+  YK             +EG  +LY+G    +++  P   I L
Sbjct: 242 YNWSWPSIFTIYK-------------EEGFRALYKGFVPKVLRLGPGGGILL 280

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 77/192 (40%), Gaps = 31/192 (16%)

Query: 101 DLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG----QLIKLRDEIMAIWSH 156
           D    P  Y    G++AG++  L  YP DV++TR      G    Q   + D I  I + 
Sbjct: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK 62

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESI-KIFTEE--RSKLSDRRDPFTLLNELAGP 213
           EG    + G  S ++      A  F   +   KI+  E    KL+        L+ L+G 
Sbjct: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS------LSILSGA 116

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEG 273
            +G        P + V+ R+Q                D+  SYK    + V   ++ QEG
Sbjct: 117 SAGCCEAFVVVPFELVKIRLQ----------------DVSSSYKGP--IDVVRKIIAQEG 158

Query: 274 PLSLYRGVTMSL 285
            L++Y G+  +L
Sbjct: 159 VLAMYNGLESTL 170

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 10/182 (5%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFW 68
           E+++ + S+++G+ +G      + P + VKI+LQ   + +    +V+  I+ +EG+   +
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMY 163

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLASYP 127
            G       + ++    FG    + + L      + S Q  + L+ GS+ G   SL S P
Sbjct: 164 NGLESTLWRHGVWNAGYFGIIFQVRALLPEAK--SKSQQTRNDLIAGSIGGTIGSLMSTP 221

Query: 128 FDVLRTRF--AANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
           FDV+++R    A   G   K       I  I+  EG    + G    ++ +G    I+  
Sbjct: 222 FDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLV 281

Query: 183 VY 184
           V+
Sbjct: 282 VF 283

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 16/92 (17%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP--------HNKNANVLINILK 60
           K +   T N L+AGS+ G        P D VK ++Q T         +N +   +  I K
Sbjct: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYK 254

Query: 61  REGIRGFWKGNVP--------GSIMYIIYGGA 84
            EG R  +KG VP        G I+ +++ G 
Sbjct: 255 EEGFRALYKGFVPKVLRLGPGGGILLVVFTGC 286

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 129/315 (40%), Gaps = 64/315 (20%)

Query: 31  TCIAPLDTVKIKLQ--------------VTPHNKNA------------NVLINILKREGI 64
           TC  P D VK +LQ              + P+  N              ++ N+ + EG 
Sbjct: 70  TC--PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
           R  +KG  P  +  I      F +Y          L+          +  + AG  +S A
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTA 187

Query: 125 SYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           + P  +++TR   +  G   K +   D +  +   EG++G + G  +S +   +   + +
Sbjct: 188 TNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLG-SVEGILQW 246

Query: 182 GVYESIKIFTEERS------------KLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
            +YE +K   ++RS              SD+   +   +  AG ++ F + + T+P + V
Sbjct: 247 VLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAG-LAKFVASIITYPHEVV 305

Query: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISM---VQQEGPLSLYRGVTMSLI 286
           R R+  R +P E                  ++ G+  S+   +++EG  S+Y G+T  L+
Sbjct: 306 RTRL--RQAPLEN--------------GKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLL 349

Query: 287 KSVPSTAISLWSYEL 301
           ++VP++ I   ++EL
Sbjct: 350 RTVPNSIIMFGTWEL 364

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 82/191 (42%), Gaps = 25/191 (13%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV-----TPHNKNA-NVLINILKREGIRGFWKG-- 70
           L+A + +G    T   P+  VK +LQ+     T   KN+ + L N++++EGI G +KG  
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLS 233

Query: 71  -----NVPGSIMYIIYGGAQ-------FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG 118
                +V G + +++Y   +          +  I    +   D  I           LA 
Sbjct: 234 ASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSD-KIKEWCQRSGSAGLAK 292

Query: 119 MTSSLASYPFDVLRTRFAA----NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
             +S+ +YP +V+RTR       N + +   L   I  I   EGL   + G    ++   
Sbjct: 293 FVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTV 352

Query: 175 LNTAIMFGVYE 185
            N+ IMFG +E
Sbjct: 353 PNSIIMFGTWE 363

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 119/297 (40%), Gaps = 38/297 (12%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77
           L+AG+  G+       P DT K++LQ +     A +V+  ++K EG RGF+KG +   + 
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86

Query: 78  YIIYGGAQFGSYTYIGSFL--RGGLDLNISP-------QLYSCLVGSLAGMTSSLASYPF 128
                  QFG    +  F   R G   N  P       Q Y C  G   G  +S  + P 
Sbjct: 87  VGACVSVQFGVNEAMKRFFHSRNG---NSGPNETLGLLQYYLC--GFAGGTANSFLASPI 141

Query: 129 DVLRTRF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           + +R R        +  Q     D I  + ++  LM    G   +M+       + F  Y
Sbjct: 142 EHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHGCGVYFLTY 198

Query: 185 ESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH 244
           E+  +   E  K   R +  T    L G  SG T  L  +PLD ++  +Q          
Sbjct: 199 EA--LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ---------- 246

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
               T  + +  + +  L V  ++    G  S ++G   +++++ P+   +  ++EL
Sbjct: 247 ----TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 81/198 (40%), Gaps = 9/198 (4%)

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           L G+  G++  L   PFD  + R   +S        D +  +  +EG  GF+ G  + ++
Sbjct: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVP--TTALDVVKKLVKNEGFRGFYKGTLTPLV 85

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPLDTVR 230
            +G   ++ FGV E++K F   R+  S   +   LL   L G   G  +     P++ VR
Sbjct: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFL-GVGISMVQQEGPLSLYRGVTMSLI--- 286
            R+Q +               I K   N   + G+  +M+++     +Y     +LI   
Sbjct: 146 IRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANE 205

Query: 287 --KSVPSTAISLWSYELF 302
             K V  + I  W   LF
Sbjct: 206 LHKGVSRSEIPTWKLCLF 223

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 119/292 (40%), Gaps = 39/292 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR----EGIRGFWKG 70
           G +S   A+T  +P++ VK+ +Q           +     +++  +R    EGI  FW+G
Sbjct: 18  GGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRG 77

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLASYPFD 129
           N    I Y       F     I +      +   +      L  G +AG  S +  Y  D
Sbjct: 78  NTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLD 137

Query: 130 VLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
             RTR AA+++        Q   L D      + +G+ G + G   S+I I +   + FG
Sbjct: 138 YARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFG 197

Query: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
           +Y+S K        L+   +   + + L G +    +  A++PLDTVRRR+ + +     
Sbjct: 198 LYDSCKPLL-----LTGSLEGSFIASFLLGWVVTTGASTASYPLDTVRRRMMMTSG---- 248

Query: 243 RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
                      ++ K +  +     +V  EG  SL++G   ++++ V    +
Sbjct: 249 -----------QAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 92/188 (48%), Gaps = 19/188 (10%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN------KNANVLINILKR----EGIR 65
             +L +G ++G  +   +  LD  + +L     +      +  N L+++ K+    +G+ 
Sbjct: 116 AGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVA 175

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGS-FLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
           G ++G +P  I  ++Y G  FG Y       L G L+ +    + S L+G +    +S A
Sbjct: 176 GLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSF---IASFLLGWVVTTGASTA 232

Query: 125 SYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           SYP D +R R    S GQ +K +   D +  I + EG+   F GCG++++  G+  A + 
Sbjct: 233 SYPLDTVRRRMMMTS-GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR-GVAGAGVI 290

Query: 182 GVYESIKI 189
            +Y+ +++
Sbjct: 291 SLYDQLQM 298

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 197 LSDRRDPFT--LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYK 254
           +S+ + P +   ++ L G +S   +K A  P++ V+  IQ ++   ++       K I  
Sbjct: 1   MSETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVD 60

Query: 255 SYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
            ++            +QEG +S +RG T ++I+  P+ A++ 
Sbjct: 61  CFQR---------TARQEGIISFWRGNTANVIRYFPTQALNF 93

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 23/194 (11%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGI 64
           D+L  ++      S  AGSL G+     + PLD +KIK Q  P +      I IL+ EG+
Sbjct: 109 DNLFGEKTGKAMRSAAAGSLIGI-GEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGL 167

Query: 65  RGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117
              ++G       N PGS  + ++GG  F     +G  L+       S    S +VG+  
Sbjct: 168 FNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILG--LKDYSQATWSQNFISSIVGA-- 221

Query: 118 GMTSSLASYPFDVLRTRFA----ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
             +S + S P DV++TR       N +  L  +++ +     +EG+  FF G    ++  
Sbjct: 222 -CSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTL----KNEGVTAFFKGLTPKLLTT 276

Query: 174 GLNTAIMFGVYESI 187
           G      F + +S+
Sbjct: 277 GPKLVFSFALAQSL 290

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 73/189 (38%), Gaps = 24/189 (12%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           + S   GSL G+   +   P DVL+ +   N +    K R   + I   EGL   + G G
Sbjct: 120 MRSAAAGSLIGI-GEIVLLPLDVLKIKRQTNPES--FKGRG-FIKILRDEGLFNLYRGWG 175

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
            +      N    F ++       E    L D        N ++  +   +S + + PLD
Sbjct: 176 WTAAR---NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLD 232

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
            ++ RIQ RN  N E   R     I K            + ++ EG  + ++G+T  L+ 
Sbjct: 233 VIKTRIQNRNFDNPESGLR-----IVK------------NTLKNEGVTAFFKGLTPKLLT 275

Query: 288 SVPSTAISL 296
           + P    S 
Sbjct: 276 TGPKLVFSF 284

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 95/221 (42%), Gaps = 35/221 (15%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN---VLINILK 60
           +D+      +   N LV G+ + + A T IAPL+ ++ +LQ  P  ++      LI  L 
Sbjct: 125 RDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLL 184

Query: 61  RE--------GIRGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS 105
           RE        G R  +KG       +VP S +Y  +G  +F    +           N  
Sbjct: 185 REMRHEVSVMGYRALFKGLEITLWRDVPFSAIY--WGTYEFCKTQFWARHAATHNASNWD 242

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF----AANSQ----GQLIKLRDE------IM 151
             + S   GS+ G  ++L ++PFDV +TR     A+  Q    G+  K  D       + 
Sbjct: 243 HFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLN 302

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE-SIKIFT 191
           AI   EG+   ++G    ++ I  + AIM   YE S K FT
Sbjct: 303 AIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFT 343

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 110/266 (41%), Gaps = 34/266 (12%)

Query: 55  LINILKREGIRGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-P 106
           L  I + EG+   W+G        VP +++Y       F  Y      LR    L    P
Sbjct: 87  LRKIAQLEGLPTLWRGLGITLVMAVPANVVY-------FSGY----EALRDNSPLASRLP 135

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFA----ANSQGQLIKLRDEIMAIWSHE-GLMG 161
                + G+ A + ++    P ++LRTR      A    + I L  +++    HE  +MG
Sbjct: 136 VANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMG 195

Query: 162 F---FSGCGSSMINIGLNTAIMFGVYESIKI-FTEERSKLSDRRDPFTLLNELA-GPISG 216
           +   F G   ++      +AI +G YE  K  F    +   +  +    +   A G + G
Sbjct: 196 YRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGG 255

Query: 217 FTSKLATFPLDTVRRRIQIR-NSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275
             + L T P D  + R+QI   SP +     + TK    +  +R       ++ + EG  
Sbjct: 256 AVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATK----TDDSRGMFSFLNAIRKSEGIR 311

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYEL 301
           +LY G+   ++K  PS AI + +YEL
Sbjct: 312 ALYTGLLPRVMKIAPSCAIMISTYEL 337

>Scas_645.9
          Length = 391

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 101/220 (45%), Gaps = 46/220 (20%)

Query: 5   DHLRKDEEVSTT----NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK 60
           ++LR +  ++T+    N L+ G+++ + A + +APL+ +K KLQ  P    +     ++K
Sbjct: 171 EYLRDNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVK 230

Query: 61  ------REGIR------GFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFL---RG 98
                 R+ +R        +KG       +VP S +Y       +GSY +  + L     
Sbjct: 231 ELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIY-------WGSYEFCKTHLWMDTS 283

Query: 99  GLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTR----FAANSQGQLIKLRDE----- 149
               N++  + S + GS++G  ++L ++PFDV +TR    F  N+   ++K  D      
Sbjct: 284 KSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKN 343

Query: 150 ----IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
               +  IW  EG    ++G    M+ I  + AIM   YE
Sbjct: 344 MFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYE 383

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 114/277 (41%), Gaps = 40/277 (14%)

Query: 50  KNANVLIN--------ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLD 101
           KN++V  N        I K EGI   W+G     +M I      F  Y Y    LR    
Sbjct: 123 KNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEY----LRDNSP 178

Query: 102 LNIS-PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQ-----------GQLIKLRDE 149
           L  S P     + G++A + ++    P ++L+T+  +  +            +L+K   +
Sbjct: 179 LATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQ 238

Query: 150 IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE 209
            M I         F G   ++      +AI +G YE  K      +  S     F + + 
Sbjct: 239 EMRISGASN--ALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSF 296

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH-----DREFTKDIYKSYKNRRFLGV 264
           + G ISG  + L T P D  + R QI    N ++      D E TK+++K  +N      
Sbjct: 297 IGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRN------ 350

Query: 265 GISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
              + + EG  +LY G+   ++K  PS AI + SYEL
Sbjct: 351 ---IWKLEGWGALYTGLVPRMVKIAPSCAIMISSYEL 384

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 116/290 (40%), Gaps = 36/290 (12%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILKREGIRGFWKGNVPGSIMYI 79
           G  +G+FA     PLD  K++LQ  P  K     +L +IL  EG+ G + G     +   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 80  IYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC--LVGSLAGMTSSLASYPFDVLRTRFAA 137
            Y   +FG+Y  +   +     L     L  C    G++ G+  + A    DV+  R   
Sbjct: 80  TYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA----DVVNIRMQN 135

Query: 138 NSQGQLIKLR------DEIMAIWSHE-GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190
           +S  +  K R      D +  I+ +E GL   F+G   +M+   L TA     Y+  K +
Sbjct: 136 DSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNY 195

Query: 191 TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTK 250
              +      ++ +T L   A  ++G  +     P D ++ RI   N   + +   +   
Sbjct: 196 LVTKLDFDASKN-YTHLT--ASLLAGLVATTVCSPADVMKTRIM--NGSGDHQPALKILA 250

Query: 251 DIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           D                 V++EGP  ++RG   S  +  P T +  ++ E
Sbjct: 251 DA----------------VRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 24/198 (12%)

Query: 109 YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQ--LIKLRDEIMAIWSHEGLMGFFSGC 166
           Y    G  AG+ +++ ++P D+ + R  A    +  L ++ + I+A   +EG++G +SG 
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILA---NEGVVGLYSGL 71

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRD--PFTLLNELAGPISGFTSKLATF 224
            ++++     T + FG Y+ +K     R +L++     P ++    +G I G     A  
Sbjct: 72  SAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSM---FSGAIGGLAGNFA-- 126

Query: 225 PLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMS 284
             D V  R+Q  +S  E    R +   I   YK  R+ G         G  +L+ G   +
Sbjct: 127 --DVVNIRMQ-NDSALEAAKRRNYKNAIDGVYKIYRYEG---------GLKTLFTGWKPN 174

Query: 285 LIKSVPSTAISLWSYELF 302
           +++ +  TA  + +Y++F
Sbjct: 175 MVRGILMTASQVVTYDVF 192

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 24/180 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTP--------HNKNA-NVLINILKREG-IRGFWKGN 71
           G L+G FA       D V I++Q           + KNA + +  I + EG ++  + G 
Sbjct: 119 GGLAGNFA-------DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGW 171

Query: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVL 131
            P  +  I+   +Q  +Y    ++L   LD + S          LAG+ ++    P DV+
Sbjct: 172 KPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVM 231

Query: 132 RTRF---AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           +TR    + + Q  L  L D +      EG    F G   S   +G  T ++F   E +K
Sbjct: 232 KTRIMNGSGDHQPALKILADAV----RKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLK 287

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFWKGNVP 73
           L A  L+GL A T  +P D +K ++      H     +L + +++EG    ++G +P
Sbjct: 211 LTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMFRGWLP 267

>Scas_662.12
          Length = 308

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 136/316 (43%), Gaps = 58/316 (18%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTP------HNKNANVLINILK------------ 60
           L AGSL+ L     + PLD +K++LQ+        H K    LIN L             
Sbjct: 15  LSAGSLTTLI----VHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 61  ----REGIRGF---WKGN-VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL 112
               +E  RG      GN V  S+ + IY   +   Y +  ++L      N +  L S  
Sbjct: 71  YNLIKESYRGLPINLLGNAVAWSLYFTIYNSTK--DYMFQNNYLHNN---NTTIFLTS-- 123

Query: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQGQ---LIKLRDEIMAIWSHEGLMGFFSGCGSS 169
            G ++G++++L + P  V++TR  + S+        +R    ++ + EG    + G   S
Sbjct: 124 -GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPS 182

Query: 170 MINIGLNTAIMFGVYESIKI-FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDT 228
           ++ +    AI F +Y+++K+ F    +K         L   L   +S   S ++ +P   
Sbjct: 183 LLGVS-QGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQL 241

Query: 229 VRRRIQIRNS--PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLI 286
           ++  +Q   S   N  ++D  F   I K Y++    G             LY+G++ +L+
Sbjct: 242 LKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKG-------------LYKGLSANLL 288

Query: 287 KSVPSTAISLWSYELF 302
           +++PST I+   YE F
Sbjct: 289 RAIPSTCITFCIYENF 304

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 96/210 (45%), Gaps = 32/210 (15%)

Query: 4   KDHLRKDEEVSTTNS---LVAGSLSGLFARTCIAPLDTVKIKLQVTP-HNKNANVLI--- 56
           KD++ ++  +   N+   L +G +SG+       PL  +K ++  T  H+K++   I   
Sbjct: 103 KDYMFQNNYLHNNNTTIFLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHG 162

Query: 57  --NILKREGIRGFWKGNVP-------GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ 107
             ++L +EG +  W G +P       G+I ++IY   +     +    L      N +  
Sbjct: 163 FKSLLTKEGPKAIWMGLLPSLLGVSQGAIYFMIYDNLKL----HFNVNLNKSKKDNANAN 218

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRT-----RFAANSQGQ----LIKLRDEIMAIWSHEG 158
           L   L+ SL+ M S ++ YPF +L++     R   N+  Q     I L   I  I+   G
Sbjct: 219 LKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITL---IRKIYRDNG 275

Query: 159 LMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           + G + G  ++++    +T I F +YE+ K
Sbjct: 276 IKGLYKGLSANLLRAIPSTCITFCIYENFK 305

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 85/183 (46%), Gaps = 8/183 (4%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK---REGIR- 65
           ++ + TT  +++ S+  + A     P + VK + QV   N +   L +IL+   +EG+R 
Sbjct: 89  EQLIDTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRK 148

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIG-SFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
             ++G     +  I +   QF  Y Y+  ++ +      + P     + GS+AG  ++  
Sbjct: 149 NLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEP-WKGAICGSIAGGIAAAT 207

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           + P D L+TR   N       L   I+ I+  EG   FFSG G   + I    AI  G+Y
Sbjct: 208 TTPLDFLKTRLMLNKT--TASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMY 265

Query: 185 ESI 187
           E++
Sbjct: 266 ETV 268

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 97/230 (42%), Gaps = 22/230 (9%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SL++G+ +G        P+DT+K +LQ                  G +G ++G       
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKG---------GFFANGGYKGIYRGLGSAVVA 57

Query: 71  NVPG-SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           + PG S+ +I Y   +  S  YI      G +  I    +  L  S+  + + L   P +
Sbjct: 58  SAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTH-MLSSSIGEICACLVRVPAE 116

Query: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGL-MGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           V++ R   +S     +    I+   + EGL    + G  ++++     T I F +YE +K
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLK 176

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNS 238
             T  ++    + +P+     + G I+G  +   T PLD ++ R+ +  +
Sbjct: 177 K-TWAKANGQSQVEPWK--GAICGSIAGGIAAATTTPLDFLKTRLMLNKT 223

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 83/200 (41%), Gaps = 42/200 (21%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           S L G+ AG ++ L  +P D ++TR  A                +++ G  G + G GS+
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKG------------GFFANGGYKGIYRGLGSA 54

Query: 170 MINIGLNTAIMFGVYESIKI---------FTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
           ++      ++ F  Y+ +K+         +++   +L D     T  + L+  I    + 
Sbjct: 55  VVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLID-----TTTHMLSSSIGEICAC 109

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
           L   P + V++R Q+ ++ +  +  +   ++  K    +                +LYRG
Sbjct: 110 LVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRK----------------NLYRG 153

Query: 281 VTMSLIKSVPSTAISLWSYE 300
            + ++++ +P T I    YE
Sbjct: 154 WSTTIMREIPFTCIQFPLYE 173

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-ANVLINILKREGIRGFW 68
             +V      + GS++G  A     PLD +K +L +     +  +V+I I + EG   F+
Sbjct: 185 QSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGPAVFF 244

Query: 69  KGNVPGSIMYIIYGGAQF-GSYTYIGSFL 96
            G  P + M+I  GGA F G Y  + S L
Sbjct: 245 SGVGPRT-MWISAGGAIFLGMYETVHSLL 272

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIR 236
            L+ L+G  +G ++ L  FP+DT++ R+Q +
Sbjct: 5   FLSLLSGAAAGTSTDLVFFPIDTIKTRLQAK 35

>Kwal_33.12988
          Length = 303

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 133/310 (42%), Gaps = 38/310 (12%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREG 63
           D   K +   T   + AG+  G+       P D  K++LQ +     A  V+ +++K EG
Sbjct: 13  DLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALRVVQDLVKNEG 72

Query: 64  IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS----PQLYSCLVGSLAGM 119
           +RGF+KG     I   +   +QFG+   +  +     +   +    P+ Y+C  G ++G 
Sbjct: 73  LRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYAC--GFVSGC 130

Query: 120 TSSLASYPFDVLR--------TRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
            ++  + P + +R        +R  A  QG +    D I  +     LM  F+    +++
Sbjct: 131 ANAFLATPIEHVRILLQVQTKSRADAEYQGAM----DCIKKLLKEGKLMRGFT---PTIL 183

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRR 231
                  + F  YE++ I +E+R  ++ +  P   L  L G  SG       +P D ++ 
Sbjct: 184 RTSHGFGVYFTSYEAM-ICSEQRKGIARKDIPAWKLC-LYGAFSGSLLWAMVYPFDVIKS 241

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
            +Q     +++     +  ++++  KN         +  + GP +  +G   ++++S+P 
Sbjct: 242 VMQ-----SDKLRTPVYGTNVFQVAKN---------IYNERGPKAFVKGFGPTMLRSLPV 287

Query: 292 TAISLWSYEL 301
              +  ++E+
Sbjct: 288 NGATFTAFEM 297

>Scas_718.5
          Length = 324

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 128/321 (39%), Gaps = 49/321 (15%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILK 60
           N   H    +       ++AG+  G+       P DT K+++Q +  +  A +++  ++K
Sbjct: 26  NGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVK 85

Query: 61  REGIRGFWKGNVPGSIMYIIYGGA----QFGSYTYIGSFLR------------GGLDLNI 104
            EG+  F+K    GS++ I+  GA    QFG    +  F R            G L L  
Sbjct: 86  NEGVWAFYK----GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLG- 140

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANS-QGQLIKLR---DEIMAIWSHEGLM 160
             Q Y C  G   G+ +S  + P + +R R    +  G   + +   D I  +   + LM
Sbjct: 141 --QYYIC--GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM 196

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
               G    M+  G      F  YE+  +   E  K  DR +  +      G +SG    
Sbjct: 197 ---RGLRPMMLRAGHGLGCYFLTYEA--LIANEIKKGKDRSEIASWKLCSYGSLSGVVLW 251

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
           LA +PLD V+  IQ     N         K+  K+  N  +   GIS        + ++G
Sbjct: 252 LAIYPLDVVKSMIQTDTLRNPR------FKNSMKNVINHLYREQGIS--------AFFKG 297

Query: 281 VTMSLIKSVPSTAISLWSYEL 301
              +++++ P    +  ++EL
Sbjct: 298 FAPTMLRAAPVNGATFVTFEL 318

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 76/180 (42%), Gaps = 16/180 (8%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA----NVLINILKREGIRGFWKGNVPGS 75
           + G   G+      +P++ V+I+LQ    N N       L  I K    +   +G  P  
Sbjct: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRP-- 201

Query: 76  IMYIIYGGAQFGSY--TY---IGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
              ++  G   G Y  TY   I + ++ G D +       C  GSL+G+   LA YP DV
Sbjct: 202 --MMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259

Query: 131 LRTRFAANS-QGQLIK--LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
           +++    ++ +    K  +++ I  ++  +G+  FF G   +M+         F  +E +
Sbjct: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 57.4 bits (137), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 72/143 (50%), Gaps = 12/143 (8%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKN-ANVLINILKR 61
           L++  +  ++ + +AG ++G  +RT ++P + VKI LQV    + +N    N +  + K 
Sbjct: 3   LKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RGGLDLNISPQLYSCLVGSL 116
           EG+ G ++GN    +    Y   QF  Y +    +       G +  ++ Q  S   G+L
Sbjct: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA--GAL 120

Query: 117 AGMTSSLASYPFDVLRTRFAANS 139
            G  S LA+YP D++RTR +  +
Sbjct: 121 CGGMSVLATYPLDLVRTRLSIQT 143

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIK--LRDEIMAIWSHEGLMGFFSGCGSS 169
           + G +AG  S     PF+ ++      S        + + +  ++  EG+ G F G G +
Sbjct: 16  IAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLN 75

Query: 170 MINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
            + I   +A+ F VYE  K           +          AG + G  S LAT+PLD V
Sbjct: 76  CVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLV 135

Query: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL-SLYRGV 281
           R R+ I+ + N  +  +   KDI K       L   +   ++EG +  LYRG+
Sbjct: 136 RTRLSIQTA-NLAKLSKSKAKDIAKPPGVWELL---VKTFKEEGGIRGLYRGI 184

 Score = 30.8 bits (68), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269
           +AG ++G  S+    P + V+  +Q+++S +   H       + + YK            
Sbjct: 16  IAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHG--IINAVGQVYK------------ 61

Query: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
            +EG   L+RG  ++ ++  P +A+    YE
Sbjct: 62  -EEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91

>Scas_562.12
          Length = 300

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 22/196 (11%)

Query: 6   HLRKDEEVS-------TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINI 58
           H +KD + +          S  AGSL G+     + PLD +KIK Q  P        + I
Sbjct: 103 HYKKDFDSAFGEKTGKAMRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPEAFKGRGFVKI 161

Query: 59  LKREGIRGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC 111
           LK EGI   ++G       N PGS  + ++GG  F     +G  L      + S    S 
Sbjct: 162 LKDEGIFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILG--LEDYSQASWSQNFISS 217

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           +VG+     S + S P DV++TR    S          +   + +EG+  FF G    ++
Sbjct: 218 IVGA---SCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLL 274

Query: 172 NIGLNTAIMFGVYESI 187
             G      F + +S+
Sbjct: 275 TTGPKLVFSFALAQSL 290

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 118/312 (37%), Gaps = 57/312 (18%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNK--NANVLINILKRE----- 62
           D + S    L+  + +G+       P+DT+  +L ++ H K  N++ L  ++ RE     
Sbjct: 5   DRKQSGVARLLGSASAGILEIGVFHPVDTISKRL-MSNHTKIGNSHELNRVIFREHFSEP 63

Query: 63  -GIRGFWKGNVPG---SIMYII------YGGAQFGSYTYIGSFLRGGLDLNISPQ----L 108
            G R F     PG   +  Y +      YGG  F +  ++    +   D     +    +
Sbjct: 64  LGKRLFTL--FPGLGYAASYKVLQRVYKYGGQPFAN-EFLNKHYKKDFDSAFGEKTGKAM 120

Query: 109 YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGS 168
            S   GSL G+   +   P DVL+ +   N +    K R   + I   EG+   + G G 
Sbjct: 121 RSATAGSLIGI-GEIVLLPLDVLKIKRQTNPEA--FKGRG-FVKILKDEGIFNLYRGWGW 176

Query: 169 SMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDT 228
           +      N    F ++       E    L D        N ++  +    S + + PLD 
Sbjct: 177 TAAR---NAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDV 233

Query: 229 VRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV----QQEGPLSLYRGVTMS 284
           ++ RIQ R+  N E                      G+++V    + EG  + ++G+T  
Sbjct: 234 IKTRIQNRSFDNPE---------------------TGLTIVKNTFKNEGITAFFKGLTPK 272

Query: 285 LIKSVPSTAISL 296
           L+ + P    S 
Sbjct: 273 LLTTGPKLVFSF 284

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 127/308 (41%), Gaps = 40/308 (12%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG 70
           E   T++ L+ G + GL +   + P D +K +LQ    NK+  +   + +    +  W+G
Sbjct: 3   ERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQ---QNKDTTLWGTLKEIRSPKQLWRG 59

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP--------QLYSCLV-GSLAGMTS 121
            +P S+   I       +     + +  G    ++P         +Y  L  G+      
Sbjct: 60  ALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVV 119

Query: 122 SLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
              + P  +++ R+  ++      L +    I+S EG+ GFF+GCG++++       +  
Sbjct: 120 GFITMPITIIKVRYE-STMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYV 178

Query: 182 GVYESIKIFTE---ERSKLS-DRRDPF-----TLLNELAGPISGFTSKLATFPLDTVRRR 232
            +YE  K+        S +S D    F     T++N ++  +S   +   T P DT++ R
Sbjct: 179 LLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTR 238

Query: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292
           +Q+         D       YK+          + +V +E   +L+ G+T+ L +   S 
Sbjct: 239 MQL---------DPTKFSGFYKTL---------VLIVSKEKFKNLFDGLTLRLTRKAFSA 280

Query: 293 AISLWSYE 300
            I+   YE
Sbjct: 281 GIAWGIYE 288

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 119/297 (40%), Gaps = 31/297 (10%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI-NILKREGIRGFWKGN 71
           +S +AGS++G    +   P +  K +LQ+    +  ++N  VLI N  K  GI   + G 
Sbjct: 92  HSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGC 151

Query: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSL-ASYPFDV 130
               +      G +F  +  I + LR      +S      + G  AG+  S+ A  PF+ 
Sbjct: 152 PAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELS-GFRGVVAGLGAGLLESVVAVTPFEA 210

Query: 131 LRTRFAANSQGQLIKLRDE-------IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
           ++T    + Q  + K ++           + S +G  G + G     +    N A+  G 
Sbjct: 211 IKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGC 270

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
           Y  IK   ++ + +   +   + L  + G  SG  +   T P+DTV+ R+Q  N+     
Sbjct: 271 YNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSS 330

Query: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
               F                  ++ ++EG  + ++G T  L + + S  I    YE
Sbjct: 331 TINCFA-----------------TIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 87/194 (44%), Gaps = 14/194 (7%)

Query: 8   RKDEEVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKL------QVTPHNKNANVLIN--- 57
           +K  E+S    +VAG  +GL  +   + P + +K  L       V  +  N   +++   
Sbjct: 179 KKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYA 238

Query: 58  -ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL---V 113
            +L  +G  G ++G +P S+        + G Y  I + ++   ++     L S L   V
Sbjct: 239 KLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIV 298

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
           G+ +G+ +   + P D ++TR  + + GQ     +    I+  EGL  F+ G    +  +
Sbjct: 299 GAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRL 358

Query: 174 GLNTAIMFGVYESI 187
            L+  I+F +YE +
Sbjct: 359 ILSGGIVFTIYEKV 372

>Kwal_33.15597
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 90/200 (45%), Gaps = 23/200 (11%)

Query: 5   DHLRKDEEVSTTNSLVAGS--LSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILK 60
           D L  D+ V+  NS+  GS  ++  FA   + PL+  +I+L   P   N  V     ILK
Sbjct: 99  DTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRILK 158

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQF-----GSYTYIGSFLRGGLDLNISPQLYSCLVGS 115
            EG+  F+ G  P     I Y  A+F      +  Y G           +    + L G 
Sbjct: 159 EEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGL 218

Query: 116 LAGMTSSLASYPFDVLRTRF--AANSQGQ-----LIKLRDEIMAIWSHEGLMGFFSGCGS 168
            AG+ +++ S P D L ++   A  + GQ     L +L  E+       G +G F+G  +
Sbjct: 219 TAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKEL-------GFVGSFAGLPT 271

Query: 169 SMINIGLNTAIMFGVYESIK 188
            ++ +G  T++ FG+Y S+K
Sbjct: 272 RLVMVGTLTSLQFGIYGSLK 291

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 74/193 (38%), Gaps = 24/193 (12%)

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
            L G++   T+  A  P DV++TR           +      I S EG     +G G ++
Sbjct: 17  ALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTL 76

Query: 171 INIGLNTAIMFGVYESIK---IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
           +   L  +  FG YE  K   I T    +  + ++   + +     I+ F + +A  PL+
Sbjct: 77  LGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGS---AAIAEFFADIALCPLE 133

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
             R  I++ + P        F   +   +           ++++EG  S Y G T  L K
Sbjct: 134 ATR--IRLVSQPT-------FANGLVGGFSR---------ILKEEGLSSFYNGFTPILFK 175

Query: 288 SVPSTAISLWSYE 300
            +P        +E
Sbjct: 176 QIPYNIAKFLVFE 188

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 95/233 (40%), Gaps = 14/233 (6%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---ILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   N  ++ +   I+  EG      G  P  +
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLY-SCLVGS--LAGMTSSLASYPFDVLRT 133
            Y + G  +FG Y          L  + +     S  +GS  +A   + +A  P +  R 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 134 RFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYESIK--I 189
           R    SQ      L      I   EGL  F++G    +   I  N A  F V+E      
Sbjct: 138 RLV--SQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIA-KFLVFERAAEVY 194

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI-QIRNSPNE 241
           F     K +      T LN L+G  +G  + + + P DT+  ++ + + +P +
Sbjct: 195 FGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQ 247

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 80/196 (40%), Gaps = 22/196 (11%)

Query: 6   HLRKDEEVS-------TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINI 58
           H +KD + +          S  AGSL G+     + PLD +KIK Q  P        + I
Sbjct: 103 HFKKDFDSAFGDKTGKALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPEAFKGRGFLKI 161

Query: 59  LKREGIRGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC 111
           LK EGI   ++G       N PGS  + ++GG  F     +G  L+       S    S 
Sbjct: 162 LKDEGIFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILG--LQDYSQATWSQNFISS 217

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           +VG+ A +   + S P DV++TR    +          +     +EG   FF G    ++
Sbjct: 218 IVGASASL---IVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLL 274

Query: 172 NIGLNTAIMFGVYESI 187
             G      F + +S+
Sbjct: 275 TTGPKLVFSFALAQSL 290

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 111/305 (36%), Gaps = 43/305 (14%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN--ILKREGIRGF 67
           D + S    L+  + +G+       P+DT+  +L        +   +N  I +      F
Sbjct: 5   DRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAF 64

Query: 68  WK---GNVPG---SIMYII------YGGAQFGSYTYIGSFLRGGLDLNISPQ----LYSC 111
            K      PG   + +Y I      YGG  F +  ++    +   D     +    L S 
Sbjct: 65  GKRVFTLFPGLGYAAVYKILQRVYKYGGQPFAN-EFLNKHFKKDFDSAFGDKTGKALRSA 123

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
             GSL G+   +   P DVL+ +   N +    K R   + I   EG+   + G G +  
Sbjct: 124 TAGSLIGI-GEIVLLPLDVLKIKRQTNPEA--FKGRG-FLKILKDEGIFNLYRGWGWTAA 179

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRR 231
               N    F ++       E    L D        N ++  +    S + + PLD ++ 
Sbjct: 180 R---NAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKT 236

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
           RIQ RN  N E          +K  KN          ++ EG  + ++G+T  L+ + P 
Sbjct: 237 RIQNRNFDNPESG--------FKIVKN---------TLKNEGFTAFFKGLTPKLLTTGPK 279

Query: 292 TAISL 296
              S 
Sbjct: 280 LVFSF 284

>Scas_669.6
          Length = 373

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 134/325 (41%), Gaps = 30/325 (9%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTPHNKNANVLI-N 57
           N+   L  D   S  + ++AG + G+   + +  LDTVK + Q   +TP  KN       
Sbjct: 38  NEPSSLNGDNGSSLLHCVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTPKYKNMTTAYRT 97

Query: 58  ILKREGI-RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116
           I   EGI RG + G     +         FG+Y +    + G L  N +    S   G L
Sbjct: 98  IFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHLSA--GLL 155

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIK-----------LRDEIMAIWSHEGLMGFFSG 165
               SS    P +VL+TR     QG++             LR  I  I + EG+   F G
Sbjct: 156 GDFVSSFVYVPSEVLKTRLQL--QGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFG 213

Query: 166 CGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL-AGPISGFTSKLATF 224
             +++      +A+ FG YE  +    +  K    +   ++ NE+  G I+G  + + T 
Sbjct: 214 YKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITT 273

Query: 225 PLDTVRRRIQIRNS---PNEERHDREFTKDIYKSYK-----NRRFLGVGISMVQQEGPLS 276
           P+D ++ R+Q + +   PN        +    K  +     N  F  + + + Q EG + 
Sbjct: 274 PMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKL-VYQSEGVIG 332

Query: 277 LYRGVTMSLIKSVPSTAISLWSYEL 301
            + GV    + +   ++I L  Y++
Sbjct: 333 FFSGVGPRFVWTSVQSSIMLLLYQM 357

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 124/311 (39%), Gaps = 45/311 (14%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNV 72
            S+T  L+ G   GL +   + PLD +K + Q T   K   +   +   +     W+G +
Sbjct: 2   ASSTGHLIGGFAGGLSSAVALQPLDLLKTRFQQT---KGGTLWQTVKSLDTPWQLWRGTL 58

Query: 73  PGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNIS---------PQL--YSCLV-GSLAG 118
           P +I   +       S   + + L  R   D   S         PQL  Y  LV G+ A 
Sbjct: 59  PSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFAR 118

Query: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178
            T    + P  +++ R+ +        + +   +I + EG+ GFF G G + +     + 
Sbjct: 119 GTVGYITMPITIIKVRYESTLY-NYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSG 177

Query: 179 IMFGVYESIK-----IFTEERSKLSD--RRDPF--TLLNELAGPISGFTSKLATFPLDTV 229
           +   +YE +K     I  +   +L    R   +  T +N  +  +S   +   T P DT+
Sbjct: 178 LYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTI 237

Query: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
           + R+Q+  +                  K + F     ++V QE P+ ++ G++M L +  
Sbjct: 238 KTRMQLEPT------------------KFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKA 279

Query: 290 PSTAISLWSYE 300
            S  I+   YE
Sbjct: 280 LSAGIAWGIYE 290

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 87/216 (40%), Gaps = 34/216 (15%)

Query: 4   KDHLRKDEEVSTTNSLVAGS-------------LSGLFARTCIA----PLDTVKIKLQVT 46
           +  L K ++  T +S+V G              ++G FAR  +     P+  +K++ + T
Sbjct: 79  RTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYEST 138

Query: 47  PHNKN--ANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL-----RGG 99
            +N    A    +I  +EGIRGF++G  P  +    Y G     Y  +   L     +  
Sbjct: 139 LYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSL 198

Query: 100 LDLNISPQLYSCLVGSLAGMTSSLASY--------PFDVLRTRFAANSQGQLIKLRDEIM 151
           L L+ S   Y+    +    TS++ S         PFD ++TR       +       + 
Sbjct: 199 LQLD-SEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPT-KFKTFWSTLT 256

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
            I + E  +  FSG    +    L+  I +G+YE +
Sbjct: 257 TIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 120/292 (41%), Gaps = 38/292 (13%)

Query: 19  LVAGSLSGLFARTCIAPLDTVK--IKLQVT----PHNKNA-NVLINILKREGIRGFWKGN 71
            +AG+++G+     + PLD VK  ++LQV+    P  K   + L  I  +EG    +KG 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 72  VPGSIMYIIYGGAQFG---SYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
               +M       +F     +  I   L G   L    Q  S L G+ AG+  S    PF
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT---QPLSILSGASAGICESFVVVPF 129

Query: 129 DVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           ++++ R   +   +       +  I   EG++  ++G  S+M   G+  A  FG+   ++
Sbjct: 130 ELVKIRLQ-DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR 188

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ----IRNSPNEERH 244
               + S  S++    T  + LAG + G  S L + P D V+ R+Q    I   P +   
Sbjct: 189 ALLPKASTKSEQ----TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNW 244

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
                  IYK                +EG  +LY+G    +++  P   I L
Sbjct: 245 SWPALATIYK----------------EEGFKALYKGFVPKVLRLGPGGGILL 280

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 80/187 (42%), Gaps = 8/187 (4%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--NILKREGIRGFW 68
           E+++   S+++G+ +G+     + P + VKI+LQ       + + +  NI+++EGI   +
Sbjct: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMY 163

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
            G       + I+    FG    + + L               L G++ G  SSL S PF
Sbjct: 164 NGLESTMWRHGIWNAGYFGIIFQVRALLPKA-STKSEQTRNDLLAGTVGGTLSSLLSTPF 222

Query: 129 DVLRTRFAANSQGQLIKLR-----DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
           DV+++R    +    +  +       +  I+  EG    + G    ++ +G    I+  V
Sbjct: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVV 282

Query: 184 YESIKIF 190
           +  +  F
Sbjct: 283 FTGVMDF 289

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 78/184 (42%), Gaps = 25/184 (13%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRT----RFAANSQGQLIKLRDEIMAIWSHEGLMG 161
           P +Y  + G++AG++  L  YP D+++T    + +  S  Q   + D +  I + EG   
Sbjct: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
            + G  S ++      A  F   +  +   ++         P ++L+   G  +G     
Sbjct: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS---GASAGICESF 124

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
              P + V+ R+Q  +S        +FT  I           V  ++V++EG L++Y G+
Sbjct: 125 VVVPFELVKIRLQDVSS--------KFTSPI----------AVVKNIVEKEGILAMYNGL 166

Query: 282 TMSL 285
             ++
Sbjct: 167 ESTM 170

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTP-----HNKNANVLINILKREGIRG 66
           T N L+AG++ G  +     P D VK ++Q   V P     +N +   L  I K EG + 
Sbjct: 201 TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR 97
            +KG VP  +     GG     +T +  F R
Sbjct: 261 LYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 197 LSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSY 256
           +SD++    +   +AG ++G +  L  +PLD V+  +Q++ S           K ++   
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ----YKGVFDCL 56

Query: 257 KNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
           K          +  +EGP  LY+G++  ++   P  A
Sbjct: 57  KQ---------IAAKEGPSRLYKGISSPILMEAPKRA 84

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 98/206 (47%), Gaps = 26/206 (12%)

Query: 98  GGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQ-GQLIKLRDEIMAIWSH 156
           G +D  +    Y    GS +G+ +++ + P  V++TR  A S+ G      D +  ++  
Sbjct: 105 GIMDRRLPAHAYMLAAGS-SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQT 163

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAG--PI 214
           EG++ F+ G   S++ +    AI F +Y+++K      S  +D+ +    ++E+ G   I
Sbjct: 164 EGVLAFWRGVVPSLLGVS-QGAIYFALYDTLKFHYLHSS--TDKAERRLSVSEIIGITCI 220

Query: 215 SGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGP 274
           S   S  + +P   ++ ++Q   +P+      +  + +Y                 +EG 
Sbjct: 221 SKMISVTSVYPFQLLKSKLQDFGAPSG---ITQLVQTVYS----------------REGI 261

Query: 275 LSLYRGVTMSLIKSVPSTAISLWSYE 300
              YRG++ +L+++VP+T I+ + YE
Sbjct: 262 RGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 84/186 (45%), Gaps = 10/186 (5%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT----PHNKNANVLINILKREGIR 65
           D  +     ++A   SG+       P+  +K ++  T    P+    + +  + + EG+ 
Sbjct: 108 DRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVL 167

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSCLVG--SLAGMTSS 122
            FW+G VP S++ +  G   F  Y T    +L    D        S ++G   ++ M S 
Sbjct: 168 AFWRGVVP-SLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISV 226

Query: 123 LASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
            + YPF +L+++      G    +   +  ++S EG+ GF+ G  ++++     T I F 
Sbjct: 227 TSVYPFQLLKSKL--QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFF 284

Query: 183 VYESIK 188
           VYE+IK
Sbjct: 285 VYENIK 290

>Scas_702.10
          Length = 302

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 106/271 (39%), Gaps = 37/271 (13%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILKREGIRGFWKGNVPGSIMYI 79
           G  +G+FA     PLD  K++LQ  P  K     +L  IL+ E + G + G     +   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 80  IYGGAQFGSYTYIGSFLRGGLDLNISPQLYSC--LVGSLAGMTSSLASYPFDVLRTRFAA 137
            Y   +FG+Y  +   L     +N    L  C    G++ G+  + A    DV+  R   
Sbjct: 76  TYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFA----DVVNIRM-Q 130

Query: 138 NSQGQLIKLR-------DEIMAIWSHE-GLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
           N      +LR       D +  I+ HE G+    +G   +M+   L TA     Y+  K 
Sbjct: 131 NDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKN 190

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFT 249
           +   +     +++   L   L   ++G  +     P D ++ RI      N  + + E  
Sbjct: 191 YLVTKLSFDPKKNSTHLSASL---LAGLVATTICSPADVIKTRIM-----NAHKTESESA 242

Query: 250 KDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
             I              S +++EGP  ++RG
Sbjct: 243 IKILT------------SAIKKEGPSFMFRG 261

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 83/198 (41%), Gaps = 24/198 (12%)

Query: 109 YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGS 168
           Y    G  AG+ + + ++P D+ + R  A    +   L   +  I  +E +MG +SG  +
Sbjct: 11  YPWWYGGAAGIFACVMTHPLDLAKVRLQAAPLPK-PTLGRMLTTILRNENVMGLYSGLSA 69

Query: 169 SMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLL--NELAGPISGFTSKLATFPL 226
           +++     T + FG Y+ +K   E         D   LL  +  +G I G     A    
Sbjct: 70  AVLRQCTYTTVRFGAYDLMK---ENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFA---- 122

Query: 227 DTVRRRIQIRNS--PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMS 284
           D V  R+Q  ++  P   R+ R     +YK Y            + + G  +L  G   +
Sbjct: 123 DVVNIRMQNDSALKPELRRNYRNAIDGVYKIY------------MHEGGIKTLLTGWKPN 170

Query: 285 LIKSVPSTAISLWSYELF 302
           +++ V  TA  + +Y++F
Sbjct: 171 MVRGVLMTASQVVTYDVF 188

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKL---QVTPHNKNANVLINILKREGIRG 66
           D + ++T+ L A  L+GL A T  +P D +K ++     T       +L + +K+EG   
Sbjct: 199 DPKKNSTH-LSASLLAGLVATTICSPADVIKTRIMNAHKTESESAIKILTSAIKKEGPSF 257

Query: 67  FWKGNVP 73
            ++G +P
Sbjct: 258 MFRGWLP 264

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 39/219 (17%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNK---NANVLINILK 60
           +DH    +   + N L  G+ + + A T +APL+ +K +LQ  P ++      ++   L 
Sbjct: 142 RDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLL 201

Query: 61  RE--------GIRGFWKG-------NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS 105
           +E        G +  +KG       +VP S +Y  +G  +F    +   F    L  N+S
Sbjct: 202 KETRNEIRSGGYKVLFKGLEITLWRDVPFSAIY--WGSYEFYKKNFWIDFSEQCLRWNLS 259

Query: 106 PQ----LYSCLVGSLAGMTSSLASYPFDVLRTRFA-----ANSQ-GQLIKLRDEIMA--- 152
           P     + S + GS++G +++L ++PFDV +TR        N Q   L+  +  + A   
Sbjct: 260 PNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGM 319

Query: 153 ------IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
                 I   EG    ++G    ++ I  + AIM   YE
Sbjct: 320 FKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 39  VKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG 98
           ++ K      N        I + EG+   W+G     +M I      F  Y       R 
Sbjct: 88  IQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGY----EMFRD 143

Query: 99  GLDLNIS-PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA------NSQGQLI------K 145
              +  S P L     G+ A M ++    P ++++TR  +      ++  Q++      +
Sbjct: 144 HSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKE 203

Query: 146 LRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI-----FTEE--RSKLS 198
            R+EI +     G    F G   ++      +AI +G YE  K      F+E+  R  LS
Sbjct: 204 TRNEIRS----GGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLS 259

Query: 199 DRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKN 258
              D F + + + G +SG ++ L T P D  + R+QI  + + E   R       K    
Sbjct: 260 PNWD-FFINSFIGGSVSGSSAALLTHPFDVGKTRMQI--TMDIENKQRNTLVSPKKRVSA 316

Query: 259 RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           R       ++ Q EG  +LY G+   ++K  PS AI + +YEL
Sbjct: 317 RGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYEL 359

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 63/147 (42%), Gaps = 17/147 (11%)

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL-AGPIS 215
           EGL   + G   +++       + F  YE   +F +     S  RD +  LN L  G  +
Sbjct: 111 EGLATLWRGLSITLLMAIPANVVYFSGYE---MFRDH----SPMRDSYPSLNPLFCGATA 163

Query: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275
              +     PL+ ++ R+Q      ++   +   KD+ K  +N          ++  G  
Sbjct: 164 RMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNE---------IRSGGYK 214

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYELF 302
            L++G+ ++L + VP +AI   SYE +
Sbjct: 215 VLFKGLEITLWRDVPFSAIYWGSYEFY 241

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 117/296 (39%), Gaps = 47/296 (15%)

Query: 22  GSLSGLFARTCIAPLDTVKIKLQVTPH-------NKNANVLINILKR----EGIRGFWKG 70
           G +S   ++T  AP++ VK+ +Q           ++    ++   KR    EG+  FW+G
Sbjct: 17  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASFWRG 76

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS----- 125
           N    I Y       F     I    +                G+LA    +        
Sbjct: 77  NTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNLASGGLAGGLSLLFV 132

Query: 126 YPFDVLRTRFAANSQG-------QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178
           Y  D  RTR AA+S+        Q   L D      + +G+ G + G   S++ I +   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRG 192

Query: 179 IMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNS 238
           + FG+Y+S+K        L+   +   L + L G      +  A++PLDTVRRR+ +  S
Sbjct: 193 LYFGLYDSLKPLL-----LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMM-TS 246

Query: 239 PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
               ++D  F  D ++             +V  EG  SL++G   ++++ V    +
Sbjct: 247 GQAVKYDGAF--DAFR------------KIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 7/165 (4%)

Query: 28  FARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFG 87
           +ART +A       K      N   +V    L  +G+ G ++G +P  +  ++Y G  FG
Sbjct: 137 YARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFG 196

Query: 88  SYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR 147
            Y  +   L  G   N    L S L+G      +S ASYP D +R R    S GQ +K  
Sbjct: 197 LYDSLKPLLLTGSLEN--SFLASFLLGWAVTTGASTASYPLDTVRRRMMMTS-GQAVKYD 253

Query: 148 ---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
              D    I + EG+   F GCG++++  G+  A +  +Y+ +++
Sbjct: 254 GAFDAFRKIVAAEGIKSLFKGCGANILR-GVAGAGVISMYDQLQV 297

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 198 SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH-DREFTKDIYKSY 256
           +D++     ++ L G +S   SK A  P++ V+  IQ ++   ++   DR +T  I + +
Sbjct: 3   TDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYT-GIVECF 61

Query: 257 KNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
           K              EG  S +RG T ++I+  P+ A++ 
Sbjct: 62  KR---------TAADEGVASFWRGNTANVIRYFPTQALNF 92

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 9/193 (4%)

Query: 5   DHLRKDEEVSTTNSLVAGS--LSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILK 60
           D+L  D      NS+  GS  ++   A   + PL+  +I+L   P   N  V     ILK
Sbjct: 103 DNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILK 162

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL-----NISPQLYSCLVGS 115
            EGI  F+ G  P     I Y  A+F  +     F  G         + S  L + L G 
Sbjct: 163 EEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGL 222

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            AG+ +++ S P D L ++     +         +  +    G  G F+G  + ++ +G 
Sbjct: 223 TAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGT 282

Query: 176 NTAIMFGVYESIK 188
            T++ FG+Y S+K
Sbjct: 283 LTSLQFGIYGSLK 295

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 97/235 (41%), Gaps = 18/235 (7%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVL---INILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   N  ++     I+  EG      G  P  +
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLL 81

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY---PFDVLRT 133
            Y I G  +FG Y     F    L  + + +  + +    A M   LA     P +  R 
Sbjct: 82  GYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRI 141

Query: 134 RFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYESIKIF- 190
           R    SQ Q    L      I   EG+  F+SG    +   I  N A  F V+E    F 
Sbjct: 142 RLV--SQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIA-KFLVFERASEFY 198

Query: 191 ---TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI-QIRNSPNE 241
                 + KLS      TLLN L+G  +G  + + + P DT+  ++ + + +P +
Sbjct: 199 YGFAGPKEKLSSTST--TLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQ 251

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 77/200 (38%), Gaps = 22/200 (11%)

Query: 103 NISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGF 162
           ++S  +   L G++   ++  +  P DV++TR           +      I + EG    
Sbjct: 13  SVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGAL 72

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIKIFTEER--SKLSDRRDPFTLLNELAGPISGFTSK 220
            +G G +++   +  A  FG YE  K F  +      + R      +   A  ++ F + 
Sbjct: 73  LTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAA--MAEFLAD 130

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
           +A  PL+  R  I++ + P       +F   +   +           ++++EG  S Y G
Sbjct: 131 IALCPLEATR--IRLVSQP-------QFANGLVGGFSR---------ILKEEGIGSFYSG 172

Query: 281 VTMSLIKSVPSTAISLWSYE 300
            T  L K +P        +E
Sbjct: 173 FTPILFKQIPYNIAKFLVFE 192

>Scas_697.47
          Length = 328

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 131/304 (43%), Gaps = 44/304 (14%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR-----------EGIRG 66
           SLVAG + G+ A     P D +K++ Q    +   + +  ILK              ++G
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKG 98

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQL---YSCLVGSLAGMTSSL 123
           F+KG +P  +         F  Y  +G  +    D + S QL        G ++ + ++L
Sbjct: 99  FYKGVIPPLLGVTPIFAVSFWGYD-VGKKIVTRSDSS-SAQLTMGQMAAAGFISAIPTTL 156

Query: 124 ASYPFD----VLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAI 179
            + P +    VL+T   ANS+   I     I+      G+   F G  +++   G  +A+
Sbjct: 157 VTAPTERIKVVLQTA-GANSKTSFIGAAKNIV---KDGGVKSLFKGSLATLARDGPGSAL 212

Query: 180 MFGVYESIKIFTEERSKLSDRRD-PFTLLNE-LAGPISGFTSKLATFPLDTVRRRIQIRN 237
            F  YE  K F  +R+  ++ +     + N  LAG I+G +  L  FP+DT++ ++Q   
Sbjct: 213 YFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ--- 269

Query: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
           S +  +     T++IY               V++ G    + G+  +L++S P+ A +  
Sbjct: 270 SSSGSQSMVAATREIY---------------VKRGGIKGFFPGLGPALLRSFPANAATFL 314

Query: 298 SYEL 301
             EL
Sbjct: 315 GVEL 318

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 86/192 (44%), Gaps = 32/192 (16%)

Query: 21  AGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVL---INILKREGIRGFWKGNV----- 72
           AG +S +      AP + +K+ LQ    N   + +    NI+K  G++  +KG++     
Sbjct: 146 AGFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLAR 205

Query: 73  --PGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYS--------CLVGSLAGMTSS 122
             PGS +Y       F SY     FL    D N + +  +        CL G +AGM+  
Sbjct: 206 DGPGSALY-------FASYEISKKFLN---DRNATAESKTGEVNIANVCLAGGIAGMSMW 255

Query: 123 LASYPFDVLRTRFAANSQGQ-LIKLRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIM 180
           L  +P D ++T+  ++S  Q ++    EI       G+ GFF G G +++ +   N A  
Sbjct: 256 LVVFPIDTIKTKLQSSSGSQSMVAATREIYV--KRGGIKGFFPGLGPALLRSFPANAATF 313

Query: 181 FGVYESIKIFTE 192
            GV  +  +F +
Sbjct: 314 LGVELTHSLFKK 325

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 91/210 (43%), Gaps = 35/210 (16%)

Query: 104 ISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFA---ANSQGQLIK--LRDEIMAIWSHEG 158
           I   L S + G + G+ + L  +PFD+++ R     A+S    IK  L+D   AI +   
Sbjct: 33  IRDNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDA-RAIPTSNM 91

Query: 159 LM----GFFSGCGSSMINIGLNTAIMFGVYE-SIKIFTEERSKLSDRRDPFTLLNELA-- 211
           L+    GF+ G    ++ +    A+ F  Y+   KI T      SD       + ++A  
Sbjct: 92  LVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTR-----SDSSSAQLTMGQMAAA 146

Query: 212 GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQ 271
           G IS   + L T P + ++  +Q   + ++                   F+G   ++V+ 
Sbjct: 147 GFISAIPTTLVTAPTERIKVVLQTAGANSKTS-----------------FIGAAKNIVKD 189

Query: 272 EGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
            G  SL++G   +L +  P +A+   SYE+
Sbjct: 190 GGVKSLFKGSLATLARDGPGSALYFASYEI 219

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN--ANVLINILKREGIRG 66
           K  EV+  N  +AG ++G+     + P+DT+K KLQ +  +++  A      +KR GI+G
Sbjct: 234 KTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSGSQSMVAATREIYVKRGGIKG 293

Query: 67  FWKGNVP 73
           F+ G  P
Sbjct: 294 FFPGLGP 300

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 126/300 (42%), Gaps = 46/300 (15%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINIL----KREGI------RGF 67
           SL AG++ G+ A     P D +K++ Q    +   + +  IL     + G+      RGF
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRGF 109

Query: 68  WKGNVP-----GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSS 122
           +KG +P       I  + + G   G      +   G L    + QL +   G ++ + ++
Sbjct: 110 YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLT---TAQLATA--GFISAIPTT 164

Query: 123 LASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
           L   P + ++      S   L      I+A     G+   F G  +++   G  +A+ F 
Sbjct: 165 LVMAPTERVKVVLQTQSNHSLGSAAKHILAT---GGVRSLFRGSLATLARDGPGSALYFA 221

Query: 183 VYESIKIFTEERSKLSDRRDPFTLLNE-LAGPISGFTSKLATFPLDTVRRRIQIRNSPNE 241
            YE+ K +   RS  ++     ++ N  LAG ++G +  +  FP+DT++  +Q   S N 
Sbjct: 222 SYEATKAYLNARSGTNE----LSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQ---SSNT 274

Query: 242 ERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
            +   E T+ IY +               + G    + G+  +L++S P+ A +    EL
Sbjct: 275 RQTMMEATRKIYNT---------------RGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 89/190 (46%), Gaps = 18/190 (9%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGN 71
           +++T     AG +S +     +AP + VK+ LQ   ++   +   +IL   G+R  ++G+
Sbjct: 146 KLTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQSNHSLGSAAKHILATGGVRSLFRGS 205

Query: 72  V-------PGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
           +       PGS +Y       F SY    ++L      N       CL G +AG++  + 
Sbjct: 206 LATLARDGPGSALY-------FASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVG 258

Query: 125 SYPFDVLRTRF-AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFG 182
            +P D ++T   ++N++  +++   +I    +  G+ GFF G G +++ +   N A   G
Sbjct: 259 VFPIDTIKTELQSSNTRQTMMEATRKIYN--TRGGIKGFFPGIGPALLRSFPANAATFLG 316

Query: 183 VYESIKIFTE 192
           V  +  +F +
Sbjct: 317 VELTHSLFKK 326

>Scas_640.25
          Length = 306

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 122/293 (41%), Gaps = 33/293 (11%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQV-----------TPHNKNANVLINILKREGIRG 66
             +AG+++G+     + PLD VK ++Q+           T +    + L  I+K+EG   
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
            +KG     +M       +F S        +         Q  S L G+ AG+T +L   
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135

Query: 127 PFDVLRTRFA-ANSQGQLIKLRDEIMA-IWSHEGLMGFFSGCGSSMINIGLNTAIMFGV- 183
           PF++++ R    NS+    K   E++  I   +GL G +SG  S++    +  A  FGV 
Sbjct: 136 PFELVKIRLQDVNSK---FKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI 192

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
           ++  ++    +SK    R+        AG + G    +   P D V+ RIQ         
Sbjct: 193 FQVRELLPVAKSKQEKTRNDLC-----AGFVGGTFGVMFNTPFDVVKSRIQ--------S 239

Query: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
              E    + K   N  +  V + +  +EG  +LY+G    +++  P  A+ L
Sbjct: 240 DGNEIINGVRKY--NWTWPSV-MKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 86/191 (45%), Gaps = 10/191 (5%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ-VTPHNKN-ANVLINILKREGIRGFW 68
           ++++   S+++G+ +G+     I P + VKI+LQ V    K    VL +I+K++G++G +
Sbjct: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLY 171

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
            G         ++    FG    +   L          +   C  G + G    + + PF
Sbjct: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC-AGFVGGTFGVMFNTPF 230

Query: 129 DVLRTRFAANSQGQLIKLRD------EIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
           DV+++R  ++    +  +R        +M I+  EG    + G    ++ +G   A++  
Sbjct: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290

Query: 183 VYESI-KIFTE 192
           V+ ++  +F E
Sbjct: 291 VFTNVMNVFRE 301

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF--------AANSQGQLIKLRDEIMAIWSHE 157
           P  Y  + G++AG++  +  YP DV++TR         A  S      + D +  I   E
Sbjct: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71

Query: 158 GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGF 217
           G M  + G  S M+      A+ F   +    F +    +   +     ++ L+G  +G 
Sbjct: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDE---FIKLWKSVFGTKQLTQQISVLSGASAGI 128

Query: 218 TSKLATFPLDTVRRRIQIRNS 238
           T  L   P + V+ R+Q  NS
Sbjct: 129 TEALVIVPFELVKIRLQDVNS 149

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269
           +AG I+G +  +  +PLD V+ R+Q++ S           K +               +V
Sbjct: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ---------IV 68

Query: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           ++EGP+ +Y+G++  ++   P  A+   S + F
Sbjct: 69  KKEGPMHMYKGISSPMLMEAPKRAVKFASNDEF 101

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---------VTPHNKNANVLINIL 59
           K ++  T N L AG + G F      P D VK ++Q         V  +N     ++ I 
Sbjct: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGA 84
             EG R  +KG VP  ++ +  GGA
Sbjct: 263 HEEGFRALYKGFVP-KVLRLGPGGA 286

>Scas_558.2
          Length = 289

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 79/190 (41%), Gaps = 17/190 (8%)

Query: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREG---- 63
           R    V T   ++A S+  L A     P + +K + QV   N +      ILK E     
Sbjct: 92  RSPHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGI 151

Query: 64  IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL------NISPQLYSCLVGSLA 117
           IR  ++G     +  I +   QF  Y     F++    L      ++ P     + GS+A
Sbjct: 152 IRNLYRGWSTTIMREIPFTCIQFPLY----EFMKKEWALYDNEVGHLKP-WKGAICGSIA 206

Query: 118 GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           G  ++  + P D L+TR   N     I ++  I  I+  EG   FFSG     + I    
Sbjct: 207 GGIAAATTTPLDFLKTRLMLNKDS--IPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGG 264

Query: 178 AIMFGVYESI 187
           AI  GVYE++
Sbjct: 265 AIFLGVYETM 274

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 86/200 (43%), Gaps = 37/200 (18%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           S L G+ AG ++ L  +P D L+TR  A                + + G  G + G GS+
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG------------GFFQNGGYHGIYRGLGSA 56

Query: 170 MINIGLNTAIMFGVYESIKI----FTEERSKLSDRRDPF---TLLNELAGPISGFTSKLA 222
           ++    + ++ F  Y+S+K+      E     S  R P    T+++ +A  +    + L 
Sbjct: 57  VVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAACLV 116

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL-SLYRGV 281
             P + +++R Q+ ++ +  +  R   K+                   QEG + +LYRG 
Sbjct: 117 RVPAEVIKQRTQVHSTNSSWQTFRTILKN-----------------ENQEGIIRNLYRGW 159

Query: 282 TMSLIKSVPSTAISLWSYEL 301
           + ++++ +P T I    YE 
Sbjct: 160 STTIMREIPFTCIQFPLYEF 179

 Score = 32.3 bits (72), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 46/252 (18%), Positives = 100/252 (39%), Gaps = 33/252 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SL++G+ +G        P+DT+K +LQ               +  G  G ++G       
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG---------GFFQNGGYHGIYRGLGSAVVA 59

Query: 71  NVP-GSIMYIIYGGAQFGSYTYIGSFLR--GGLDLNISPQLYSCLVGSLAGMTSSLASYP 127
           + P  S+ ++ Y   +     ++   +   G    +    +   +  S+  + + L   P
Sbjct: 60  SAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAACLVRVP 119

Query: 128 FDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLM-GFFSGCGSSMINIGLNTAIMFGVYES 186
            +V++ R   +S     +    I+   + EG++   + G  ++++     T I F +YE 
Sbjct: 120 AEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEF 179

Query: 187 IK----IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242
           +K    ++  E   L   +        + G I+G  +   T PLD ++ R+ +     + 
Sbjct: 180 MKKEWALYDNEVGHLKPWK------GAICGSIAGGIAAATTTPLDFLKTRLMLN---KDS 230

Query: 243 RHDREFTKDIYK 254
              +   ++IYK
Sbjct: 231 IPIKSLIRNIYK 242

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 40/95 (42%), Gaps = 29/95 (30%)

Query: 206 LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
           +++ L+G  +G ++ L  FP+DT++ R+Q +                             
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKG---------------------------- 38

Query: 266 ISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
               Q  G   +YRG+  +++ S PS ++   +Y+
Sbjct: 39  -GFFQNGGYHGIYRGLGSAVVASAPSASLFFVTYD 72

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 129/320 (40%), Gaps = 55/320 (17%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV--------LINILKR 61
           +E  S     VAG  SG+   T   P DTVK++LQ +     A +        +   LK 
Sbjct: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63

Query: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGS-YTYIGSFLRGGLDLNISPQ-----LYSCLV-G 114
           +GIRG + G  P    +I+   A  GS + Y     R  L   + P+     L  C++ G
Sbjct: 64  QGIRGLYLGFTPPLFGWIMMDSALLGSLHNY-----RMLLHKYVYPEHDKLPLSGCIISG 118

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAI-------WSHEGLMG----FF 163
            +AG T S  + P ++ + +       +  K    I  +        +  G++G     +
Sbjct: 119 VMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178

Query: 164 SGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG-FTSKLA 222
            G  S++I    N    +G YE I  + ++ + LS        +N  AG +S  F    +
Sbjct: 179 KGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSA-----PAINFWAGGLSASFGFWTS 232

Query: 223 TFPLDTVRRRIQIRNSPNEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            +P D V++ +   +  +   +  R    DIY+                Q G    ++G 
Sbjct: 233 AYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYR----------------QRGIHGFFKGF 276

Query: 282 TMSLIKSVPSTAISLWSYEL 301
             S ++S P+ A +L ++E 
Sbjct: 277 LPSFLRSFPANAAALAAFEF 296

>Kwal_27.11626
          Length = 299

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (42%), Gaps = 26/182 (14%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           S  AGSL G+     + PLD +KIK Q  P +      I ILK EG  G ++G       
Sbjct: 121 SATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFKGRGFIKILKDEGF-GLYRGWGWTAAR 178

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           N PGS  + ++GG  F     +G  L+       S    S +VG+ A +   + S P DV
Sbjct: 179 NAPGS--FALFGGNAFAKEYILG--LKDYSSATWSQNFVSSIVGASASL---IVSAPLDV 231

Query: 131 LRTR-----FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           ++TR     F     G  I     +     +EG+  FF G    ++  G      F + +
Sbjct: 232 IKTRIQNRHFDNPESGFRI-----VQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 286

Query: 186 SI 187
           S+
Sbjct: 287 SL 288

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 71/189 (37%), Gaps = 25/189 (13%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           L S   GSL G+   +   P DVL+ +   N +    K R   + I   EG  G + G G
Sbjct: 119 LRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPES--FKGRG-FIKILKDEGF-GLYRGWG 173

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
            +      N    F ++       E    L D        N ++  +    S + + PLD
Sbjct: 174 WTAAR---NAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLD 230

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
            ++ RIQ R+  N E   R                 +  + ++ EG  + ++G+T  L+ 
Sbjct: 231 VIKTRIQNRHFDNPESGFR-----------------IVQNTLKNEGITAFFKGLTPKLLT 273

Query: 288 SVPSTAISL 296
           + P    S 
Sbjct: 274 TGPKLVFSF 282

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 135/310 (43%), Gaps = 56/310 (18%)

Query: 31  TCIAPLDTVKIKLQ----------------------VTPHNKNANVLINILKREGIRGFW 68
           TC  P D VK +LQ                      +    +   ++ N+  +EG R  +
Sbjct: 67  TC--PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLF 124

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128
           KG  P  +  I      F +Y          L+          L G+ AG  +S A+ P 
Sbjct: 125 KGLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPI 184

Query: 129 DVLRTRF----AANSQGQLIKLR-DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
            +++TR     AA+ + +  K   D +  +  +EG++G + G  +S +   + + + + +
Sbjct: 185 WLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLG-SVESILQWVL 243

Query: 184 YESIKIFTEERS-----KLSDR-RDPFTLLNEL------AGPISGFTSKLATFPLDTVRR 231
           YE +K    +RS      +S+  +  +  + E       AG    F S L T+P + VR 
Sbjct: 244 YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASIL-TYPHEVVRT 302

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291
           R+  R +P +E    ++T  +++S+           ++++EG  S+Y G+T  L+++VP+
Sbjct: 303 RL--RQAP-KENGKLKYT-GLFQSFS---------LIIKEEGFASMYSGLTPHLMRTVPN 349

Query: 292 TAISLWSYEL 301
           + I   ++EL
Sbjct: 350 SIIMFGTWEL 359

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 80/194 (41%), Gaps = 25/194 (12%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTP--------HNKNANVLINILKREGIRGFWKG 70
            +AG+ +G    T   P+  VK +LQ+          +  + + L  +++ EGI G +KG
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKG 226

Query: 71  -------NVPGSIMYIIYGGAQF----GSYTYIGSFLRGGLDLNISPQLYSCLVGSL--A 117
                  +V   + +++Y   +      S    G          +  + +    GS   A
Sbjct: 227 LSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAA 286

Query: 118 GMTSSLASYPFDVLRTRF--AANSQGQL--IKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
            + +S+ +YP +V+RTR   A    G+L    L      I   EG    +SG    ++  
Sbjct: 287 KLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRT 346

Query: 174 GLNTAIMFGVYESI 187
             N+ IMFG +E +
Sbjct: 347 VPNSIIMFGTWELV 360

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 82/190 (43%), Gaps = 21/190 (11%)

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           L G+  G+   L   PFD+ + R    S G    + D + ++  +EG++GF+ G  + ++
Sbjct: 28  LSGTAGGIAQVLVGQPFDITKVRMQ-TSAGSATAV-DVVTSLIKNEGILGFYKGTLAPLV 85

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPLDTVR 230
            +G   +  FGV E++K     R    D   P +L    + G  SG  +     P++ VR
Sbjct: 86  GVGACVSCQFGVNEAMK--RRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVR 143

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
            R+Q++                 KS  N  + G    M +     +L RG T +L+++  
Sbjct: 144 IRLQLQT----------------KSLANAEYQGSLDCMRKLLKQGALMRGFTATLMRTCH 187

Query: 291 STAISLWSYE 300
              I   +YE
Sbjct: 188 GFGIYFSTYE 197

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 119/303 (39%), Gaps = 48/303 (15%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGS 75
             +++G+  G+       P D  K+++Q +  +  A +V+ +++K EGI GF+KG +   
Sbjct: 25  KDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATAVDVVTSLIKNEGILGFYKGTLAPL 84

Query: 76  IMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-------QLYSCLVGSLAGMTSSLASYPF 128
           +        QFG    +    R    +N  P       Q Y C V S  G  ++  + P 
Sbjct: 85  VGVGACVSCQFGVNEAMKRRFR---RMNGDPSKPLSLKQYYVCGVAS--GCANAFLATPI 139

Query: 129 DVLRTRFA--------ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
           + +R R          A  QG L    D +  +     LM  F+   ++++       I 
Sbjct: 140 EHVRIRLQLQTKSLANAEYQGSL----DCMRKLLKQGALMRGFT---ATLMRTCHGFGIY 192

Query: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN--S 238
           F  YE+  +   +  K   R+D       + G  SG       +P+D V+  +Q     S
Sbjct: 193 FSTYEA--LIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVS 250

Query: 239 PNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298
           P    +  +  K IY +   R F+                +G   ++++S+P    +  +
Sbjct: 251 PVHGTNVWQVAKSIYTTRGKRAFI----------------KGFMPAMLRSLPVNGATFAT 294

Query: 299 YEL 301
           +E+
Sbjct: 295 FEM 297

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 126/277 (45%), Gaps = 33/277 (11%)

Query: 43  LQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLD 101
           +Q   H K    ++ N+ K+EG R  +KG  P  +  I      F +Y           +
Sbjct: 110 IQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFN 169

Query: 102 LNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG-----QLIKLRDEIMAIWSH 156
                 +   +  + AG  ++ A+ P  +++TR   +  G     Q     D + ++  +
Sbjct: 170 NGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRN 229

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERS------------KLSDRRDPF 204
           EG  G + G  +S +   +   + + +YE +K   +ERS              S++   +
Sbjct: 230 EGFTGLYKGLSASYLG-SVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEW 288

Query: 205 TLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGV 264
              +  AG ++ F + +AT+P + VR R+  R +P +E   R++T  + +S+K       
Sbjct: 289 CQRSGSAG-LAKFVASIATYPHEVVRTRL--RQTP-KENGKRKYT-GLVQSFK------- 336

Query: 265 GISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
              ++++EG  S+Y G+T  L+++VP++ I   ++E+
Sbjct: 337 --VIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEI 371

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 17/163 (10%)

Query: 42  KLQVTPHNKNANVLINILKREGIRGFWKG-------NVPGSIMYIIYGGAQF----GSYT 90
           K  V  +  + + L ++++ EG  G +KG       +V G + +++Y   +      S  
Sbjct: 210 KTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIE 269

Query: 91  YIGSFLRGGLDLNISPQLYSCLVGS--LAGMTSSLASYPFDVLRTRF----AANSQGQLI 144
             G    G    +   + +    GS  LA   +S+A+YP +V+RTR       N + +  
Sbjct: 270 KFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYT 329

Query: 145 KLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
            L      I   EGL   +SG    ++    N+ IMFG +E +
Sbjct: 330 GLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372

>Scas_328.1
          Length = 227

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 27  LFARTCIAPL--DTVKIKLQVTPHNKNANVLINILKR----EGIRGFWKGNVPGSIMYII 80
           LF R C   +  D   IK   +   +  N ++++ K+    +G+ G ++G +P  +  ++
Sbjct: 55  LFLRLCKNEIGSDAKSIK---SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMV 111

Query: 81  YGGAQFGSYTYIGS-FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANS 139
           Y G  FG Y  +    L G  +    P   S L+G    +++S  SYP D +R R    S
Sbjct: 112 YRGLYFGLYDSLKPVLLTGSFENAFLP---SFLLGWAVTISASTTSYPLDTVRRRMMMTS 168

Query: 140 QGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEER 194
            GQ +K +   D    I S EG+   F GCG+++   G+  A +  +Y+ +++    R
Sbjct: 169 -GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR-GVAAAGVISLYDQLQLLLFGR 224

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 64/138 (46%), Gaps = 20/138 (14%)

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG 216
           +G++G + G   S++ I +   + FG+Y+S+K        L+   +   L + L G    
Sbjct: 93  DGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVL-----LTGSFENAFLPSFLLGWAVT 147

Query: 217 FTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLS 276
            ++   ++PLDTVRRR+ + +                ++ K +  +     +V QEG  S
Sbjct: 148 ISASTTSYPLDTVRRRMMMTSG---------------QAVKYKGAIDCFQQIVSQEGVYS 192

Query: 277 LYRGVTMSLIKSVPSTAI 294
           L++G   ++ + V +  +
Sbjct: 193 LFKGCGANIFRGVAAAGV 210

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 79/181 (43%), Gaps = 24/181 (13%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           S  AGS+ G+     + PLD +KIK Q  P        + ILK EG+ G ++G       
Sbjct: 121 SATAGSMIGI-GEIVLLPLDVLKIKRQTNPEAFKGRGFVKILKDEGL-GLYRGWGWTAAR 178

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           N PGS  + ++GG  F     +G  L+       S    S +VG+ A +   + S P DV
Sbjct: 179 NAPGS--FALFGGNAFAKEYILG--LKDYSQATWSQNFVSSIVGASASL---IISAPLDV 231

Query: 131 LRTRFA----ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYES 186
           ++TR       N +     +++ +     +EG   FF G    ++  G      F + ++
Sbjct: 232 IKTRIQNKNFENPESGFTIVKNTL----KNEGFSAFFKGLTPKLLTTGPKLVFSFALAQT 287

Query: 187 I 187
           +
Sbjct: 288 L 288

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 72/189 (38%), Gaps = 25/189 (13%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           L S   GS+ G+   +   P DVL+ +   N +    K R   + I   EGL G + G G
Sbjct: 119 LRSATAGSMIGI-GEIVLLPLDVLKIKRQTNPEA--FKGRG-FVKILKDEGL-GLYRGWG 173

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
            +      N    F ++       E    L D        N ++  +    S + + PLD
Sbjct: 174 WTAAR---NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLD 230

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
            ++ RIQ +N  N E          +   KN          ++ EG  + ++G+T  L+ 
Sbjct: 231 VIKTRIQNKNFENPESG--------FTIVKN---------TLKNEGFSAFFKGLTPKLLT 273

Query: 288 SVPSTAISL 296
           + P    S 
Sbjct: 274 TGPKLVFSF 282

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 79/187 (42%), Gaps = 17/187 (9%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           S  AGSL G+     + PLD +KIK Q  P +      + I+K EG  G ++G       
Sbjct: 122 SATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFKGRGFLKIIKDEGF-GLYRGWGWTAAR 179

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           N PGS  + ++GG  F     +G  L+       S    S +VG+ A +   + S P DV
Sbjct: 180 NAPGS--FALFGGNAFAKEYILG--LKDYGQATWSQNFVSSIVGASASL---IVSAPLDV 232

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYES-IKI 189
           ++TR    +          I     +EG   FF G    ++  G      F + ++ I I
Sbjct: 233 IKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQTLIPI 292

Query: 190 FTEERSK 196
           F    SK
Sbjct: 293 FDNLVSK 299

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 81  YGGAQFGSYTYIGSFLRGGLDLNISPQ----LYSCLVGSLAGMTSSLASYPFDVLRTRFA 136
           YGG  F +  ++    +G  D     +    L S   GSL G+   +   P DVL+ +  
Sbjct: 90  YGGQPFAN-EFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGI-GEIVLLPLDVLKIKRQ 147

Query: 137 ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSK 196
            N +    K R   + I   EG  G + G G +      N    F ++       E    
Sbjct: 148 TNPES--FKGRG-FLKIIKDEGF-GLYRGWGWTAAR---NAPGSFALFGGNAFAKEYILG 200

Query: 197 LSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSY 256
           L D        N ++  +    S + + PLD ++ RIQ RN  N E          +K  
Sbjct: 201 LKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG--------FKII 252

Query: 257 KNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296
           KN          ++ EG  + ++G+T  L+ + P    S 
Sbjct: 253 KN---------TLKNEGFTAFFKGLTPKLLTTGPKLVFSF 283

>Kwal_55.21338
          Length = 323

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 117/282 (41%), Gaps = 51/282 (18%)

Query: 31  TCIAPLDTVKIKLQVTPHNKN----ANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQF 86
           T   PL  V  KLQ           A+ + +I +++G  GF+ G             A F
Sbjct: 38  TLTYPLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAG----------LESALF 87

Query: 87  GS--------YTYIGS---FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRF 135
           G+        Y Y  S    LR      ++    S LVGS+AG  ++ A+ P  V  TR 
Sbjct: 88  GTTLSNFVYYYCYEASSRCVLRARHTQRLTTA-ESMLVGSIAGSLNATAANPLWVANTRM 146

Query: 136 AA--NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFT 191
               + +G L  + D    I   EG+ G F G   ++I + +N  I + VYE +K  I +
Sbjct: 147 TVQKSDRGTLSTIFD----IVKDEGISGLFKGLNPALILV-INPIIQYTVYEQLKNWILS 201

Query: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251
             +++       F L     G +    +  +T+P  T++ R+ +                
Sbjct: 202 SRQTRTLSPSWAFIL-----GAVGKLAATGSTYPYVTMKARMHLLGEHKSS--------- 247

Query: 252 IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
              +   R  L +   +++++G L LYRG+ + L++S+ + A
Sbjct: 248 --TAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAA 287

>Kwal_56.23011
          Length = 303

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/292 (20%), Positives = 120/292 (41%), Gaps = 30/292 (10%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTP-HNKNANVLINILKREGIRGFWKGNVPGSIM 77
           +  G++ G+       P D  K++LQ +P     A V+ +++K EG+  F+KG +     
Sbjct: 27  VFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAG 86

Query: 78  YIIYGGAQFGSYTYIGSFLR---GGLDLNIS-PQLYSCLVGSLAGMTSSLASYPFDVLRT 133
                  QFG    +  + R   G  D  ++  Q Y+C  G ++G  ++  + P + +R 
Sbjct: 87  VGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYAC--GFVSGTANAFLATPIEHVRI 144

Query: 134 RF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
           R     A++S  +     D    +     LM  F+   ++ +       I F  YE++  
Sbjct: 145 RLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFT---ATTLRTSHGFGIYFLTYETLIA 201

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFT 249
                  L +    + +   + G  SG      T+P D V+  +Q     N         
Sbjct: 202 NQAHHGVLRENIPAWKVC--VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNP-------- 251

Query: 250 KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
             +Y     R  L V  ++ ++ GP +  +G T ++++S+P    +  ++E+
Sbjct: 252 --VY----GRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEI 297

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 18/189 (9%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-------NVLINILKRE 62
           D+ ++       G +SG        P++ V+I+LQ+   + +A       +    +LK+ 
Sbjct: 113 DQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQG 172

Query: 63  GI-RGFWKGNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
            + RGF    +  S  + IY    F +Y T I +    G+     P    C+ G+ +G  
Sbjct: 173 ALMRGFTATTLRTSHGFGIY----FLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAF 228

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLRDEIM---AIWSHEGLMGFFSGCGSSMI-NIGLN 176
               +YPFDV+++   A+     +  R+ +    AI+   G   F  G   +M+ ++ +N
Sbjct: 229 FWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVN 288

Query: 177 TAIMFGVYE 185
            A  F  +E
Sbjct: 289 GAT-FAAFE 296

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKI-----KLQVTPHNKNANVLI 56
           N+  H    E +      V G+ SG F      P D VK      KL+   + +N   + 
Sbjct: 202 NQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVA 261

Query: 57  NILKRE-GIRGFWKGNVPGSIMYIIYGGAQFGSY 89
             + RE G R F KG  P  +  +   GA F ++
Sbjct: 262 KAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAF 295

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 122/287 (42%), Gaps = 31/287 (10%)

Query: 35  PLDTVKIKLQVTPHNKNANV------LINILKREGIRGFWKGNVPGSIMYIIYGGA--QF 86
           PL T+  KLQ   +++N  V      +  I +++G+ GF+ G     +   IYG A   F
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAG-----LESAIYGMALTNF 87

Query: 87  GSYTYIGSFLRGGLDLNISPQL---YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQL 143
             Y +     R  L +    +L    S L G +AG  +++AS P  V  TR       + 
Sbjct: 88  VYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEK- 146

Query: 144 IKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDP 203
                 I+ I   +     F+G   +++ + +N  + + V+E +K      +K       
Sbjct: 147 -TALATIIEIVKKDSAKTLFNGLKPALVLV-MNPIVQYTVFEQLKNLVLAWNKQGILSPS 204

Query: 204 FTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLG 263
           +  L    G +    +  +T+P  T++ R+ +  S      D       +K+  ++  L 
Sbjct: 205 WAFL---LGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKA-SSKSMLS 260

Query: 264 VGISMVQQEGPLSLYRGVTMSLIKSVPSTA--------ISLWSYELF 302
           +   +V+++G   LYRGV + L +S+ + A        + LWS ++ 
Sbjct: 261 LITEIVKKDGVSGLYRGVGIKLAQSILTAAFLFFFKEGLVLWSIKVL 307

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/211 (18%), Positives = 93/211 (44%), Gaps = 24/211 (11%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIR 65
           +RK ++++T  S++ G ++G        P+     ++ VT   K A   +I I+K++  +
Sbjct: 103 VRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTALATIIEIVKKDSAK 162

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125
             + G  P  ++ ++    Q+  +  + + +       I    ++ L+G+L  + ++ ++
Sbjct: 163 TLFNGLKPALVL-VMNPIVQYTVFEQLKNLVLAWNKQGILSPSWAFLLGALGKLAATGST 221

Query: 126 YPFDVLRTRFAANSQGQ-------------------LIKLRDEIMAIWSHEGLMGFFSGC 166
           YP+  L+TR   +  G+                   ++ L  EI+     +G+ G + G 
Sbjct: 222 YPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIV---KKDGVSGLYRGV 278

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKL 197
           G  +    L  A +F   E + +++ +  KL
Sbjct: 279 GIKLAQSILTAAFLFFFKEGLVLWSIKVLKL 309

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 125 SYPFDVLRTRFAA--NSQGQLIKLRDE-IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           +YP   + T+     N +   +K + E I  I+  +GL+GF++G  S++  + L   + +
Sbjct: 31  TYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYY 90

Query: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNS 238
             YE   + +    K+   +   TL + L G ++G  + +A+ P+     R+ +  S
Sbjct: 91  YFYE---LTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKS 144

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 97/239 (40%), Gaps = 56/239 (23%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKL--------------------QVT 46
           L KD  +S    L+AG+L+G     CI P + VK+ +                    QV 
Sbjct: 93  LAKDAPLSGVQLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVA 152

Query: 47  ---------------------PHNKNANVLIN---ILKREGIRGFWKGNVPGSIMYIIYG 82
                                P     NVL     + ++ G+R ++KG +P  +  +   
Sbjct: 153 NEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNS 212

Query: 83  GAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQ 142
             +F ++T +  F       N   + ++ L+G ++      A+ P DV++TR  A  +  
Sbjct: 213 VVRFTTFTMLKQFAPKEYQNN---EYFATLLGLISSCAVVGATQPLDVIKTRMQA--KDS 267

Query: 143 LIKLRDEIMA---IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE----SIKIFTEER 194
           ++  R+ I     I+  EG    + G    ++ +GL+ ++ FG+Y+     I +  +ER
Sbjct: 268 VLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIALMRQER 326

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 104/265 (39%), Gaps = 55/265 (20%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMY 78
           + AGS+SGLF+ T   P + +K  LQ+   N  A     +L  + +R ++ G    +I  
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQLH-RNVVAAKPFEVLGYQ-VRTYFAGCSAVNIGV 70

Query: 79  IIYGGAQFGSYTYIGSFLRGGLDLNISP----QLYSCLVGSLAGMTSSLASYPFDVLRTR 134
           ++    +F ++     +LR       +P    QL   + G+L G   SL   PF+ ++  
Sbjct: 71  VMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQL--LMAGALTGTMESLCIIPFENVKVA 128

Query: 135 FAANS--------------QGQLI-----------------------KLRDEIMA----I 153
              NS              QGQ+                        KL   ++     +
Sbjct: 129 MIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAEL 188

Query: 154 WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGP 213
           +   GL  +F G   +++    N+ + F  +  +K F  +  + ++          L G 
Sbjct: 189 YRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNE------YFATLLGL 242

Query: 214 ISGFTSKLATFPLDTVRRRIQIRNS 238
           IS      AT PLD ++ R+Q ++S
Sbjct: 243 ISSCAVVGATQPLDVIKTRMQAKDS 267

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 83/193 (43%), Gaps = 9/193 (4%)

Query: 5   DHLRKDEEVSTTNSLVAGS--LSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILK 60
           D L  D+ V+  NS+  GS  ++  FA   + PL+  +I+L   P   N  V     ILK
Sbjct: 99  DVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRILK 158

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQF-----GSYTYIGSFLRGGLDLNISPQLYSCLVGS 115
            EG   F+ G  P     I Y  A+F      +  Y G           S    + L G 
Sbjct: 159 EEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGL 218

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            AG+ +++ S P D L ++     +         +  +    G +G F+G  + ++ +G 
Sbjct: 219 TAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGT 278

Query: 176 NTAIMFGVYESIK 188
            T++ FG+Y S+K
Sbjct: 279 LTSLQFGIYGSLK 291

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 74/200 (37%), Gaps = 18/200 (9%)

Query: 101 DLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLM 160
           D ++S      L G++   T+  A  P DV++TR           +      I S EG  
Sbjct: 7   DYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAG 66

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
              +G G +++   L  +  FG YE  K    +        +    +   +  I+ F + 
Sbjct: 67  ALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFAD 126

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRG 280
           +A  PL+    RI++ + P        F   +   +           ++++EG  S Y G
Sbjct: 127 IALCPLEAT--RIRLVSQPT-------FANGLVGGFSR---------ILKEEGAGSFYNG 168

Query: 281 VTMSLIKSVPSTAISLWSYE 300
            T  L K +P        +E
Sbjct: 169 FTPILFKQIPYNIAKFLVFE 188

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 96/234 (41%), Gaps = 16/234 (6%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---ILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   N  ++ +   I+  EG      G  P  +
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 77  MYIIYGGAQFGSYTYIGSFLRG--GLDLNISPQLYSCLVGS--LAGMTSSLASYPFDVLR 132
            Y + G  +FG Y           G D  ++ +  S  +GS  +A   + +A  P +  R
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYK-NSIYIGSAAIAEFFADIALCPLEATR 136

Query: 133 TRFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYESIK-- 188
            R    SQ      L      I   EG   F++G    +   I  N A  F V+E     
Sbjct: 137 IRLV--SQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIA-KFLVFERAAEV 193

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI-QIRNSPNE 241
            F     K S      T +N L+G  +G  + + + P DT+  ++ + + +P +
Sbjct: 194 YFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQ 247

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 124/316 (39%), Gaps = 55/316 (17%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWK 69
            E+   T  L+ G   GL +   + P D +K +LQ    +K + +   +   E     W+
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQ---QDKTSTLWKTLKSIETPSQLWR 58

Query: 70  GNVP-------GSIMYI---------IYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV 113
           G +P       GS MY+         I  G   GS     S+L     LN+   ++S   
Sbjct: 59  GALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTG--SSYLP---QLNMYENMFS--- 110

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
           G++    + L + P  V++ R+ + +  Q   LR     I+  EGL GFF G G++ +  
Sbjct: 111 GAVTRALTGLITMPITVIKVRYES-TLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRD 169

Query: 174 GLNTAIMFGVYESIKIFT-----EERSKLSDRRDPFTLLNELAGPISGFTSKL----ATF 224
                +    Y+ +K+           KL+      T  + L    S F++ +     T 
Sbjct: 170 APYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITA 229

Query: 225 PLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMS 284
           P DTV+ R+Q+     E      FT   +              +  +E   +L+ G+++ 
Sbjct: 230 PFDTVKTRMQL-----EPAKFHSFTSTFWH-------------IATKESVRNLFAGISLR 271

Query: 285 LIKSVPSTAISLWSYE 300
           L +   S  I+   YE
Sbjct: 272 LTRKAFSAGIAWGIYE 287

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 74/185 (40%), Gaps = 25/185 (13%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILKREGIRGFWKGNVPGSIM 77
           V  +L+GL       P+  +K++ + T +   +      +I + EG+RGF++G    ++ 
Sbjct: 113 VTRALTGLIT----MPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALR 168

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNI----SPQLYSCLVGSL--------AGMTSSLAS 125
              Y G     Y  +   +   L  N+    S   YS    +L        A + ++  +
Sbjct: 169 DAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSIT 228

Query: 126 YPFDVLRTRFAANSQGQLIKLRDEIMAIW---SHEGLMGFFSGCGSSMINIGLNTAIMFG 182
            PFD ++TR     Q +  K        W   + E +   F+G    +     +  I +G
Sbjct: 229 APFDTVKTRM----QLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWG 284

Query: 183 VYESI 187
           +YE I
Sbjct: 285 IYEEI 289

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 121/290 (41%), Gaps = 28/290 (9%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77
           L+AG+  G+       P DT K++LQ +  + NA  V+ +++K EG  GF+KG +   + 
Sbjct: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVG 86

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQL-----YSCLVGSLAGMTSSLASYPFDVLR 132
                  QFG    +  F     D   S  L     Y C  G   G T+S  + P + +R
Sbjct: 87  VGACVSLQFGVNEAMKRFFH-TFDEAASQHLSLLQYYIC--GVAGGFTNSFLASPIEHIR 143

Query: 133 TRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFT 191
            R    +  G   + +  I  I           G   +M+       + F  YE++ I  
Sbjct: 144 IRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEAL-IGH 202

Query: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251
           + +S +  +  P   L  L G  SG       +PLD ++  +Q  N              
Sbjct: 203 QVKSGIQRKDIPAWKLC-LFGAASGTLLWTMVYPLDVIKSVMQTDN-------------- 247

Query: 252 IYKSYKN-RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
             K+ KN    L VG +++ ++G   L++G   +++++ P+ A +  ++E
Sbjct: 248 -LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFE 296

>Kwal_26.7967
          Length = 297

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 107/248 (43%), Gaps = 20/248 (8%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILKREGI 64
           + + ++V   +S +AGSL+G    +   P +  K +LQ+   +  A  N L  I +   +
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKV 60

Query: 65  RGFWKGNVPGSIMYII----YGGAQFGSYTYIGSFLRGGLDLNIS-PQLYSCLVGSLAGM 119
           +G     V G   +I+      G +F  +  I + LR      +S P+    + G  AG+
Sbjct: 61  QGLGAVYV-GCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPR--GIVAGLGAGL 117

Query: 120 TSSL-ASYPFDVLRTRFAANSQGQLIK--------LRDEIMAIWSHEGLMGFFSGCGSSM 170
             S+ A  PF+ ++T    + Q    K        LR+    ++  +G  G + G     
Sbjct: 118 LESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVY-DKGFSGLYRGVLPVS 176

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
           +    N A+  G Y  IK   ++ +  +  +   + +  + G  SG  +   T P+DTV+
Sbjct: 177 MRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVK 236

Query: 231 RRIQIRNS 238
            R+Q  +S
Sbjct: 237 TRMQSLDS 244

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 85/193 (44%), Gaps = 16/193 (8%)

Query: 12  EVSTTNSLVAGSLSGLF-ARTCIAPLDTVKIKL-----QVTP--HNKNANVLIN---ILK 60
           E+S    +VAG  +GL  +   + P + +K  L       +P  HN    +L N   ++ 
Sbjct: 102 ELSGPRGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVY 161

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSY----TYIGSFLRGGLDLNISPQLYSCLVGSL 116
            +G  G ++G +P S+        + G Y    T I  +     D  +S  + + +VG+ 
Sbjct: 162 DKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGM-TFVVGAF 220

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLN 176
           +G+ +   + P D ++TR  +    +     +    ++  EGL  F+ G    +  + L+
Sbjct: 221 SGIVTVYTTMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILS 280

Query: 177 TAIMFGVYESIKI 189
             I+F +YE + +
Sbjct: 281 GGIVFTIYEKVLV 293

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 120/306 (39%), Gaps = 48/306 (15%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-------------NVLINIL 59
           +++  S   G+++   A T + PLD  K  +Q    N ++             + +I I 
Sbjct: 1   MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIF 60

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS----FLRGGLDLNISPQ------LY 109
           K+ G  G ++G         +     F  Y+ I S    F  G L L    +      + 
Sbjct: 61  KKRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIE 120

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIW--SHEGLMGFFSGCG 167
              +G  AG  + + + P  V+ TR      G+   L+  I  I+  S+  L  F+ G  
Sbjct: 121 ELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFK 180

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLL----NELAGPISGFTSKLAT 223
            +++ +  N AI +G Y+ +K        LS  +   T L    N L G  S   S   T
Sbjct: 181 VALV-LSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVT 239

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            PL  +  +I ++   ++ +  +E  + IY                Q EG LSL++GV  
Sbjct: 240 QPL--IVAKITLQGKGSKFKTFQEVLQHIY----------------QNEGFLSLWKGVIP 281

Query: 284 SLIKSV 289
            + K V
Sbjct: 282 QVSKGV 287

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--TPHNKNANVLINILKREGIRGFWK 69
           ++S   + + G  S + +     PL   KI LQ   +       VL +I + EG    WK
Sbjct: 218 QLSAGENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWK 277

Query: 70  GNVP 73
           G +P
Sbjct: 278 GVIP 281

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 95/240 (39%), Gaps = 27/240 (11%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK--------REGIRGFW 68
           +  +AG + G+   + +  LDTVK + Q  P+      ++   +        R G+ G +
Sbjct: 55  HCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGY 114

Query: 69  KGNVPGSI--MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126
              + GS     I +   +F   T I        D +++        G L    SS    
Sbjct: 115 CAAMLGSFPSAAIFFSTYEFTKRTMIN-------DYHLNDTFSHLTAGFLGDFFSSFVYV 167

Query: 127 PFDVLRTRFAA---------NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
           P +VL+TR            NS      LR+ I  I+  EG+   F G  +++      +
Sbjct: 168 PSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFS 227

Query: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-GPISGFTSKLATFPLDTVRRRIQIR 236
           A+ F  YE  + +          +   ++ NE+  G  +G  + + T PLD V+ R+Q +
Sbjct: 228 ALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQ 287

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 22/148 (14%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQV-----TPHNKNA-------NVLINILKRE 62
           T + L AG L   F+     P + +K +LQ+      PH  +        N +  I + E
Sbjct: 148 TFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTE 207

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYI--GSFLRGG-----LDLNISPQLYSCLVGS 115
           G+   + G        + +   QF  Y      +FL  G      DL+IS ++   + G+
Sbjct: 208 GVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEI---VTGA 264

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQL 143
            AG  + + + P DV++TR       Q+
Sbjct: 265 CAGGLAGILTTPLDVVKTRVQTQLPSQI 292

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 17/93 (18%)

Query: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269
           LAG + G     A   LDTV+ R Q   +PN  ++     K + ++Y+         +M 
Sbjct: 58  LAGGVGGIIGDSAMHSLDTVKTRQQ--GAPNVHKY-----KHMLQAYR---------TMF 101

Query: 270 QQEG-PLSLYRGVTMSLIKSVPSTAISLWSYEL 301
            +EG    LY G   +++ S PS AI   +YE 
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEF 134

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 212 GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQ 271
           G ISG  ++   +P D +RRR Q+      E   R      YKS  +       I++ + 
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFR------YKSVSDAL-----ITIGKT 65

Query: 272 EGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           EGP   Y+G+T +L K +PSTA+S   YE+
Sbjct: 66  EGPKGYYKGLTANLFKVIPSTAVSWLVYEV 95

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 101 DLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG------QLIKLRDEIMAIW 154
           D N++  LY   +G+++G  +    YPFD+LR RF   + G      +   + D ++ I 
Sbjct: 5   DPNLA-NLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIG 63

Query: 155 SHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
             EG  G++ G  +++  +  +TA+ + VYE I+
Sbjct: 64  KTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIR 97

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 10 DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN---------ANVLINILK 60
          D  ++    L  G++SG  A+T + P D ++ + QV     N         ++ LI I K
Sbjct: 5  DPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGK 64

Query: 61 REGIRGFWKG 70
           EG +G++KG
Sbjct: 65 TEGPKGYYKG 74

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 122/304 (40%), Gaps = 43/304 (14%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVP 73
           T   + +G++ G+       P D +K++LQ  P N  A   + +++K EG  GF+KG + 
Sbjct: 24  TLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLVKYEGFMGFYKGTMA 83

Query: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS----------PQLYSCLVGSLAGMTSSL 123
             +        QFG    +  + R   DLN S           Q Y+C  G ++G  ++L
Sbjct: 84  PLVGVGACVSCQFGINEAMKRYFR---DLNRSRGIYDNTLSLGQYYTC--GFVSGSANAL 138

Query: 124 ASYPFDVLRTRFA----ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAI 179
            + P + +R R      A +  +     D    +     LM  F+   ++++       I
Sbjct: 139 LATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFT---ATLMRTSHGFGI 195

Query: 180 MFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN-- 237
            F  YE+  +   + +    R D       + G +SG      T+P D V+  +Q     
Sbjct: 196 YFLTYET--LIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLV 253

Query: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
           +P    +  +  K+IY+                + G  +  +G   ++++S+P    +  
Sbjct: 254 NPAYGTNVVQVAKNIYR----------------ERGLRAFTKGFMPTMLRSLPVNGATFA 297

Query: 298 SYEL 301
           ++E+
Sbjct: 298 AFEV 301

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 6   HLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ----VTP-HNKN-ANVLINIL 59
           H  + E++S   + + G+LSG F      P D VK  +Q    V P +  N   V  NI 
Sbjct: 210 HGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIY 269

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSY 89
           +  G+R F KG +P  +  +   GA F ++
Sbjct: 270 RERGLRAFTKGFMPTMLRSLPVNGATFAAF 299

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 12/186 (6%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT--PHNKN-ANVLINILKREGIRGFWKGN 71
           T   L A + +   A   + P + +K+K Q T  P  KN       I   EG+ G +KG 
Sbjct: 112 TAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGI 171

Query: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGS-LAGMTSSLAS 125
            P     I Y   +F S+  I   +   L     +++ S Q+    VG  LAG+  ++ S
Sbjct: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231

Query: 126 YPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           +P DV+ ++  A+  QG+   + +    I+S  G  G ++G    +  IG  T+  + +Y
Sbjct: 232 HPADVMVSKVNADRKQGE--SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289

Query: 185 ESIKIF 190
           +S K +
Sbjct: 290 DSFKAY 295

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 80/199 (40%), Gaps = 22/199 (11%)

Query: 105 SPQLYS-CLVGSLAGMTSSLASY-PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGF 162
           SP+ Y+ C +G +     + +S  P D+++ R   N Q     L D    I   EGL   
Sbjct: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNL-DGWKTIVRSEGLSKV 69

Query: 163 FSGCGSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
           F+G G++ I   L  A  +G YE  K  ++   S  +  R   T +   A   + F + +
Sbjct: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHR-TAVYLCASASAEFLADI 128

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
              P + ++ + Q    P        F K+  + +           +   EG   LY+G+
Sbjct: 129 LLCPWEAIKVKQQTTIPP--------FCKNFLEGWSK---------ITAAEGLSGLYKGI 171

Query: 282 TMSLIKSVPSTAISLWSYE 300
           T    + +P T     S+E
Sbjct: 172 TPLWCRQIPYTMCKFTSFE 190

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 96/250 (38%), Gaps = 24/250 (9%)

Query: 21  AGSLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIRGFWKGNVPG 74
           A +L G+ A     + + PLD VK +LQV P  +  N +    I++ EG+   + G    
Sbjct: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76

Query: 75  SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ----LYSCLVGSLAGMTSSLASYPFDV 130
            I Y + G  ++G Y Y        L    + +    +Y C   S A   + +   P++ 
Sbjct: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS-AEFLADILLCPWEA 135

Query: 131 LRTRFAANSQGQLIKLRDEIMAIWSH----EGLMGFFSGCGSSMINIGLNTAIMFGVYES 186
           ++ +     Q  +       +  WS     EGL G + G           T   F  +E 
Sbjct: 136 IKVK----QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFER 191

Query: 187 I--KIFTE-ERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
           I   I+ +  RSK          ++ + G ++G    + + P D +  ++       E  
Sbjct: 192 IVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESM 251

Query: 244 HDREFTKDIY 253
              E +K IY
Sbjct: 252 --VEASKRIY 259

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 122/307 (39%), Gaps = 53/307 (17%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---------------VTPHNKNANV---LI 56
           T  S + G+++   A   + PLD  K  +Q               V P+ +  NV   +I
Sbjct: 3   TLESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMI 62

Query: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYI-GSFLRGGL---------DLNISP 106
           NI K +GI G ++G    ++   +     F  YT+I  S+++  L         D  I+P
Sbjct: 63  NIFKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITP 122

Query: 107 QLYSCLV-GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEG--LMGFF 163
                LV G  A   S L + P  V+ TR       +  K  + I  I+      +  F+
Sbjct: 123 STIEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFW 182

Query: 164 SGCGSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLA 222
            G  + +  + +N +I +  ++ +K +F  + S  +D      + N + G +S   S L 
Sbjct: 183 KGLRTGL-ALTINPSITYASFQRLKEVFFHDHS--NDAGSLSAVQNFILGVLSKMISTLV 239

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVT 282
           T PL   +  +Q   S         F + +   YKN             EG  SL++GV 
Sbjct: 240 TQPLIVAKAMLQSAGS-----KFTTFQEALLYLYKN-------------EGLKSLWKGVL 281

Query: 283 MSLIKSV 289
             L K V
Sbjct: 282 PQLTKGV 288

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 8/88 (9%)

Query: 204 FTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLG 263
            TL + L G ++   + +A +PLD  +  IQ + SP+      E      K   NRR+  
Sbjct: 2   LTLESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNE-----GKVLPNRRYKN 56

Query: 264 V---GISMVQQEGPLSLYRGVTMSLIKS 288
           V    I++ +++G L LY+G+T++ + +
Sbjct: 57  VVDCMINIFKEKGILGLYQGMTVTTVAT 84

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 2/85 (2%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--TPHNKNANVLINILKRE 62
           DH      +S   + + G LS + +     PL   K  LQ   +        L+ + K E
Sbjct: 212 DHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNE 271

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFG 87
           G++  WKG +P     +I  G  F 
Sbjct: 272 GLKSLWKGVLPQLTKGVIVQGLLFA 296

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 90/205 (43%), Gaps = 33/205 (16%)

Query: 102 LNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMG 161
           ++ S  L S   G+ AG ++ LA +P D L+TR  A                +++ G  G
Sbjct: 1   MDSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKG------------GFFANGGYKG 48

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTE---ERSKLSDRRDPFTLLNELAGPISGFT 218
            + G GS++I    + ++ F  Y+S+K++++    +   S+ +   TL +  +  I   +
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVS 108

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL-SL 277
           + L   P + +++R Q   + +     + FTK +                   EG L +L
Sbjct: 109 ACLVRVPAEVIKQRTQTHKTNSSW---QTFTKILQNE--------------NGEGVLRNL 151

Query: 278 YRGVTMSLIKSVPSTAISLWSYELF 302
           YRG   ++++ +P T I    YE  
Sbjct: 152 YRGWNTTIMREIPFTCIQFPLYEFL 176

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 88/187 (47%), Gaps = 18/187 (9%)

Query: 15  TTNSLVAGSLSGLFART------CIA--PLDTVKIKLQVTPHNKNANVLINILKREG--- 63
           T+N+ +A +LS +F+ +      C+   P + +K + Q    N +      IL+ E    
Sbjct: 87  TSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEG 146

Query: 64  -IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL--RGGLDLNISPQLYSCLVGSLAGMT 120
            +R  ++G     +  I +   QF  Y ++      R G D +++P   S + GS+AG  
Sbjct: 147 VLRNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQD-HVAPWQGS-VCGSVAGAI 204

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
           ++  + P DVL+TR   + +   I +      I++ EG   FFSG G   + I    AI 
Sbjct: 205 AAATTTPLDVLKTRLMLSHKS--IPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIF 262

Query: 181 FGVYESI 187
            GVYE++
Sbjct: 263 LGVYETV 269

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN-KNANVLINILK 60
           N +DH      V+     V GS++G  A     PLD +K +L ++  +   A +  NI  
Sbjct: 184 NGQDH------VAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIPVAQLAKNIYA 237

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQF-GSYTYIGSFLRG 98
            EG + F+ G  P + M+I  GGA F G Y  + S L G
Sbjct: 238 EEGFKVFFSGVGPRT-MWISAGGAIFLGVYETVHSILSG 275

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 50/259 (19%), Positives = 109/259 (42%), Gaps = 29/259 (11%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SL +G+ +G        P+DT+K +LQ                  G +G ++G       
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQAKG---------GFFANGGYKGVYRGLGSAVIA 59

Query: 71  NVP-GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           + P  S+ ++ Y   +  S   I  ++    +  ++  L      S+  +++ L   P +
Sbjct: 60  SAPSASLFFVSYDSMKVYSKPVISKYVTS--NNQMADTLSHMFSSSIGEVSACLVRVPAE 117

Query: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGLM-GFFSGCGSSMINIGLNTAIMFGVYESIK 188
           V++ R   +      +   +I+   + EG++   + G  ++++     T I F +YE +K
Sbjct: 118 VIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLK 177

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI--RNSPNEERHDR 246
               +R+   D   P+     + G ++G  +   T PLD ++ R+ +  ++ P  +    
Sbjct: 178 KTWAKRNG-QDHVAPWQ--GSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIPVAQLAKN 234

Query: 247 EFTKDIYKSYKNRRFLGVG 265
            + ++ +K +    F GVG
Sbjct: 235 IYAEEGFKVF----FSGVG 249

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 95/205 (46%), Gaps = 26/205 (12%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-ANVLINILKREGIRGFW 68
           + E++ +    AG +S +      AP + VK+ LQ T    +  +    I++ +G +  +
Sbjct: 134 EPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGKASFLDAAKQIVRTQGFQSLF 193

Query: 69  KGNV-------PGSIMYIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGSL 116
           KG++       PGS +Y       F SY     +L         +L+I+     C+ G +
Sbjct: 194 KGSLATLSRDGPGSALY-------FASYEICKEYLNKASGHTSGELSIT---NVCISGGM 243

Query: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI-NIGL 175
           AG++  +  +P D ++T+  ++S+ Q + L    M   +  G+ GFF G G +++ +   
Sbjct: 244 AGVSMWVVVFPIDTVKTQLQSSSKRQSM-LEVTRMIYNTRGGIKGFFPGVGPAILRSFPA 302

Query: 176 NTAIMFGVYESIKIFTE-ERSKLSD 199
           N A   GV  +  +F + E+ K S 
Sbjct: 303 NAATFLGVELTHSLFKKFEQQKTSS 327

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 127/313 (40%), Gaps = 42/313 (13%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR------- 61
           K +      SL AG + G+ A     P D VK++ Q        + + +IL+        
Sbjct: 22  KSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGP 81

Query: 62  ---EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLD-------LNISPQL--- 108
                +RGF+KG VP  +         F  Y  +G  L   +          + P+L   
Sbjct: 82  TSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYD-VGKKLVTSVPSSAASGAAAVEPELTLS 140

Query: 109 YSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGS 168
                G ++ + ++L + P + ++      +QG+   L D    I   +G    F G  +
Sbjct: 141 QMAAAGFISAIPTTLVTAPTERVKVVL-QTTQGKASFL-DAAKQIVRTQGFQSLFKGSLA 198

Query: 169 SMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDT 228
           ++   G  +A+ F  YE  K +  + S  +      T +  ++G ++G +  +  FP+DT
Sbjct: 199 TLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVC-ISGGMAGVSMWVVVFPIDT 257

Query: 229 VRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKS 288
           V+ ++Q   S ++ +   E T+ IY +               + G    + GV  ++++S
Sbjct: 258 VKTQLQ---SSSKRQSMLEVTRMIYNT---------------RGGIKGFFPGVGPAILRS 299

Query: 289 VPSTAISLWSYEL 301
            P+ A +    EL
Sbjct: 300 FPANAATFLGVEL 312

>Kwal_47.19228
          Length = 281

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 47  PHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP 106
           P  +    +  I +  GIRGF +G +P  I        +F +YT +   +     LN   
Sbjct: 127 PSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLN--- 183

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR-DEIMAIWSHEGLMGFFSG 165
           + Y+  +G ++       + P DV++TR  +       K   +    I+  EG   F+ G
Sbjct: 184 EYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKG 243

Query: 166 CGSSMINIGLNTAIMFGVYESI 187
               ++ +GL+  + FGVY+ +
Sbjct: 244 WAPRLMKVGLSGGVSFGVYQYV 265

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINIL 59
           K  +  ++ ++   +   G +S         P+D +K ++Q     + +  + N    I 
Sbjct: 173 KQMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIF 232

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG 98
             EG   FWKG  P  +   + GG  FG Y Y+ + ++ 
Sbjct: 233 VEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKA 271

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 60/155 (38%), Gaps = 30/155 (19%)

Query: 150 IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE 209
           +  I+   G+ GF  G   ++I    N+A+ F  Y S+K              P   LNE
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI----------SPNKPLNE 184

Query: 210 LAGPISGFTSKLA----TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
                 GF S  A    T P+D ++ R+Q              +K  + +YKN   L   
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQ--------------SKYTWSNYKNS--LNCA 228

Query: 266 ISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
             +  +EG    ++G    L+K   S  +S   Y+
Sbjct: 229 YRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 67/168 (39%), Gaps = 36/168 (21%)

Query: 162 FFSGCGSSMINIG--LNTAIMFGVYE-SIKIFTEERSKLSDRRDPFTLLNELAGPISGFT 218
           +F+GC  S +N+G  L TA  F  ++ + ++  +  +       P  L    AG I+GF 
Sbjct: 8   YFAGC--SALNVGTLLKTATRFTTFDRACQLLHDPENPNGTISGPRLLA---AGVITGFM 62

Query: 219 SKLATFPLDTVRRRIQIRNS----------PNEER-----------------HDREFTKD 251
             L   P + ++  + I N+          P E++                 H R+    
Sbjct: 63  ESLLVIPFENIKTTM-IENALLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWAL 121

Query: 252 IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299
            Y  + +R+FL     + +  G     +G   ++I+   ++A+   +Y
Sbjct: 122 YYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTY 169

>Scas_715.45
          Length = 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 113/273 (41%), Gaps = 31/273 (11%)

Query: 12  EVSTTNSLVAGSLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIR 65
           E+ T     A +L G+ A     + + PLD +K +LQV P  +  N + +I ILK+EG+ 
Sbjct: 9   ELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLG 68

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL--DLNISPQLYSCLVGSLAGMTSSL 123
             + G     I Y + G  ++G Y          L  D   + +  +    S+  ++S+ 
Sbjct: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRT----SIYLLSSAT 124

Query: 124 ASYPFDVLRTRFAA---NSQGQLIKLRDEIMAIW----SHEGLMGFFSGCGSSMINIGLN 176
           A +  D++   F A     Q  +    + ++  W    + EGL GF+ G           
Sbjct: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184

Query: 177 TAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-----GPISGFTSKLATFPLDTVRR 231
           T   F  +E  +I     ++L  ++   + L +++     G ++G    + + P D +  
Sbjct: 185 TMCKFTSFE--RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242

Query: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGV 264
           +I      NE + +      + + Y    F+G+
Sbjct: 243 KIN-----NERKVNESMNVALKRIYSRIGFVGL 270

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 81/205 (39%), Gaps = 43/205 (20%)

Query: 110 SCLVGSLAGMTSSLASY-PFDVLRTR-------FAANSQGQLIKLRDEIMAIWSHEGLMG 161
           +C +G +     + +S  P D+++ R       + +N+ G        I+ I   EGL  
Sbjct: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSG--------IIQILKKEGLGK 69

Query: 162 FFSGCGSSMINIGLNTAIMFGVYE------SIKIFTEERSKLSDRRDPFTLLNELAGPIS 215
            F+G G++ I   L  A  +G YE      S  +  +E +    R    T +  L+   +
Sbjct: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYR----TSIYLLSSATA 125

Query: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275
            F + +   P + ++ + Q    P        +  ++ + +K          M  +EG  
Sbjct: 126 EFFADIMLCPFEAIKVKQQTTMPP--------WCNNVIEGWKK---------MYAKEGLN 168

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYE 300
             Y+G+T    + +P T     S+E
Sbjct: 169 GFYKGITPLWCRQIPYTMCKFTSFE 193

>Kwal_23.4354
          Length = 343

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 97/212 (45%), Gaps = 29/212 (13%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ----VTPHNKNANVLINIL 59
           +D  R  ++  T N L+ G+L+ + A T +APL+  + +LQ     +P +  A ++ +++
Sbjct: 129 RDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLI 188

Query: 60  K-------REGIRGFWKG-------NVPGSIMYIIYGGAQF-GSYTYIGS--FLRGGLDL 102
           K       + G +  ++G       +VP S +Y  +G  +F  S   I S   +    + 
Sbjct: 189 KESRYEISKVGYKALFRGLEITLWRDVPFSSIY--WGCYEFYKSNVSIDSEKSIVNSSNS 246

Query: 103 NISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDE------IMAIWSH 156
           N +  + S + GS  G  +++ ++PFDV +TR         ++ +        +  +   
Sbjct: 247 NWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKS 306

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           EGL   ++G    +I I  + AIM   YE  K
Sbjct: 307 EGLAALYTGLVPRVIKIAPSCAIMISTYEVCK 338

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 119/281 (42%), Gaps = 31/281 (11%)

Query: 36  LDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSF 95
            + V+ K     +N   +    I K EG++  W+G    SI  ++   A    +    S 
Sbjct: 72  FEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGL---SITLLMAAPANMVYFIGYESL 128

Query: 96  LRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA-------NSQGQLIK-LR 147
                  +  P L   + G+LA + ++    P ++ RTR  +       ++   +IK L 
Sbjct: 129 RDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLI 188

Query: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE----SIKIFTEERSKLSDRRDP 203
            E     S  G    F G   ++      ++I +G YE    ++ I +E+    S   + 
Sbjct: 189 KESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNW 248

Query: 204 FTLLNE-LAGPISGFTSKLATFPLDTVRRRIQIR--NSPNEERHDREFTKDIYKSYKNRR 260
              +N  + G   G  + + T P D  + R+QI   NS  E++     +K+++K Y N+ 
Sbjct: 249 NHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKP----SKNMFK-YLNQ- 302

Query: 261 FLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                  M + EG  +LY G+   +IK  PS AI + +YE+
Sbjct: 303 -------MRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 67/149 (44%), Gaps = 21/149 (14%)

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL-AGPIS 215
           EG+   + G   +++       + F  YES++    ++S+L D+   +  LN L  G ++
Sbjct: 98  EGVQSLWRGLSITLLMAAPANMVYFIGYESLR----DKSRLQDK---YPTLNPLMCGALA 150

Query: 216 GFTSKLATFPLDTVRRRIQ--IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEG 273
              +     PL+  R R+Q   R+SP          KD+ K  +           + + G
Sbjct: 151 RVLAATTVAPLELFRTRLQSIPRSSPKSTTA--MMIKDLIKESRYE---------ISKVG 199

Query: 274 PLSLYRGVTMSLIKSVPSTAISLWSYELF 302
             +L+RG+ ++L + VP ++I    YE +
Sbjct: 200 YKALFRGLEITLWRDVPFSSIYWGCYEFY 228

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 26/182 (14%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           S  AGSL G+     + PLD +KIK Q  P +      + IL+ EG+ G ++G       
Sbjct: 121 SATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFRGRGFLRILRDEGM-GLYRGWGWTAAR 178

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDV 130
           N PGS  + ++GG  F     +G  L+            S + G+ A +   + S P DV
Sbjct: 179 NAPGS--FALFGGNAFAKEYILG--LKDYSQATWGQNFVSSIFGASASL---IVSAPLDV 231

Query: 131 LRTR-----FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
           ++TR     F +   G  I     +     +EG   FF G    ++  G      F + +
Sbjct: 232 IKTRIQSRNFESAESGFTI-----VKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQ 286

Query: 186 SI 187
           ++
Sbjct: 287 TL 288

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 117/315 (37%), Gaps = 58/315 (18%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNK--NANVLINILKRE-- 62
           +  D++ S    +V  + +G+       P+DT+  +L ++ H K  NA  L +++ RE  
Sbjct: 1   MSNDQKQSGLARVVGSASAGILEIGVFHPVDTISKRL-MSNHTKITNAQQLNDVVFREHA 59

Query: 63  ----GIRGFWKGNVPG---SIMYII------YGGAQFGSY---TYIGSFLRGGLDLNISP 106
               G R F     PG   +  Y I      YGG  F +     +  +   G        
Sbjct: 60  SKPFGQRLFTL--FPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGK 117

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQ-----GQLIKLRDEIMAIWSHEGLMG 161
            L S   GSL G+   +   P DVL+ +   N +     G L  LRDE M ++   G   
Sbjct: 118 ALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFRGRGFLRILRDEGMGLYRGWGWTA 176

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
             +  GS            F ++       E    L D        N ++       S +
Sbjct: 177 ARNAPGS------------FALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLI 224

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
            + PLD ++ RIQ RN  + E          +   KN          ++ EG  + ++G+
Sbjct: 225 VSAPLDVIKTRIQSRNFESAESG--------FTIVKN---------TLKNEGATAFFKGL 267

Query: 282 TMSLIKSVPSTAISL 296
           T  L+ + P    S 
Sbjct: 268 TPKLLTTGPKLVFSF 282

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 74/161 (45%), Gaps = 12/161 (7%)

Query: 33  IAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYI 92
           I+P + + +  +  P ++  + +  I    G+RGF +G  P     +     +F +YT +
Sbjct: 252 ISPRERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL 311

Query: 93  GSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFA-----ANSQGQLIKLR 147
              +     LN   + Y+ ++G ++       + P DV++TR       AN +  L    
Sbjct: 312 KQLISPNKPLN---EYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSL---- 364

Query: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           +    I+  EG+  F+ G    ++ +GL+  + FGVY+ ++
Sbjct: 365 NCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVE 405

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTPHNKNA-NVLINIL 59
           K  +  ++ ++   + V G +S         P+D +K ++Q      + KN+ N    I 
Sbjct: 312 KQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIF 371

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR 97
             EGI  FWKG  P  +   + GG  FG Y Y+ + ++
Sbjct: 372 VEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 62/155 (40%), Gaps = 30/155 (19%)

Query: 150 IMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE 209
           +  I+   GL GF  G   ++     N+A+ F  Y S+K       +L     P   LNE
Sbjct: 274 VKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLK-------QLISPNKP---LNE 323

Query: 210 LAGPISGFTSKLA----TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVG 265
               + GF S  A    T P+D ++ R+Q              +K  + +YKN   L   
Sbjct: 324 YYAFVLGFISSCAVVAVTQPIDVIKTRMQ--------------SKYAWANYKNS--LNCA 367

Query: 266 ISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
             +  +EG    ++G    L+K   S  +S   Y+
Sbjct: 368 YRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQ 402

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 46/123 (37%), Gaps = 16/123 (13%)

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           + GS A +  +  SYPF+ L+T        QL +                +FSGC +   
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGL------QLHRSLPNAHPFNMMHQFKYYFSGCAA--- 149

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE----LAGPISGFTSKLATFPLD 227
              LN   +F        F +    L D   P   ++     +AG I+GF   L   P +
Sbjct: 150 ---LNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFE 206

Query: 228 TVR 230
            ++
Sbjct: 207 NIK 209

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 75/184 (40%), Gaps = 25/184 (13%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG----QLIKLRDEIMAIWSHEGLMG 161
           P LY    G++AG++  L  YP DV++TR     QG        + D +  I + EG+  
Sbjct: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221
            + G  S ++      A  F   +  +   ++   +     P ++   LAG  +G     
Sbjct: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM---LAGASAGCVEAF 126

Query: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
              P + V+ R+Q                D   SYK    + V   +V +EG L++Y G+
Sbjct: 127 VVVPFELVKIRLQ----------------DASSSYKGP--VDVVRKIVAREGVLAMYNGL 168

Query: 282 TMSL 285
             +L
Sbjct: 169 ESTL 172

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 88/222 (39%), Gaps = 14/222 (6%)

Query: 21  AGSLSGLFARTCIAPLDTVKIKLQVT------PHNKN-ANVLINILKREGIRGFWKGNVP 73
           AG+++G+     + PLD VK ++Q+       PH     + L  I+  EG+   +KG   
Sbjct: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76

Query: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRT 133
             +M       +F          +    +    Q  S L G+ AG   +    PF++++ 
Sbjct: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136

Query: 134 RFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEE 193
           R    S      + D +  I + EG++  ++G  S++    L     FG+     IF   
Sbjct: 137 RLQDASSSYKGPV-DVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI-----IFQAR 190

Query: 194 RSKLSDRRDPFTLLNEL-AGPISGFTSKLATFPLDTVRRRIQ 234
               +       + N+L +  I      + + P D V+ RIQ
Sbjct: 191 ALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ 232

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 82/190 (43%), Gaps = 12/190 (6%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFW 68
           E++S   S++AG+ +G      + P + VKI+LQ   + +    +V+  I+ REG+   +
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMY 165

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN--ISPQLYSCLVGSLAGMTSSLASY 126
            G       + ++ G  FG      + L    +    I+  L S  +G   G    + S 
Sbjct: 166 NGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIG---CMLST 222

Query: 127 PFDVLRTRF--AANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
           PFDV+++R    A   G + K       ++ I+  EG    + G    ++ +G    I+ 
Sbjct: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282

Query: 182 GVYESIKIFT 191
            V+  +  F 
Sbjct: 283 VVFTGVLDFC 292

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 13/96 (13%)

Query: 198 SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           SD +    L    AG ++G +  L  +PLD V+ R+Q++       H       + K   
Sbjct: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK--- 60

Query: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293
                     +V  EG   LY+G++  ++   P  A
Sbjct: 61  ----------IVAGEGVGRLYKGISSPILMEAPKRA 86

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 81/198 (40%), Gaps = 19/198 (9%)

Query: 5   DHLRKDEEVSTTNSLVAGSLSG--LFARTCIAPLDTVKIKLQVTPHNKNANV--LINILK 60
           D L  D      NS+  GS +     A   + PL+  +I+L   P   N  V     ILK
Sbjct: 99  DTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILK 158

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP----------QLYS 110
            EG+  F+ G  P     I Y  A+F  +          L  +++P             +
Sbjct: 159 EEGVGSFYSGFTPILFKQIPYNIAKFLVFERASE-----LYFSLAPPKDTLSQTSLTAIN 213

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
            L G  AG+ +++ S P D L ++    S+         +  +    G +G F+G  + +
Sbjct: 214 LLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRL 273

Query: 171 INIGLNTAIMFGVYESIK 188
           + +G  T++ FG+Y  +K
Sbjct: 274 VMVGTLTSLQFGIYGQLK 291

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 98/233 (42%), Gaps = 14/233 (6%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---ILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   N  ++ +   I+  EG      G  P  +
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLL 77

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLY-SCLVGSLAG--MTSSLASYPFDVLRT 133
            Y I G  +FG Y     F    L  + + +   S  +GS A     + +A  P +  R 
Sbjct: 78  GYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRI 137

Query: 134 RFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYE--SIKI 189
           R    SQ      L      I   EG+  F+SG    +   I  N A  F V+E  S   
Sbjct: 138 RLV--SQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIA-KFLVFERASELY 194

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI-QIRNSPNE 241
           F+    K +  +   T +N L+G  +G  + + + P DT+  ++ +   +P +
Sbjct: 195 FSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQ 247

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 73/193 (37%), Gaps = 24/193 (12%)

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
            L G++   ++  +  P DV++TR           +      I + EG     +G G ++
Sbjct: 17  ALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTL 76

Query: 171 INIGLNTAIMFGVYESIKIF---TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227
           +   +  A  FG YE  K F   T      +  ++   + +  A   + F + +A  PL+
Sbjct: 77  LGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAA---AEFLADIALCPLE 133

Query: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287
               RI++ + P        F   +   +           ++++EG  S Y G T  L K
Sbjct: 134 AT--RIRLVSQPT-------FANGLVGGFSR---------ILKEEGVGSFYSGFTPILFK 175

Query: 288 SVPSTAISLWSYE 300
            +P        +E
Sbjct: 176 QIPYNIAKFLVFE 188

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 123/286 (43%), Gaps = 47/286 (16%)

Query: 35  PLDTVKIKLQVTPHNKNA--------NVLINILKREGIRGFWKGNVPGSIMYIIYG-GAQ 85
           PL T+  ++QV+  +K            +  I ++EG+ GF+ G     +   +YG  A 
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYG-----LESAMYGMAAN 90

Query: 86  FGSYTYIGSF-------LRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRF--A 136
             +Y Y           +RG   LN S  + S  V   AG  +++AS P  V+ TR   A
Sbjct: 91  SLNYYYFYELAARATMRVRGSRRLNTSEAILSSAV---AGSMTAIASNPIWVVNTRMTVA 147

Query: 137 ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSK 196
            + Q  L  L D    I   +G+   F+G   +++ +  N  I + V+E +K    + S 
Sbjct: 148 KSEQSTLAVLLD----IVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVVLKWSG 202

Query: 197 LSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSY 256
            SD   P      L G +    +  +T+P  T++ R+ +  +  +E  D +         
Sbjct: 203 -SDVLLPSWAF--LLGAVGKLAATGSTYPYITLKTRMHL--AKGKEDADTQ--------- 248

Query: 257 KNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
             +    + + +V++EG   LY G+ + L +S+ + A   +  E F
Sbjct: 249 --QSMWSLMVDIVKKEGIQGLYHGIGVKLTQSILTAAFLFYFKEGF 292

>Scas_687.15*
          Length = 328

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 91/232 (39%), Gaps = 49/232 (21%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKL------------------- 43
           +  +L KD  +     L+AG L+G     CI P + VK+ +                   
Sbjct: 87  RDPNLPKDSLLKGPRLLLAGILTGAVESLCIIPFENVKVTMIENSLQLSESKPTEKEIAG 146

Query: 44  --------------QVTPHNKNANV--------LINILKR----EGIRGFWKGNVPGSIM 77
                         Q++P  +   V        + +++K      G+RGF +G +P    
Sbjct: 147 TLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFR 206

Query: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA 137
            +     +F +YT +   +     LN   ++Y+  +G  +       + P DV++TR  +
Sbjct: 207 QVSNSTVRFTAYTTLKQLISPTQPLN---EVYAFGIGLFSSCAVVALTQPIDVVKTRMQS 263

Query: 138 NSQGQLIKLR-DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
            +     K   +    ++  EG++  + G    +  +GL+  I FGVY+ ++
Sbjct: 264 KTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQYVE 315

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 12/129 (9%)

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           L GS A +  +  +YPF+ L+T F  + +    K  + +  I        +F+GC +  +
Sbjct: 13  LAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPFEALRPI------KVYFAGCTALNL 66

Query: 172 NIGLNTAIMFGVYE-SIKIFTEER-SKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
           +  + T++ F  ++ + +I  +    K S  + P  L   LAG ++G    L   P + V
Sbjct: 67  SAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLL---LAGILTGAVESLCIIPFENV 123

Query: 230 RRRIQIRNS 238
           +  + I NS
Sbjct: 124 KVTM-IENS 131

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 125/279 (44%), Gaps = 31/279 (11%)

Query: 39  VKIKLQVTPHNKNANVLI-NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR 97
           V + LQ   H K    +I N+ ++EG R  +KG  P  +  I      F +Y        
Sbjct: 110 VNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYS 169

Query: 98  GGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIW 154
              +          +  + AG  ++ A+ P  +++TR   +  G+    +   D + +I 
Sbjct: 170 KAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSIL 229

Query: 155 SHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERS------------KLSDRRD 202
            +EG+ G + G  +S +   +   + + +YE +K   ++RS              +D+  
Sbjct: 230 RNEGIYGLYRGLSASYLG-SVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIK 288

Query: 203 PFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFL 262
            +   +  AG ++ F + + T+P + VR R+  R SP E  + +     + +S++     
Sbjct: 289 QWCQRSGGAG-LAKFMASIVTYPHEVVRTRL--RQSPLE--NGKVKYTGLVQSFR----- 338

Query: 263 GVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
                ++++EG  S+Y G+T  L+++VP++ I   ++E+
Sbjct: 339 ----VIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEV 373

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 77/176 (43%), Gaps = 23/176 (13%)

Query: 35  PLDTVKIKLQV-----TPHNKNA-NVLINILKREGIRGFWKG-------NVPGSIMYIIY 81
           P+  VK ++Q+     T   KN+ + L +IL+ EGI G ++G       +V G + +++Y
Sbjct: 199 PIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLY 258

Query: 82  GGAQF----GSYTYIGSFLRGGLDLNISPQLYSCLVGS--LAGMTSSLASYPFDVLRTRF 135
              +      S    G+     +      + +    G   LA   +S+ +YP +V+RTR 
Sbjct: 259 EQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRL 318

Query: 136 AA----NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187
                 N + +   L      I   EGL   +SG    ++    N+ IMFG +E +
Sbjct: 319 RQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVV 374

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 72/173 (41%), Gaps = 12/173 (6%)

Query: 35  PLDTVKIKLQVTPHNKNANVLINILKRE---GIR-GFWKGNVPGSIMYIIYGGAQFGSYT 90
           P + VK + Q    + +   L  ILK E   G+R   ++G     +  I +   QF  Y 
Sbjct: 113 PAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE 172

Query: 91  YIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEI 150
           Y+        + +        + GS+AG  ++  + P D L+TR     +   I L   +
Sbjct: 173 YMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKS--IPLGTLV 230

Query: 151 MAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDP 203
             I+  EG   FFSG G   + I    AI  G+YE++       S LS  + P
Sbjct: 231 STIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETV------HSLLSTNKKP 277

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 100/227 (44%), Gaps = 24/227 (10%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SL++G+ +G        P+DT+K +LQ               +  G RG ++G       
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG---------GFFRNGGYRGVYRGLGSAVVA 58

Query: 71  NVPG-SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           + PG S+ +I Y   +  +  +    L      ++   ++S  +G +A   + +   P +
Sbjct: 59  SAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIA---ACMVRVPAE 115

Query: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGL-MGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           V++ R   ++     +   EI+   + EG+    + G  ++++     T I F +YE +K
Sbjct: 116 VVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMK 175

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
               E  + SDR +P+     + G I+G  +   T PLD ++ R+ +
Sbjct: 176 KVWAELDE-SDRVEPWK--GAVCGSIAGGIAAATTTPLDFLKTRLML 219

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 79/195 (40%), Gaps = 30/195 (15%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           L S L G+ AG ++ L  +P D L+TR  A                + + G  G + G G
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAKG------------GFFRNGGYRGVYRGLG 53

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEE--RSKLSDRRDPFTLLNELAGPISGFTSKLATFP 225
           S+++      ++ F  Y++ K  T    R  L        + +  +  +    + +   P
Sbjct: 54  SAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVP 113

Query: 226 LDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSL 285
            + V++R Q   S +     RE  K+     +N    G G+         +LYRG + ++
Sbjct: 114 AEVVKQRSQTHASHSSWETLREILKN-----EN----GEGVRR-------NLYRGWSTTI 157

Query: 286 IKSVPSTAISLWSYE 300
           ++ +P T I    YE
Sbjct: 158 MREIPFTCIQFPLYE 172

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 6   HLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN-ILKREGI 64
            L + + V      V GS++G  A     PLD +K +L +   +     L++ I K EG 
Sbjct: 180 ELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLVSTIYKEEGF 239

Query: 65  RGFWKGNVPGSIMYIIYGGAQF-GSYTYIGSFL 96
           + F+ G  P   M+I  GGA F G Y  + S L
Sbjct: 240 KVFFSGVGP-RTMWISAGGAIFLGIYETVHSLL 271

>Kwal_0.232
          Length = 274

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 12/185 (6%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKRE---GIR- 65
           D+   T   + + S   + A     P + +K + Q    + +   L  +L+ E   GIR 
Sbjct: 90  DQVAETATHMFSSSAGEIAACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRR 149

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYSCLVGSLAGMTSSL 123
             ++G     +  I +   QF  Y ++     + GG +  ++P       G +AG  ++ 
Sbjct: 150 NLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAISGGRE-QVAP-WQGAFCGCVAGGIAAA 207

Query: 124 ASYPFDVLRTRFA-ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182
            + P DVL+TR   +++   ++ L  +I A    EG   FFSG G   + I    AI  G
Sbjct: 208 TTTPLDVLKTRLMLSHTSVPVLHLARQIYAT---EGWKVFFSGVGPRTVWISAGGAIFLG 264

Query: 183 VYESI 187
           VYE++
Sbjct: 265 VYETV 269

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 84/199 (42%), Gaps = 37/199 (18%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           S L G+ AG ++ L  +P D L+TR  A                +++ G +G + G GS+
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAG------------GFFANGGYLGVYRGLGSA 56

Query: 170 MINIGLNTAIMFGVYESIK-----IFTEERSKLSDRRDPFT-LLNELAGPISGFTSKLAT 223
           ++    + ++ F  Y+ +K     IF    +      +  T + +  AG I+    ++  
Sbjct: 57  VVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRV-- 114

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            P + +++R Q   S +         + + K  +N    G GI         +LYRG + 
Sbjct: 115 -PAEVIKQRTQTHKSDSS-------LQTLKKLLQNEN--GEGIRR-------NLYRGWST 157

Query: 284 SLIKSVPSTAISLWSYELF 302
           ++++ +P T I    YE  
Sbjct: 158 TVMREIPFTCIQFPLYEFL 176

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 53/277 (19%), Positives = 112/277 (40%), Gaps = 31/277 (11%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------ 70
            SL+AG+ +G        P+DT+K +LQ                  G  G ++G      
Sbjct: 8   TSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG---------GFFANGGYLGVYRGLGSAVV 58

Query: 71  -NVP-GSIMYIIYGGAQFGSYTYIGSFLRGGLDL-NISPQLYSCLVGSLAGMTSSLASYP 127
            + P  S+ ++ Y G +  S     + +     +   +  ++S   G +A   + +   P
Sbjct: 59  ASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIA---ACMVRVP 115

Query: 128 FDVLRTRFAANSQGQLIKLRDEIMAIWSHEGL-MGFFSGCGSSMINIGLNTAIMFGVYES 186
            +V++ R   +     ++   +++   + EG+    + G  ++++     T I F +YE 
Sbjct: 116 AEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYE- 174

Query: 187 IKIFTEERSKLSDRRDPFT-LLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHD 245
              F +++  +S  R+          G ++G  +   T PLD ++ R+ + ++     H 
Sbjct: 175 ---FLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLH- 230

Query: 246 REFTKDIYKSYKNRRFL-GVGISMVQQEGPLSLYRGV 281
               + IY +   + F  GVG   V      +++ GV
Sbjct: 231 --LARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGV 265

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 91/215 (42%), Gaps = 51/215 (23%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN--KNANV-----LINILKRE-GIRG 66
           T N L+ G+ +   A T +APL+ +K KLQ  P +  KN +V     L N +K E  +RG
Sbjct: 166 TINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRG 225

Query: 67  ------------FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLY---SC 111
                        W+ +VP S +Y  +   +F   T +        D N S   +   S 
Sbjct: 226 VAQTMFKGLEITLWR-DVPFSAIY--WASYEFYK-TKVAYLSPSTFDKNSSNWFHFTNSF 281

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMA------------------I 153
           L G ++G  +++ ++PFDV +TR       Q+  + D+ +A                  I
Sbjct: 282 LGGFISGSLAAICTHPFDVGKTR------QQISLVTDKKLANSNLKYGSSNTMFGFLNYI 335

Query: 154 WSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
              EG+   ++G    +  I  + AIM   YE  K
Sbjct: 336 RKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTK 370

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 103/258 (39%), Gaps = 23/258 (8%)

Query: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN-ISPQLYSCLVGSL 116
           I K EG+   W+G     +M I      F  Y Y+    R    LN + P +   + G+ 
Sbjct: 120 IAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYV----RDRSPLNGLYPTINPLICGAF 175

Query: 117 AGMTSSLASYPFDVLRTRF-----AANSQGQLIKLRDEIMAIWSHEGLMG----FFSGCG 167
           A   ++ +  P ++++T+      ++   G +I  RD    I S   + G     F G  
Sbjct: 176 ARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLE 235

Query: 168 SSMINIGLNTAIMFGVYESIKI---FTEERSKLSDRRDPFTLLNE-LAGPISGFTSKLAT 223
            ++      +AI +  YE  K    +    +   +  + F   N  L G ISG  + + T
Sbjct: 236 ITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICT 295

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            P D  + R QI         D++      K   +    G    + + EG  +LY G+  
Sbjct: 296 HPFDVGKTRQQI-----SLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAP 350

Query: 284 SLIKSVPSTAISLWSYEL 301
            + K  PS AI + SYEL
Sbjct: 351 RVAKIAPSCAIMISSYEL 368

>Scas_673.17
          Length = 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 9/193 (4%)

Query: 5   DHLRKDEEVSTTNSLVAGS--LSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILK 60
           D +  +  V   NS+  GS  ++   A   + PL+  +I+L   P   N  V     ILK
Sbjct: 106 DTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILK 165

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQF-----GSYTYIGSFLRGGLDLNISPQLYSCLVGS 115
            EG+  F+ G  P     I Y  A+F      S  Y G         +++    + L G 
Sbjct: 166 EEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGL 225

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            AG  ++  S P D L ++     +         +  +    G++G F+G  + +I +G 
Sbjct: 226 TAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGT 285

Query: 176 NTAIMFGVYESIK 188
            T++ F +Y S+K
Sbjct: 286 LTSLQFAIYGSLK 298

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 98/237 (41%), Gaps = 22/237 (9%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVL---INILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   N  ++     I+  EG      G  P  +
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLL 84

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDL----NISPQLYSCLVGS--LAGMTSSLASYPFDV 130
            Y + G  +FG Y     F +  +D     N      S  +GS  +A   + +A  P + 
Sbjct: 85  GYSVQGAFKFGGYEV---FKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEA 141

Query: 131 LRTRFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSGCGSSMI-NIGLNTAIMFGVYESIK 188
            R R    SQ      L      I   EG+  F+SG    +   I  N A       + +
Sbjct: 142 TRIRLV--SQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASE 199

Query: 189 IF---TEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRI-QIRNSPNE 241
           ++      +  LSD  +  T +N L+G  +GF +   + P DT+  ++ + + +P +
Sbjct: 200 VYYGIVGAKETLSDMTN--TGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQ 254

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 71/190 (37%), Gaps = 18/190 (9%)

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
            L G++   T+  +  P DV++TR           +      I + EG     +G G ++
Sbjct: 24  ALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTL 83

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
           +   +  A  FG YE  K  + +     +       +   +  ++ F + +A  PL+  R
Sbjct: 84  LGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATR 143

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
             I++ + P        F   +   +           ++++EG  S Y G T  L K +P
Sbjct: 144 --IRLVSQPT-------FANGLVGGFSR---------ILKEEGVGSFYSGFTPILFKQIP 185

Query: 291 STAISLWSYE 300
                   +E
Sbjct: 186 YNIAKFLVFE 195

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 95/205 (46%), Gaps = 25/205 (12%)

Query: 101 DLNISPQ----LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSH 156
           DL+ +P+    +   + G+  G+   L   PFD+ + R   +S G    + + I  +  +
Sbjct: 13  DLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSS-GSPTAI-EVIKNLVKN 70

Query: 157 EGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL-AGPIS 215
           EGL+ F+ G    +I +G   +  FGV E++K +    +   D+    +LL     G +S
Sbjct: 71  EGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQH--LSLLQYYTCGFVS 128

Query: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275
           G  +     P++ VR R+Q++            TK + K+ + R  L     +++Q+   
Sbjct: 129 GSANAFLATPIEHVRIRLQLQ------------TKALAKA-EYRGSLDCMKKLLKQK--- 172

Query: 276 SLYRGVTMSLIKSVPSTAISLWSYE 300
           +L RG T +L+++     +   +YE
Sbjct: 173 ALMRGFTATLMRTSHGFGVYFLTYE 197

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/297 (20%), Positives = 125/297 (42%), Gaps = 36/297 (12%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGS 75
             +++G+  G+       P D  K+++Q +  +  A  V+ N++K EG+  F+KG +   
Sbjct: 25  KDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPL 84

Query: 76  IMYIIYGGAQFGSYTYIGS-FLR--GGLDLNIS-PQLYSCLVGSLAGMTSSLASYPFDVL 131
           I        QFG    +   FLR  G  D ++S  Q Y+C  G ++G  ++  + P + +
Sbjct: 85  IGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTC--GFVSGSANAFLATPIEHV 142

Query: 132 RTRFAANSQGQLIKLR-----DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYES 186
           R R    ++  L K       D +  +   + LM  F+   ++++       + F  YE+
Sbjct: 143 RIRLQLQTKA-LAKAEYRGSLDCMKKLLKQKALMRGFT---ATLMRTSHGFGVYFLTYEA 198

Query: 187 IKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN--SPNEERH 244
           + +   +   L     P+ +   + G  SG      T+P D V+  +Q     SP   ++
Sbjct: 199 LIMNQNKNGVLRKDIPPWKVC--VFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKN 256

Query: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
             +  K I+ +                 G  +  +G   ++++S+P    +  ++E+
Sbjct: 257 VFQVAKSIHAT----------------RGWGAFVKGFVPTMLRSLPVNGATFATFEV 297

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 64/143 (44%), Gaps = 21/143 (14%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV-------TPHNKNANVLINILKR 61
           KD+ +S       G +SG        P++ V+I+LQ+         +  + + +  +LK+
Sbjct: 112 KDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ 171

Query: 62  EGI-RGFWKGNVPGSIMYIIYGGAQFGSY--TYIGSFL---RGGLDLNISPQLYSCLVGS 115
           + + RGF       ++M   +G   FG Y  TY    +   + G+     P    C+ G+
Sbjct: 172 KALMRGF-----TATLMRTSHG---FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGA 223

Query: 116 LAGMTSSLASYPFDVLRTRFAAN 138
            +G      +YPFDV+++   A+
Sbjct: 224 FSGAFFWAMTYPFDVVKSIMQAD 246

>Kwal_23.5757
          Length = 307

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 83/202 (41%), Gaps = 27/202 (13%)

Query: 105 SPQLYS-CLVGSL--AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMG 161
           SP+ Y+ C +G L   G T S A  P D+++ R   ++      L D    I   EG   
Sbjct: 15  SPEYYAACTLGGLVACGPTHS-AVTPLDLVKCRRQVDASLYKSNL-DGWRQIVRSEGATK 72

Query: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL---AGPISGFT 218
            F+G G++ I   L  A  +G YE    F  + S+L       +    +   A   + F 
Sbjct: 73  VFTGVGATAIGYSLQGAFKYGGYE---FFKHQYSQLVSPETAHSYRTGIFLAASASAEFI 129

Query: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
           + +   P + ++ R Q    P        F ++++ +Y           MV  EG  SLY
Sbjct: 130 ADIFLCPWEAIKVRQQTAVPP-------PFARNVFDAYSK---------MVGAEGFASLY 173

Query: 279 RGVTMSLIKSVPSTAISLWSYE 300
           +G+T    + +P T     S+E
Sbjct: 174 KGITPLWFRQIPYTMCKFTSFE 195

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 77/184 (41%), Gaps = 12/184 (6%)

Query: 16  TNSLVAGSLSGLF-ARTCIAPLDTVKIKLQVT---PHNKNA-NVLINILKREGIRGFWKG 70
           T   +A S S  F A   + P + +K++ Q     P  +N  +    ++  EG    +KG
Sbjct: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG 175

Query: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGS-LAGMTSSLA 124
             P     I Y   +F S+  I   +   L     +++   Q+     G  LAG+  ++ 
Sbjct: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           S+P DV+ ++   N +            I+   G  G ++G    ++ IG  T+  + +Y
Sbjct: 236 SHPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIY 294

Query: 185 ESIK 188
           +S K
Sbjct: 295 DSFK 298

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 87/193 (45%), Gaps = 9/193 (4%)

Query: 5   DHLRKDEEVSTTNSLVAGS--LSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILK 60
           D++  D  V+  N++  GS  ++  FA   + PL+  +I+L   P   N        ILK
Sbjct: 99  DNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLFGGFSRILK 158

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGS--FLRGGLDLNISPQLYSCL---VGS 115
            EG+  F+ G  P     I Y  A+F  + +  +  F   G    +S   ++ +    G 
Sbjct: 159 EEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGL 218

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
            AG+ +++ S P D L ++     +         +  +    G +G F+G  + ++ +G 
Sbjct: 219 TAGLAAAVVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGT 278

Query: 176 NTAIMFGVYESIK 188
            T++ FG+Y ++K
Sbjct: 279 LTSLQFGIYGTLK 291

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 73/190 (38%), Gaps = 18/190 (9%)

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
            L G++    +  +  P DV++TR           +      I S EG     +G G ++
Sbjct: 17  ALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
           +   L  +  FG YE  K    +     +  +    +   +  I+ F + +A  PL+  R
Sbjct: 77  LGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATR 136

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
             I++ + P               ++ N  F G    ++++EG  S Y G T  L K +P
Sbjct: 137 --IRLVSQP---------------TFANGLFGGFS-RILKEEGVGSFYNGFTPILFKQIP 178

Query: 291 STAISLWSYE 300
                 + +E
Sbjct: 179 YNIAKFFVFE 188

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 20 VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---ILKREGIRGFWKGNVPGSI 76
          +AG++      + + P+D VK ++Q+ P   N  ++ +   I+  EG      G  P  +
Sbjct: 18 LAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLL 77

Query: 77 MYIIYGGAQFGSY 89
           Y + G  +FG Y
Sbjct: 78 GYSLQGSFKFGGY 90

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 6/182 (3%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR---EGI-R 65
           ++       +++ SL  + A     P + +K + Q    N +   L  IL+    EG+ R
Sbjct: 88  EQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVR 147

Query: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125
           G ++G     +  I +   QF  Y Y+        ++         + GSLAG  ++ A+
Sbjct: 148 GLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAAT 207

Query: 126 YPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYE 185
            P DVL+TR   + +   + +      ++  EG   FF G G   + I    AI  GVYE
Sbjct: 208 TPLDVLKTRMMLHER--RVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYE 265

Query: 186 SI 187
           ++
Sbjct: 266 AV 267

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 81/198 (40%), Gaps = 36/198 (18%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           L S + G+ AG ++ +  +P D L+TR  A                + + G  G + G G
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG------------GFFHNGGYRGIYRGLG 53

Query: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNE-----LAGPISGFTSKLA 222
           S+++      ++ F  Y+S+K   ++   +  R      L E     L+  +   ++ L 
Sbjct: 54  SAVVASAPGASLFFVTYDSMK---QQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLV 110

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVT 282
             P + +++R Q  ++ +  +  R   +D             G  +V+      LYRG  
Sbjct: 111 RVPAEVIKQRTQTHHTNSSLQTLRLILRD-----------PTGEGVVR-----GLYRGWW 154

Query: 283 MSLIKSVPSTAISLWSYE 300
            ++++ +P T I    YE
Sbjct: 155 TTIMREIPFTCIQFPLYE 172

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 121/297 (40%), Gaps = 53/297 (17%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SLV+G+ +G        P+DT+K +LQ                  G RG ++G       
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKG---------GFFHNGGYRGIYRGLGSAVVA 58

Query: 71  NVPG-SIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           + PG S+ ++ Y   +      +G   R      ++  L   L  SL  M++ L   P +
Sbjct: 59  SAPGASLFFVTYDSMKQQLRPVMG---RWTASEQLAEVLTHMLSSSLGEMSACLVRVPAE 115

Query: 130 VLRTR---FAANSQGQLIK--LRDEIMAIWSHEGLM-GFFSGCGSSMINIGLNTAIMFGV 183
           V++ R      NS  Q ++  LRD      + EG++ G + G  ++++     T I F +
Sbjct: 116 VIKQRTQTHHTNSSLQTLRLILRDP-----TGEGVVRGLYRGWWTTIMREIPFTCIQFPL 170

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
           YE +K   ++ +  ++          + G ++G  +  AT PLD ++ R+ +        
Sbjct: 171 YEYLK---KKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMML-------- 219

Query: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           H+R               L +  ++ ++EG    +RG+    +      AI L  YE
Sbjct: 220 HERRVP-----------MLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYE 265

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI---NILKREGIRGF 67
           E VS     V GSL+G  A     PLD +K ++ +  H +   +L     + + EG R F
Sbjct: 185 ERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMML--HERRVPMLHLARTLFREEGARVF 242

Query: 68  WKGNVPGSIMYIIYGGAQF-GSYTYIGSFL 96
           ++G  P + M+I  GGA F G Y  + S  
Sbjct: 243 FRGIGPRT-MWISAGGAIFLGVYEAVHSLF 271

>Kwal_23.3529
          Length = 395

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 116/288 (40%), Gaps = 28/288 (9%)

Query: 31  TCIAPLDTVKIKLQVTPHNKNANVLIN----ILKREGIR-GFWKGNVPGSIMYIIYGGAQ 85
           + +  LDTVK + Q  P+      +I+    I   EGIR G + G     +         
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIF 160

Query: 86  FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG-MTSSLASYPFDVLRTRFAA------- 137
           FG+Y      L     +N   +  S L   L+G + SS+   P +VL+TR          
Sbjct: 161 FGTYELTKRKLIDDWGVN---ETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNP 217

Query: 138 --NSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERS 195
             +S      LRD I AI   EG    F G  +++      +A  F  YE  + +     
Sbjct: 218 HFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLE 277

Query: 196 KLSDRRDPFTLLNELAGPISGFTSK-LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYK 254
             +  +D  +LLNEL    +      + T P+D ++ RIQ +  P+    D      I  
Sbjct: 278 GKTPSQD-LSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQ-MPSTVASDSTRLVRIEN 335

Query: 255 SYKNRRFLGVGISMV-QQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
           S      L  G++ V + EG L  + GV    I +   ++I L  Y++
Sbjct: 336 S------LIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQV 377

>Scas_705.9
          Length = 323

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/307 (19%), Positives = 120/307 (39%), Gaps = 49/307 (15%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNAN-----------------VL 55
           +S   S + G+++   A   + PLD  K  +Q     K  +                  L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 56  INILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIG------SFLRG--GLDLNISPQ 107
           I I ++ G+RG ++G         +     F  Y+++         LR      +N    
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSIST 120

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIW--SHEGLMGFFSG 165
           +   +VG  A   + + + P +V+ T+         +     +  I+  S+  L  ++ G
Sbjct: 121 VEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKG 180

Query: 166 CGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLL---NELAGPISGFTSKLA 222
              S+I + +N +I F  Y+  K    ++   S++     L    N + G ++   S + 
Sbjct: 181 FKVSLI-LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTII 239

Query: 223 TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVT 282
           T PL  +  ++ ++ S ++ +H  E  + +YK                +EG L+L++GV 
Sbjct: 240 TQPL--IVAKVSLQRSNSKFKHFEEVLRYLYK----------------EEGVLALWKGVG 281

Query: 283 MSLIKSV 289
             L K V
Sbjct: 282 PQLTKGV 288

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/182 (18%), Positives = 74/182 (40%), Gaps = 15/182 (8%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIR------G 66
           +ST   L+ G  +    +    P++ +  K Q T    N +   ++LK+  +        
Sbjct: 118 ISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVD-FYSVLKQIYVESNGKLSS 176

Query: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL---DLNISPQL---YSCLVGSLAGMT 120
           +WKG    S++  +     F +Y      L   +   + + S QL    + ++G+LA + 
Sbjct: 177 YWKG-FKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKII 235

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM 180
           S++ + P  V +      S  +     + +  ++  EG++  + G G  +    L   ++
Sbjct: 236 STIITQPLIVAKVSL-QRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLV 294

Query: 181 FG 182
           F 
Sbjct: 295 FA 296

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 2/78 (2%)

Query: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT--PHNKNANVLINILKREGIRGFWK 69
           +++   + + G+L+ + +     PL   K+ LQ +         VL  + K EG+   WK
Sbjct: 219 QLTVNQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWK 278

Query: 70  GNVPGSIMYIIYGGAQFG 87
           G  P     ++  G  F 
Sbjct: 279 GVGPQLTKGVLVQGLVFA 296

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 91/226 (40%), Gaps = 15/226 (6%)

Query: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV---------TPHNKNANVLINILKREGIRGFWK 69
            V+G+ +G+     + PLD VK ++Q+           +N   + L  I+KREG    +K
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           G     +M       +F          +    ++   Q  S L GSLAG+T +    PF+
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFE 131

Query: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKI 189
           +++ R   +   +     + +       G++  ++G  S+M          FGV   I+ 
Sbjct: 132 LVKIRL-QDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRA 190

Query: 190 FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFP-LDTVRRRIQ 234
              +    +++    T  + +AG I G+         L  V+ RIQ
Sbjct: 191 LLPKAKTNTEK----TTNDLIAGTIGGYCRYSTEHTILSVVKSRIQ 232

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 58/139 (41%), Gaps = 9/139 (6%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF---AANSQGQLIKLR---DEIMAIWSHEGL 159
           P +Y  + G+ AG++  L  YP DV++TR      +  G  +      D +  I   EG 
Sbjct: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66

Query: 160 MGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTS 219
              + G  S M+      A  F   +S +   ++   +       ++   L+G ++G T 
Sbjct: 67  SRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI---LSGSLAGVTE 123

Query: 220 KLATFPLDTVRRRIQIRNS 238
                P + V+ R+Q  NS
Sbjct: 124 ACVIVPFELVKIRLQDVNS 142

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 78/195 (40%), Gaps = 13/195 (6%)

Query: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV--TPHNKNANVLINILKREGIRGFW 68
           ++++   S+++GSL+G+     I P + VKI+LQ   +  N    V+   ++  GI   +
Sbjct: 105 DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLY 164

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTS-SLASYP 127
            G          + G  FG    I + L      N        + G++ G    S     
Sbjct: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKA-KTNTEKTTNDLIAGTIGGYCRYSTEHTI 223

Query: 128 FDVLRTRFAAN-----SQGQLIKLRD----EIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178
             V+++R  +      + G ++   +     +  I+S EG    + G    ++ +G    
Sbjct: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGG 283

Query: 179 IMFGVYESIKIFTEE 193
           IM  V+  +  F +E
Sbjct: 284 IMLVVFNGMMAFFQE 298

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 23/97 (23%)

Query: 9   KDEEVSTTNSLVAGSLSGLFAR--TCIAPLDTVKIKLQ------------VTPHNKNANV 54
           K     TTN L+AG++ G + R  T    L  VK ++Q            V  +N     
Sbjct: 196 KTNTEKTTNDLIAGTIGG-YCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254

Query: 55  LINILKREGIRGFWKGNVP--------GSIMYIIYGG 83
           L  I   EG    +KG +P        G IM +++ G
Sbjct: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNG 291

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 123/310 (39%), Gaps = 43/310 (13%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP---------HNKNANVLINILK 60
           D  VS   S  A   +   A T   P++TVK +LQ+           ++  A  +  I +
Sbjct: 6   DTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYR 65

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN------ISPQLYSCLVG 114
            EG+RG  +G        I+  G++ G Y  + + L GG  L+       +    +   G
Sbjct: 66  TEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAAL-GGCVLSDRRTYGTAALAVNATAG 124

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRD----EIMAIWSHEGLMGFFSGCGSSM 170
           + AGM  +    P  +++TR  A +  ++  L       ++A++   G+ G + G  +++
Sbjct: 125 AAAGMIGAALGSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAAL 184

Query: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230
           +  G+ +A+   VY   K        LS        L  LA  +S     +A  P D   
Sbjct: 185 LRTGVGSAVQLAVYSHAK------EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAM 238

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
            R+          H R     +Y     R  L      V+QEG  +LY+G    L++  P
Sbjct: 239 TRMY---------HHR---GGLY-----RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281

Query: 291 STAISLWSYE 300
            T + L   E
Sbjct: 282 HTILCLTLME 291

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 134/337 (39%), Gaps = 87/337 (25%)

Query: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKI-------------KLQVTP------------ 47
           +++  S ++G+++   A T + PLD VK              +L+  P            
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 48  --------------HNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIG 93
                         +N   + +  I K+EGIRG ++G +  S+M    G  Q  SY +  
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQG-LTTSVM---AGFFQTFSYFFWY 116

Query: 94  SFLRGGLD----LNISPQLYSC----LVGSLAGMTSSLASYPFDVL----RTRFAANSQG 141
           SF+R        +N     ++     L+G +A  TS + + P  ++    +TR   +   
Sbjct: 117 SFVRKCYFRVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDN 176

Query: 142 QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFTEERSKL-- 197
             + +  EI        + GF+ G   S++ + +N +I +  YE +K  +FT +   L  
Sbjct: 177 DFLTVAKEIYK--EQRSIKGFWKGLKVSLM-LTINPSITYTSYEKLKDALFTTDTMNLKK 233

Query: 198 -----SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDI 252
                S +  P+   N   G +S   S + T PL   +  +Q RN  N       F + +
Sbjct: 234 ELVDSSSQLSPYQ--NFTLGVLSKMISAIITMPLIISKAWLQ-RNGSNFS----SFQQVL 286

Query: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
           Y  YKN             EG  S ++G++  L K V
Sbjct: 287 YYLYKN-------------EGLRSWWKGLSPQLAKGV 310

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 79/178 (44%), Gaps = 32/178 (17%)

Query: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF--------TEERSKLSD 199
           D I  I+  EG+ G + G         L T++M G +++   F           R KL +
Sbjct: 80  DAIYKIYKQEGIRGLYQG---------LTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLIN 130

Query: 200 RRD-PFTLLNELA-GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257
           R++  FT + EL  G ++  TS++ T P+  +  R Q R   + +       K+IYK  +
Sbjct: 131 RKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKEQR 190

Query: 258 NRR--FLGVGISMVQQEGPL-----------SLYRGVTMSLIKSVPSTAISLWSYELF 302
           + +  + G+ +S++    P            +L+   TM+L K +  ++  L  Y+ F
Sbjct: 191 SIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNF 248

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILK 60
           KK+ +    ++S   +   G LS + +     PL   K  LQ    N ++   VL  + K
Sbjct: 232 KKELVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLYYLYK 291

Query: 61  REGIRGFWKGNVP 73
            EG+R +WKG  P
Sbjct: 292 NEGLRSWWKGLSP 304

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 104/259 (40%), Gaps = 34/259 (13%)

Query: 44  QVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL------ 96
           Q     K A + L  I   EG+ G ++G    ++   I   + F  YT +          
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQA 126

Query: 97  RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQ-LIKLRDEIMAIWS 155
           RGG     +P+    ++G +A  TS L   P +V+ TR     Q      +R     + +
Sbjct: 127 RGGDARFSTPE--ELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHA 184

Query: 156 HEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRDPFTLL----NEL 210
             G  GF++G   S++ + +N +I +  YE ++       +  S   D   LL    N +
Sbjct: 185 ENGWRGFWAGLKVSLV-LTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFV 243

Query: 211 AGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQ 270
            G +S   S + T PL   +  +Q   S  ++ H  +    +Y +               
Sbjct: 244 MGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFH--QVLHHLYST--------------- 286

Query: 271 QEGPLSLYRGVTMSLIKSV 289
            EGPLSL++G+   + K V
Sbjct: 287 -EGPLSLWKGLGPQITKGV 304

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 95/203 (46%), Gaps = 21/203 (10%)

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS---HEGLM- 160
           SP L+  L G + G       +  D ++TR    + G+ +K R  I A  +    EG+  
Sbjct: 51  SPLLHCVLAGGIGGAIGDSVMHSLDTVKTR-QQGAPGE-VKYRHMISAYRTLALEEGVRR 108

Query: 161 GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSK 220
           G + G G++M+    + A+ FG YE +K     R  +++ +   T  +  AG +    S 
Sbjct: 109 GLYGGYGAAMLGSFPSAAVFFGTYEWVK-----RQMINEWQIHETYSHLAAGFLGDLFSS 163

Query: 221 LATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGI-SMVQQEGPLSLYR 279
           +   P + ++ R+Q++   N  RH        ++S  N R L   + ++V+ EG  +L+ 
Sbjct: 164 VVYVPSEVLKTRLQLQGCYN-NRH--------FQSGYNYRGLSDAVRTIVRTEGVSALFF 214

Query: 280 GVTMSLIKSVPSTAISLWSYELF 302
           G   +L + +P +A+    YE F
Sbjct: 215 GYKATLSRDLPFSALQFAFYERF 237

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 29/200 (14%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN------------ANVLINILKRE 62
           T + L AG L  LF+     P + +K +LQ+     N            ++ +  I++ E
Sbjct: 148 TYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTE 207

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYI--GSFL--RGGLDLNISPQLYSCLVGSLAG 118
           G+   + G        + +   QF  Y      +FL  R  +D ++S      + G+ AG
Sbjct: 208 GVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTA-EVVTGASAG 266

Query: 119 MTSSLASYPFDVLRTRFAANSQGQL--------IKLRDEI----MAIWSHEGLMGFFSGC 166
             + + + P DV++TR     +G           +L   I    + +  +EGL G FSG 
Sbjct: 267 GLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGV 326

Query: 167 GSSMINIGLNTAIMFGVYES 186
           G   I   + ++IM  +Y++
Sbjct: 327 GPRFIWTSIQSSIMLLLYQT 346

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 89/218 (40%), Gaps = 22/218 (10%)

Query: 36  LDTVKIKLQVTPHNKNANVLINILK----REGI-RGFWKGNVPGSIMYIIYGGAQFGSYT 90
           LDTVK + Q  P       +I+  +     EG+ RG + G     +         FG+Y 
Sbjct: 74  LDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYE 133

Query: 91  YIGSFLRGGLDLNISPQLYSCL-VGSLAGMTSSLASYPFDVLRTRFAA---------NSQ 140
           ++   +     ++   + YS L  G L  + SS+   P +VL+TR             S 
Sbjct: 134 WVKRQMINEWQIH---ETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSG 190

Query: 141 GQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFTEERSKLS 198
                L D +  I   EG+   F G  +++      +A+ F  YE  +   F  ER K  
Sbjct: 191 YNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLER-KPV 249

Query: 199 DRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIR 236
           D    FT    + G  +G  + + T PLD V+ RIQ +
Sbjct: 250 DGHLSFT-AEVVTGASAGGLAGIITTPLDVVKTRIQTQ 286

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 74/180 (41%), Gaps = 23/180 (12%)

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGC 166
           +L   + GSL G  S   +YP   + T           KL + I  I++  G++G+F G 
Sbjct: 11  ELAHAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKL-ETIKEIYNKNGIIGYFLGL 69

Query: 167 GSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPL 226
            S++  +     + +  YE      +    L+ ++   T  + LA  I+G  + +A+ P+
Sbjct: 70  ESAVYGMATTNFVYYYFYEWC---AKTARTLTTKQYLSTWESILASTIAGSMTAVASNPI 126

Query: 227 DTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLI 286
                R+ +  S                   N   L   I +V+ +GPL+L  G+  +L+
Sbjct: 127 WVANTRMTVAKS-------------------NHSTLRTVIDIVKTDGPLTLLNGLKPALV 167

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 80/182 (43%), Gaps = 12/182 (6%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIR 65
           L   + +ST  S++A +++G        P+     ++ V   N +    +I+I+K +G  
Sbjct: 97  LTTKQYLSTWESILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRTVIDIVKTDGPL 156

Query: 66  GFWKGNVPGSIMY---IIYGGAQFGSYTYIGSF-LRGGLDLNISPQLYSCLVGSLAGMTS 121
               G  P  ++    II    Q+  Y  + +  LR      +SP  ++ L+G++  + +
Sbjct: 157 TLLNGLKPALVLVSNPII----QYTVYEQLKNLVLRLQRKKVLSPS-WAFLLGAIGKLAA 211

Query: 122 SLASYPFDVLRTR--FAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAI 179
           +  +YP+  L+TR     N       +   I+ I   +G+ G ++G    ++   +  A 
Sbjct: 212 TGTTYPYITLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMTAAF 271

Query: 180 MF 181
           +F
Sbjct: 272 LF 273

>Scas_613.24
          Length = 177

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 78/181 (43%), Gaps = 26/181 (14%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWK 69
           D+   T+  LV+G + GL +   + PLD +K ++Q    +K A +   I   +    FW+
Sbjct: 3   DKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQ---QHKGATLWSAIKDIKDPIQFWR 59

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSF--LRGGL----------DLNISPQLY---SCLVG 114
           G +P ++          GS  Y+     +R  L            +  PQL    + L G
Sbjct: 60  GTLPSALR------TSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTG 113

Query: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174
           ++A       + P  +L+ R+ +        + + I  I+  EG+ GFF G G + + IG
Sbjct: 114 AMARGLVGYITMPITILKVRYESTYY-SYKSMNEAIKDIYKMEGISGFFKGFGPT-VGIG 171

Query: 175 L 175
           +
Sbjct: 172 I 172

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 88/238 (36%), Gaps = 31/238 (13%)

Query: 23  SLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIRGFWKGNVPGSI 76
           +L G+ A     + I PLD VK +LQV P  +  N      I+  EG +  + G     +
Sbjct: 22  TLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFV 81

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFA 136
            Y + G  ++G Y Y        L   ++  L          M S+ A +  D++   F 
Sbjct: 82  GYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYL----------MASATAEFLADIMLCPFE 131

Query: 137 A---NSQGQLIKLRDEIMAIWSHE-----GLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           A     Q  +    + ++  W        G+  F+ G           T   F  +E  K
Sbjct: 132 AIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE--K 189

Query: 189 IFTEERSKLSDRRDPFTLLNELA-----GPISGFTSKLATFPLDTVRRRIQIRNSPNE 241
           I  +  S L  +++    L +++     G ++G      + P D +  +I      NE
Sbjct: 190 IVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE 247

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 7/173 (4%)

Query: 23  SLSGLFARTCIAPLDTVKIKLQVTPHNKNANV--LINILKREGIRGFWKGNVPGSIMYII 80
           +++  FA   + PL+  +I+L   P   N  V     ILK EGI  F+ G  P     I 
Sbjct: 121 AIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIP 180

Query: 81  YGGAQFGSYTYIGS--FLRGGLDLNISPQLYSCL---VGSLAGMTSSLASYPFDVLRTRF 135
           Y  A+F  + +  +  F   G   N+S    + +    G  AG+ +++ S P D L ++ 
Sbjct: 181 YNIAKFVVFEHAANAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKV 240

Query: 136 AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
               +         +M +    G +G F+G  + ++ +G  T++ FG+Y  +K
Sbjct: 241 NKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKLK 293

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 71/187 (37%), Gaps = 32/187 (17%)

Query: 111 CLVGSLAGMTSSLASYPFDVLRTRFAAN----SQGQLIKLRDEIMAIWSHEGLMGFFSGC 166
            L G++    +  A  P DV++TR        S G +   R     I   EG     +G 
Sbjct: 19  ALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRK----IVGEEGAAALLTGF 74

Query: 167 GSSMINIGLNTAIMFGVYESI-KIFTEE--RSKLSDRRDPFTLLNELAGPISGFTSKLAT 223
           G +++   +  A  FG YE   K F +          R P  + +     I+ F + +A 
Sbjct: 75  GPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSA---AIAEFFADIAL 131

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            PL+    RI++ + P        F   +   +           ++++EG  S Y G T 
Sbjct: 132 CPLEAT--RIRLVSQPT-------FANGLVGGFAR---------ILKEEGIGSFYNGFTP 173

Query: 284 SLIKSVP 290
            L K +P
Sbjct: 174 ILFKQIP 180

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 64/153 (41%), Gaps = 9/153 (5%)

Query: 20  VAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLIN---ILKREGIRGFWKGNVPGSI 76
           +AG++      + + P+D VK ++Q+ P   ++ ++ +   I+  EG      G  P  +
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 77  MYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL-VGS--LAGMTSSLASYPFDVLRT 133
            Y + G  +FG Y          L    + Q  + + +GS  +A   + +A  P +  R 
Sbjct: 80  GYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRI 139

Query: 134 RFAANSQGQLIK-LRDEIMAIWSHEGLMGFFSG 165
           R    SQ      L      I   EG+  F++G
Sbjct: 140 RLV--SQPTFANGLVGGFARILKEEGIGSFYNG 170

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 102/250 (40%), Gaps = 42/250 (16%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN-----------------ANVLINILK 60
              AG+++G+     + PLD VK ++Q+    K                   + L  I+K
Sbjct: 14  QFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVK 73

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR-------GGLDLNISPQLYSCLV 113
           +EG    +KG     +M       +F       +F +       G +   I+  +YS   
Sbjct: 74  KEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIA--IYS--- 128

Query: 114 GSLAGMTSSLASYPFDVLRTRFA-ANSQGQ--LIKLRDEIMAIWSHEGLMGFFSGCGSSM 170
           G+ AG   +    PF++++ R    NSQ +  +  +++ ++      G++  F+G  +++
Sbjct: 129 GASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVV----KGGVLSLFNGLEATI 184

Query: 171 INIGLNTAIMFGVYESI-KIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTV 229
               L  A  FG+   I K+    ++     R+     + +AG I G    L   P D V
Sbjct: 185 WRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRN-----DLIAGAIGGTVGCLLNTPFDVV 239

Query: 230 RRRIQIRNSP 239
           + RIQ  + P
Sbjct: 240 KSRIQRSSGP 249

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 81/196 (41%), Gaps = 7/196 (3%)

Query: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ-VTPHNKNA-NVLINILK 60
           KK     + E++   ++ +G+ +G      +AP + VKI+LQ V    K    V+ N + 
Sbjct: 110 KKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVV 169

Query: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT 120
           + G+   + G       ++++    FG    I   L      +        + G++ G  
Sbjct: 170 KGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAA-KTSTEKTRNDLIAGAIGGTV 228

Query: 121 SSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177
             L + PFDV+++R    S G L K       ++ ++  EG    + G    ++ +    
Sbjct: 229 GCLLNTPFDVVKSRI-QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGG 287

Query: 178 AIMFGVYESIKIFTEE 193
            ++  V+ ++  F  E
Sbjct: 288 GLLLVVFTNVMDFFRE 303

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 8/110 (7%)

Query: 195 SKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSP--NEERHDREFTKDI 252
           + + +R  PF +    AG I+G +  L  +PLD V+ R+Q++ +   +      +   D 
Sbjct: 2   TSIDNRPLPF-IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDH 60

Query: 253 YKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302
           Y        +     +V++EG   LY+G+T  ++   P  AI     + F
Sbjct: 61  YTG-----VMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTF 105

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 59/152 (38%), Gaps = 25/152 (16%)

Query: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTR--FAANSQG------------QLIKLRDEIM 151
           P +Y    G++AG++  L  YP DV++TR      ++G                + D + 
Sbjct: 10  PFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLT 69

Query: 152 AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI-----KIFTEERSKLSDRRDPFTL 206
            I   EG    + G  S ++      AI F   ++      KIF     +++ +      
Sbjct: 70  KIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQK------ 123

Query: 207 LNELAGPISGFTSKLATFPLDTVRRRIQIRNS 238
           +   +G  +G        P + V+ R+Q  NS
Sbjct: 124 IAIYSGASAGAVEAFVVAPFELVKIRLQDVNS 155

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 69/154 (44%), Gaps = 16/154 (10%)

Query: 48  HNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL----DLN 103
            N +  VL   L + G +      +P  ++    G   + +Y    SFLRG L    +  
Sbjct: 91  ENSSVGVLTRALNKYGWKVLPDRVLPPLVLNSAAGVVLYTTYLSSLSFLRGPLGAGGEHG 150

Query: 104 ISPQLYSCLV--GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHE---- 157
            SP   S +V  G +AG+  ++AS P D + TR  AN    L+    +  ++W +     
Sbjct: 151 QSPPRISDVVCAGFMAGVAQAVASAPIDAIYTRSTAN---DLLSSAKKYNSLWLYGIDKL 207

Query: 158 ---GLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188
              GL+G F G G S++   +  A+ F  +E +K
Sbjct: 208 KEIGLVGCFGGFGLSLVKESVGFAVYFTTFELLK 241

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQVTP----HNKNANVLINILKREGIRGFWKGNV 72
            +  AG+LS         P+D +K ++Q       +  + N    I   EG R  WKG V
Sbjct: 250 QAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWV 309

Query: 73  PGSIMYIIYGGAQFGSYTYI 92
           P      + GG  FG Y Y+
Sbjct: 310 PRLFKVSLSGGISFGVYQYV 329

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 67/154 (43%), Gaps = 8/154 (5%)

Query: 47  PHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP 106
           P +  A  ++ I +  G+RGF +G +P     +     +F +Y +I   L     L+   
Sbjct: 191 PSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALD--- 247

Query: 107 QLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLR-DEIMAIWSHEGLMGFFSG 165
           +  +   G+L+       + P DV++TR  + +     K   +    I+  EG    + G
Sbjct: 248 EYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKG 307

Query: 166 CGSSMINIGLNTAIMFGVYESIK----IFTEERS 195
               +  + L+  I FGVY+ ++    ++  ERS
Sbjct: 308 WVPRLFKVSLSGGISFGVYQYVENLVLLWEHERS 341

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 50/128 (39%), Gaps = 22/128 (17%)

Query: 110 SCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSS 169
           S + G+ A +  +  S+PF+ L+T        QL +      A         +FSGC + 
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKT------GQQLHRALPGAAAFNMLHPFKYYFSGCAAL 76

Query: 170 MINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGP-------ISGFTSKLA 222
            +   L T   F  +E   ++          RDP      +AGP       I+GF   L 
Sbjct: 77  NVGTLLKTGTRFATFEQACVWL---------RDPEHADQPIAGPRLLLAGAITGFLESLW 127

Query: 223 TFPLDTVR 230
             P ++++
Sbjct: 128 VVPFESIK 135

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 90/235 (38%), Gaps = 48/235 (20%)

Query: 32  CIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYT 90
           C+ P      +  + P +K+  +++ +IL  EGI+G WK N    I  I+    +     
Sbjct: 222 CLTP------ERSINPESKHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLEAWYTG 275

Query: 91  YIGSFLRGG----LDLNISPQLYSCLVGSLA-GMTSSLASYPFDVLRTRF---------- 135
            I   L       +DL   P   S ++ +L+ G+ ++L   P D++RTRF          
Sbjct: 276 LISPLLHIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRFIVTALYGTDT 335

Query: 136 ---------AANSQGQLIKLRDEIMAI-WSHEGL-----MGFFSGCGSSMINIGLNTAIM 180
                    AAN +     LR  I +  W H+ L     M   +    S+ N+  N  I 
Sbjct: 336 EVSEEASEGAANKKHDSRSLRHWIRSWSWRHDALKLPSDMWLLTML-QSVSNVSFNKLID 394

Query: 181 FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
             +Y    +         D+    T  N +   ++         P++ + RR Q+
Sbjct: 395 LVIYHKFHV---------DKYSQMTTYNTMK-VLARIAELFVKLPIECLLRRCQL 439

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 87/197 (44%), Gaps = 32/197 (16%)

Query: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCG 167
           + S + G+ AG ++ LA +P D L+TR  A                +++ G  G + G G
Sbjct: 7   IASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG------------GFFANGGYKGVYRGLG 54

Query: 168 SSMINIGLNTAIMFGVYESIKIFTE----ERSKLSDRRDPFTLLNELAGPISGFTSKLAT 223
           S+++    + ++ F  Y+S+K ++     +     + +   TL + ++      ++ +  
Sbjct: 55  SAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVR 114

Query: 224 FPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTM 283
            P + +++R Q   + +  +  +   ++     +N    G G+         +LYRG + 
Sbjct: 115 VPAEVIKQRTQTHRTNSSLQTLQALLRN-----EN----GEGLRR-------NLYRGWST 158

Query: 284 SLIKSVPSTAISLWSYE 300
           ++++ +P T I    YE
Sbjct: 159 TIMREIPFTCIQFPLYE 175

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 79/184 (42%), Gaps = 8/184 (4%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKRE---GIR 65
           +D+   T + +V+ S   + A     P + +K + Q    N +   L  +L+ E   G+R
Sbjct: 90  EDQTADTLSHMVSSSFGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLR 149

Query: 66  -GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124
              ++G     +  I +   QF  Y Y+            +      + G +AG  ++ A
Sbjct: 150 RNLYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAA 209

Query: 125 SYPFDVLRTRFAANSQG-QLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
           + P DVL+TR   + +    + L   ++     EG+  FFSG G   + I    AI  GV
Sbjct: 210 TTPLDVLKTRIMLHHKSVSALHLAKTML---QEEGVKVFFSGVGPRTMWISAGGAIFLGV 266

Query: 184 YESI 187
           YE++
Sbjct: 267 YETV 270

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 113/274 (41%), Gaps = 43/274 (15%)

Query: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKG------- 70
           SLV+G+ +G        P+DT+K +LQ                  G +G ++G       
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKG---------GFFANGGYKGVYRGLGSAVVA 59

Query: 71  NVP-GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129
           + P  S+ ++ Y   +  S   IG  L  G D   +  L   +  S   +++ +   P +
Sbjct: 60  SAPSASLFFVAYDSMKCWSRPVIGQLLPKGED-QTADTLSHMVSSSFGEISACMVRVPAE 118

Query: 130 VLRTRFAANSQGQLIKLRDEIMAIWSHEGL-MGFFSGCGSSMINIGLNTAIMFGVYESIK 188
           V++ R   +     ++    ++   + EGL    + G  ++++     T I F +YE +K
Sbjct: 119 VIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEYMK 178

Query: 189 I-FTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDRE 247
             + E + K  +R  P+     + G I+G  +  AT PLD ++ RI +            
Sbjct: 179 KRWAEVQGK--ERAAPWQ--GSVCGCIAGGIAAAATTPLDVLKTRIMLH----------- 223

Query: 248 FTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281
                   +K+   L +  +M+Q+EG    + GV
Sbjct: 224 --------HKSVSALHLAKTMLQEEGVKVFFSGV 249

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 8   RKDEEVST--TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH---------NKNANVLI 56
           R  EEV T   +   + S++ +  +  I P    ++K ++ P          + + N+  
Sbjct: 136 RYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFT 195

Query: 57  NI---LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV 113
            +   ++  G   F++G++P     +     +F +YT +   +     L+   + Y+  +
Sbjct: 196 TVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLS---EYYAFGI 252

Query: 114 GSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS---HEGLMGFFSGCGSSM 170
           G  +       + P DV++TR  +     L   R+ +  ++     EGL   + G    +
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSL--YRNSLNCVYRTFIEEGLTSLWKGWVPRL 310

Query: 171 INIGLNTAIMFGVYESI 187
             +GL+  + FGVY+ +
Sbjct: 311 FKVGLSGGVSFGVYQYV 327

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 8/79 (10%)

Query: 26  GLFARTCIA----PLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWKGNVPGSIM 77
           G+F+   +     P+D VK ++Q     + +  + N +      EG+   WKG VP    
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 78  YIIYGGAQFGSYTYIGSFL 96
             + GG  FG Y Y+ + +
Sbjct: 313 VGLSGGVSFGVYQYVDNLM 331

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 4/131 (3%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWK 69
           D   S  ++L+AGS + +F  T   P + +K   Q+     NA    N+     ++ ++ 
Sbjct: 3   DTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAF-NMFHH--VKSYFA 59

Query: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ-LYSCLVGSLAGMTSSLASYPF 128
           G    +I  ++    +F ++      L+   +       L     GS+ G   S+   PF
Sbjct: 60  GCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFMESMLIIPF 119

Query: 129 DVLRTRFAANS 139
           + ++TR   N+
Sbjct: 120 ENIKTRMIENA 130

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235
           N A+ FG Y  +K   +  +     +   +    L G +SG  +  AT P+DTV+ R+Q 
Sbjct: 182 NQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA 241

Query: 236 RNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
            ++              Y S      +G   ++V++EG  +L+RG T  L + V S  I 
Sbjct: 242 LDAAR------------YGST-----VGCFRAVVREEGVRALWRGATPRLGRLVLSGGIV 284

Query: 296 LWSYE 300
             +YE
Sbjct: 285 FTAYE 289

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 123/307 (40%), Gaps = 53/307 (17%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K + +S +N L+   L+     T   PL+ VK  +           + +I  R G+ GF+
Sbjct: 9   KKKPISFSNILLGAGLNMCEVTTLGQPLEVVKTTMAANRQFTFFQAINHIWSRGGVFGFY 68

Query: 69  KGNVP---------GSIMYIIYGGAQFG----SYTYIGSFLRGGLDLNISPQLYSCLVGS 115
           +G +P         G+++  +   A++          G+ + GG+   ++ Q Y  +   
Sbjct: 69  QGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGLNNFGAGIMGGVSGGVA-QAYLTM--- 124

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175
             G  + + +      ++  A   Q      ++    I++ EG+ G   G  +  I    
Sbjct: 125 --GFCTCMKTVEITKHKSAAAGAKQSSWAAFKE----IYNKEGIRGINKGVNAVAIRQMT 178

Query: 176 NTAIMFG----VYESIKIFTEERSKLSDRRDPFTLLNEL-AGPISGFTSKLATFPLDTVR 230
           N    FG    V E ++ FT +    ++  D  T L ++ A  I G  S     P++ + 
Sbjct: 179 NWGSRFGFSRLVEEGLRKFTGK----TNPDDKLTALEKIFASAIGGGLSAWNQ-PIEVI- 232

Query: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290
            R+++++  N+    ++ T  + K+++          + Q  G   LYRGVT       P
Sbjct: 233 -RVEMQSKTNDPNRPKDLT--VGKAFR---------YIYQSNGVKGLYRGVT-------P 273

Query: 291 STAISLW 297
              + +W
Sbjct: 274 RIGLGIW 280

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 78/206 (37%), Gaps = 38/206 (18%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVK---IKLQVTPHNK--------NANVLIN-------- 57
           N L+AG+L+G+     I P + +K   I+  +  H K        NA    +        
Sbjct: 77  NLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTP 136

Query: 58  -------------ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNI 104
                        + +  G   F +G        I     QF +YT     L+   D   
Sbjct: 137 VARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARND--- 193

Query: 105 SPQLYSCLVGSLAGMTSSLASYPFDVLRTRF-AANSQGQLIKLRDEIMAIWSHEGLMGFF 163
             +  S + G     T    + P DV++TR  + N++ +     + +  I+  EG+  F+
Sbjct: 194 --KASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFW 251

Query: 164 SGCGSSMINIGLNTAIMFGVYESIKI 189
            G     + +G++  + F VYE + +
Sbjct: 252 KGSIFRFMKVGISGGLTFTVYEQVSL 277

 Score = 34.7 bits (78), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 16/131 (12%)

Query: 145 KLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPF 204
           KL   +  ++   G   F  G  +++     NT+I F  Y + K   + R+   D+    
Sbjct: 142 KLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN---DKAS-- 196

Query: 205 TLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHD-----REFTKDIYKSYKN- 258
              + + G  + FT    T P+D V+ R+  +N+  E ++      R F ++   ++   
Sbjct: 197 ---SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

Query: 259 --RRFLGVGIS 267
              RF+ VGIS
Sbjct: 254 SIFRFMKVGIS 264

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 4/84 (4%)

Query: 17  NSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLINILKREGIRGFWKGNV 72
           +S++ G  +         P+D VK ++      T +    N +  I  +EG+  FWKG++
Sbjct: 196 SSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSI 255

Query: 73  PGSIMYIIYGGAQFGSYTYIGSFL 96
              +   I GG  F  Y  +   L
Sbjct: 256 FRFMKVGISGGLTFTVYEQVSLLL 279

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 75/193 (38%), Gaps = 25/193 (12%)

Query: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
           +YPF+ L+T      +G       EI+       +  +F GC +  +     T + F  +
Sbjct: 2   TYPFEYLKTGLQLQPKGTAF----EIIL----PQIKSYFVGCSALNVAAFGKTILRFVTF 53

Query: 185 ESIK---IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNE 241
           + +        + +    R   + LL  +AG ++G    L   P + ++  +      + 
Sbjct: 54  DKLCHSLNNNIDNNDNFQRLTGYNLL--IAGTLTGIVESLFIIPFENIKTTLIQSAMIDH 111

Query: 242 ERHDRE---------FTKDIYKS---YKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
           ++ ++          F K   KS    +  + L     M Q  GP +  +G T ++ + +
Sbjct: 112 KKLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQI 171

Query: 290 PSTAISLWSYELF 302
            +T+I   +Y  F
Sbjct: 172 ANTSIQFTAYTAF 184

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 114/294 (38%), Gaps = 38/294 (12%)

Query: 31  TCIAPLDTVKIKLQVTPHNKNANVLI----NILKREGIRGFWKGNVPGSIMYIIYGGAQ- 85
           + +  LDTVK + Q  P       +I     I+  EG+R    G   G+++      A  
Sbjct: 71  SAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIF 130

Query: 86  FGSYTYIGSFLRGGLDLNISPQLYSCL-VGSLAGMTSSLASYPFDVLRTRFAAN------ 138
           F +Y Y    + G   +N   + +S L  G L    SS    P +VL+TR          
Sbjct: 131 FATYEYTKRKMIGEWGIN---ETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNP 187

Query: 139 ---SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK--IFTEE 193
              S      L D +  I   EG    F G  +++      + + F  YE  +   F  E
Sbjct: 188 FFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVE 247

Query: 194 RSKLSDRRDPFTLLNE-LAGPISGFTSKLATFPLDTVRRRIQ-----IRNSPNEERHDRE 247
                +     +L NE + G  +G  + + T PLD V+ RIQ     I  + ++    + 
Sbjct: 248 NKTFDED---LSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQT 304

Query: 248 FTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301
            T  I K           +++ + EG   L+ GV    I +   ++I L  Y++
Sbjct: 305 LTNSITKGM---------MTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQV 349

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 89/219 (40%), Gaps = 38/219 (17%)

Query: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN------------ANVLINILKRE 62
           T + L AG L    +     P + +K +LQ+     N             + +  I++RE
Sbjct: 150 TFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRRE 209

Query: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG------GLDLNISPQLYSCLVGSL 116
           G    + G        + + G QF  Y                 DL++S ++   + G+ 
Sbjct: 210 GWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEI---ITGAA 266

Query: 117 AGMTSSLASYPFDVLRTRFAA-------NSQGQLIK------LRDEIMAIWSHEGLMGFF 163
           AG  + + + P DV++TR          NS   L +      +   +M ++  EGL G F
Sbjct: 267 AGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLF 326

Query: 164 SGCGSSMINIGLNTAIMFGVYE-SIKIFTEERSKLSDRR 201
           SG G   I   + ++IM  +Y+ ++K      SKLSD +
Sbjct: 327 SGVGPRFIWTSIQSSIMLLLYQVALKTL---DSKLSDEK 362

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 24/96 (25%)

Query: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT----PHNKNANV----------- 54
           DE++S +N ++ G+ +G  A     PLD VK ++Q      P N + N+           
Sbjct: 252 DEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITK 311

Query: 55  -LINILKREGIRGFWKG--------NVPGSIMYIIY 81
            ++ + K EG+ G + G        ++  SIM ++Y
Sbjct: 312 GMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>Scas_671.1*
          Length = 123

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 6  HLRKDEEVSTTNSLVAGSLSGL----FARTCIAPLDTVKIKLQVTPH--NKNANVLINIL 59
          H ++D + ST+ S V  S+S +     A    AP DT+K ++Q+ P         L+ I 
Sbjct: 26 HYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVLIT 85

Query: 60 KREGIRGFWKG 70
          K E I   + G
Sbjct: 86 KNESIFQLFSG 96

 Score = 31.2 bits (69), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 110 SCLVGSLAGMTS-SLASY---PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSG 165
           S +V S++ + S SLA+    PFD ++TR     +         ++ I  +E +   FSG
Sbjct: 38  STVVNSVSAIASASLATAITAPFDTIKTRMQLKPK-VFTNFFTTLVLITKNESIFQLFSG 96

Query: 166 CGSSMINIGLNTAIMFGVYESI 187
               +    L+  I +G+YE +
Sbjct: 97  LSMRLTRKALSAGIAWGIYEDL 118

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 120/302 (39%), Gaps = 42/302 (13%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           + + VS +N L+   L+     T   PL+ VK  +    +      + ++  R GI G++
Sbjct: 14  EKKPVSFSNILLGACLNLSEVTTLGQPLEVVKTTMAANRNFTFLESVKHVWSRGGILGYY 73

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG------MTSS 122
           +G +P + +     GA     +    +    L LN      S ++G + G      +T  
Sbjct: 74  QGLIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLN---NFASGILGGVTGGVTQAYLTMG 130

Query: 123 LASYPFDVLRTRFAANSQGQLIKLRDEIMA-IWSHEGLMGFFSGCGSSMINIGLNTAIMF 181
             +    V  TR  + S G + +    +   I+  EG+ G   G  +  I    N    F
Sbjct: 131 FCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQMTNWGSRF 190

Query: 182 G----VYESIKIFTEERSKLSDRRDPFTLL--NELAGPISGFTSKLATFPLDTVRRRIQI 235
           G    V + I+  T + +K  D+ +PF  +  + L G +S +       P++ +R  +Q 
Sbjct: 191 GLSRLVEDGIRKITGKTNK-DDKLNPFEKIGASALGGGLSAWNQ-----PIEVIRVEMQS 244

Query: 236 RNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295
           +    +E  +R     + K++K          + Q  G   LYRGVT       P   + 
Sbjct: 245 K----KEDPNRPKNLTVGKTFK---------YIYQSNGLKGLYRGVT-------PRIGLG 284

Query: 296 LW 297
           +W
Sbjct: 285 IW 286

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 60/304 (19%), Positives = 120/304 (39%), Gaps = 43/304 (14%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           + + VS +N L+   L+     T   PL+ VK  +             ++  R GI GF+
Sbjct: 6   EKKPVSFSNILLGAGLNLSEVTTLGQPLEVVKTTMAAHREFNFLQATKHVWSRGGIFGFY 65

Query: 69  KGNVP---------GSIMYIIYGGAQFG----SYTYIGSFLRGGLDLNISPQLYSCLVGS 115
           +G +P         G+++  +   A++          G+ + GG+   ++ Q Y  +   
Sbjct: 66  QGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGAGIMGGITGGVT-QAYLTM--- 121

Query: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIM-AIWSHEGLMGFFSGCGSSMINIG 174
             G  + + +   ++ R + AAN  G + +   ++  +I+  EG+ G   G  +  I   
Sbjct: 122 --GFCTCMKT--VEITRQK-AANVPGVIPQSSWQVFKSIYKKEGIRGINKGVNAVAIRQM 176

Query: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234
            N    FG+   ++    + +  + + D  T L ++     G        P++ +R  +Q
Sbjct: 177 TNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAWNQPIEVIRVEMQ 236

Query: 235 IRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294
            +    +E  +R     + K++K          + Q  G   LYRGVT       P   +
Sbjct: 237 SK----KEDPNRPKNLTVGKTFK---------YIYQSNGLKGLYRGVT-------PRVGL 276

Query: 295 SLWS 298
            +W 
Sbjct: 277 GIWQ 280

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 71/319 (22%), Positives = 127/319 (39%), Gaps = 65/319 (20%)

Query: 5   DHLRKD---EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKR 61
           +H  KD   + VS +N  +  +L+     T   PL+  K  +        +  + ++  R
Sbjct: 4   EHGPKDLQKKPVSFSNIALGAALNMCEVTTLGQPLEVTKTTMAANRQFGFSQAVRHVWSR 63

Query: 62  EGIRGFWKGNVP---------GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCL 112
            G+ GF++G +P         G+++  +   A++        F R GL  N    +   +
Sbjct: 64  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEY-------QFRRLGLS-NFGAGILGGV 115

Query: 113 VGSLA------GMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIM-AIWSHEGLMGFFSG 165
            G +A      G  + + +   ++ R++ AA++ G  +    ++   I++ EGL G   G
Sbjct: 116 SGGVAQAYLTMGFCTCMKT--VEITRSK-AASAPGVPVPSSLQVFKQIFAAEGLRGINKG 172

Query: 166 CGSSMINIGLNTAIMFG----VYESIKIFTEERS--KLSDRRDPFTLLNELAGPISGFTS 219
             +  I    N    FG    V + I+  T +RS  KLS       + + L G +S +  
Sbjct: 173 VNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEK--IVASALGGGLSAWNQ 230

Query: 220 KLATFPLDTVRRRIQIR-NSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278
                P++ +R  +Q R N PN  + +    K     Y+N    G             LY
Sbjct: 231 -----PIEVIRVEMQSRTNDPNRPK-NLTVGKTFRYIYENNGLRG-------------LY 271

Query: 279 RGVTMSLIKSVPSTAISLW 297
           RGVT       P   + +W
Sbjct: 272 RGVT-------PRIGLGVW 283

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 34.7 bits (78), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 14/109 (12%)

Query: 41  IKLQVTPHNKNANVLINIL-KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGG 99
           I L + P + +   +IN L  +EGIRG WK N        IY        T+    L   
Sbjct: 218 ISLTIAPQSLHTIDVINALFDQEGIRGLWKANNTT----FIYNFLSLSIDTWFTGLLSSF 273

Query: 100 L--------DLNISPQLYSCLVGSL-AGMTSSLASYPFDVLRTRFAANS 139
           L        ++  SP +    + +L AG+ +S+   P D++RTR    S
Sbjct: 274 LGVPDPYFMEVINSPDISKSFILALGAGVFTSIILLPVDLIRTRLIVTS 322

>Kwal_34.15907
          Length = 312

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 59/305 (19%), Positives = 115/305 (37%), Gaps = 48/305 (15%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K + VS +N L+   L+   A T   PL+ +K  +    +      + ++  R G+ GF+
Sbjct: 12  KKKPVSFSNILLGAGLNLCEATTLGQPLEVIKTTMAANRNLNFGQSVKHVWSRGGVFGFY 71

Query: 69  KGNVP---------GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA-- 117
           +G +P         G+++  +   A++        F R GL  N    +   + G +A  
Sbjct: 72  QGLIPWAWIEASTKGAVLLFVSAEAEY-------QFKRLGLG-NFGAGIMGGVSGGVAQA 123

Query: 118 ----GMTSSLASYPFDVLRTRFA-ANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMIN 172
               G  + + +      ++  A A  Q      ++    I+S EG+ G   G  +  I 
Sbjct: 124 YLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKE----IYSKEGIKGINKGVNAVAIR 179

Query: 173 IGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRR 232
              N    FG+   ++    + +  ++  D  T L ++     G        P++ +R  
Sbjct: 180 QMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIRVE 239

Query: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292
           +Q +    +E  +R     +  ++K          + Q  G   LYRGV        P  
Sbjct: 240 MQSK----KEDPNRPKKLTVGSAFK---------YIYQSSGIKGLYRGVA-------PRI 279

Query: 293 AISLW 297
            + +W
Sbjct: 280 GLGVW 284

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 12/84 (14%)

Query: 113 VGSLAGMTSSLASYPFDVLRTRF--------AANSQGQLIKLRDEIMAIWSHEGLMGFFS 164
            G LAG   ++ S P D + TR         A       +  RD+I  I    GL+G F 
Sbjct: 166 AGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREI----GLIGCFG 221

Query: 165 GCGSSMINIGLNTAIMFGVYESIK 188
           G G S I      A+ F  +E I+
Sbjct: 222 GFGLSFIRESFGFALYFTTFEMIR 245

>Scas_696.9
          Length = 312

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 56/298 (18%), Positives = 117/298 (39%), Gaps = 34/298 (11%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K   ++ +N ++  +++     +   PL+ VK  +    +    N +  +  R GI GF+
Sbjct: 12  KKRSINFSNIILGATINMAEVTSLGQPLEVVKTTMAANRNLNFVNSMKYVWSRGGIVGFY 71

Query: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSF---LRGGLDLNISPQLYSCLVGSLAGMTSSLAS 125
           +G +P + +     GA     +    +   L G  +             + + +T    +
Sbjct: 72  QGLIPWAWIEASTKGAVLLFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTMGFCT 131

Query: 126 YPFDVLRTRFAANSQGQLIKLRDEIM-AIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184
               V  TR  + S G  ++    +  +I++ EGL G + G  +  I    N    FG  
Sbjct: 132 CMKTVEITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFS 191

Query: 185 ESIKIFTEE---RSKLSDRRDPFTLLNELA--GPISGFTSKLATFPLDTVRRRIQIRNSP 239
             ++ +  +   ++K  DR + +  +   A  G +S +       P++ +R  +Q +   
Sbjct: 192 RLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSAWNQ-----PIEVIRVEMQSK--- 243

Query: 240 NEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
            +E  +R     + K++K          +++  G   LYRGVT       P   + +W
Sbjct: 244 -KEDPNRPKNLTVAKTFK---------YIMKTNGVKGLYRGVT-------PRIGLGIW 284

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 59/294 (20%), Positives = 109/294 (37%), Gaps = 26/294 (8%)

Query: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFW 68
           K + +S +N L+   L+     T   PL+ +K  +         N + ++  R G+ GF+
Sbjct: 12  KKKPISFSNILLGAGLNMCEVTTLGQPLEVIKTTMAANRSFSFFNAIKHVWSRGGVFGFY 71

Query: 69  KGNVPGSIMYIIYGGAQ--FGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG--MTSSLA 124
           +G +P + +     GA   F S      F R GL  N    +   + G +A   +T    
Sbjct: 72  QGLIPWAWIEASTKGAVLLFVSAESEYQFKRMGLS-NFGSGIMGGVTGGVAQAYLTMGFC 130

Query: 125 SYPFDVLRTRFAANSQGQLIKLR-DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183
           +    V  T+  +   G + +        I+  +G+ G   G  +  I    N    FG 
Sbjct: 131 TCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGF 190

Query: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243
              ++      +  ++  D  T L ++A    G        P++ +R  +Q +    +E 
Sbjct: 191 SRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIRVEMQSK----KED 246

Query: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297
            +R     +  ++K          + Q  G   LYRGV        P   + +W
Sbjct: 247 PNRPKNLTVSSAFK---------YIYQSSGIKGLYRGV-------APRIGLGVW 284

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 130/329 (39%), Gaps = 83/329 (25%)

Query: 16  TNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILKREGIRGFWKGNVPGS 75
           ++ L+ G   GL +   + PLD +K ++Q    +K A +  N+ + +     W+G +P +
Sbjct: 11  SSHLIGGFFGGLTSAVALQPLDLLKTRIQ---QDKKATLWKNLKEIDSPLQLWRGTLPSA 67

Query: 76  IMYIIYGGAQFGSYTYIG--SFLRGGL------------DLNIS-------PQLY---SC 111
           +   I      GS  Y+   + +R  L            D NI        P+L    + 
Sbjct: 68  LRTSI------GSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENL 121

Query: 112 LVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMI 171
           L G+ A       + P  V++ R+ + +      L++ I  I++ EGL GFF G G+   
Sbjct: 122 LTGAFARGLVGYITMPITVIKVRYES-TLYNYSSLKEAITHIYTKEGLFGFFRGFGA--- 177

Query: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA--GPISGF------------ 217
                T +    Y  + +   E+SK   +  P  L +      P  GF            
Sbjct: 178 -----TCLRDAPYAGLYVLLYEKSK---QLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTS 229

Query: 218 ---TSKLA---TFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQ 271
              ++ LA   T P DT++ R+Q+  S        +FT                 S+V+ 
Sbjct: 230 AVLSASLATTVTAPFDTIKTRMQLEPS--------KFTNS----------FNTFTSIVKN 271

Query: 272 EGPLSLYRGVTMSLIKSVPSTAISLWSYE 300
           E  L L+ G++M L +   S  I+   YE
Sbjct: 272 ENVLKLFSGLSMRLARKAFSAGIAWGIYE 300

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 117 AGMTSSLAS---YPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINI 173
           A +++SLA+    PFD ++TR       +     +   +I  +E ++  FSG    +   
Sbjct: 230 AVLSASLATTVTAPFDTIKTRMQLEP-SKFTNSFNTFTSIVKNENVLKLFSGLSMRLARK 288

Query: 174 GLNTAIMFGVYESI 187
             +  I +G+YE +
Sbjct: 289 AFSAGIAWGIYEEL 302

>YLR401C (DUS3) [3779] chr12 complement(922618..924447) Member of
           dihydrouridine synthase (Dus) family (Dus1p,
           Smm1p/Dus2p, Ylr401cp, Ylr405wp), may effect
           dihydrouridine modification of tRNA [1830 bp, 609 aa]
          Length = 609

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 23/118 (19%)

Query: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKL--ATFPLDTVRRRIQIRN--------- 237
           I  E +  L  RR PFT  NE+   I  F  +   +  P + V    Q++          
Sbjct: 192 ISPERKLDLIKRRFPFTKSNEILEIIDSFQQECRDSMKPEEEVESTPQLKKQDPDVEQPV 251

Query: 238 SPNEERHDREFT------KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289
           +P  E+ ++E +      +++Y  YK+ R+        Q++ PL LY    +S + +V
Sbjct: 252 APQVEQRNKELSEHRMKQREVYLKYKDTRYFA------QEKKPLDLYHKKIVSPLTTV 303

>Kwal_55.21106
          Length = 328

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 7   LRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINILKREGI 64
           L    ++S   + + G  S + +     PL   K  LQ T  N  +   VL+ + K+EG+
Sbjct: 221 LETSGQLSPRQNFLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGL 280

Query: 65  RGFWKGNVP 73
              WKG  P
Sbjct: 281 ISLWKGLAP 289

>Scas_650.9*
          Length = 609

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ- 234
           N+ I+F + +S +   EE SKL+   D  +L  +L   +     K     L  +RR +  
Sbjct: 254 NSDILFNLTQSFETIVEEDSKLNFSEDTLSLQGKLFESLEILAPKNLANKLIIMRRLVSS 313

Query: 235 ----IRNSPNEERHDREFTKDIYKSYKN 258
                 N  N  + +++  +++ +S KN
Sbjct: 314 IGHISANETNTNQEEQQLCQNVIQSSKN 341

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 2/87 (2%)

Query: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA--NVLINIL 59
           N KD      ++    + + G LS + +     PL   K  LQ +     +   VL  + 
Sbjct: 240 NAKDLNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLY 299

Query: 60  KREGIRGFWKGNVPGSIMYIIYGGAQF 86
           + EG    WKG +P     +I  G  F
Sbjct: 300 RHEGAHALWKGLLPQLTKGVIVQGLLF 326

>Scas_653.19
          Length = 439

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query: 82  GGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY--PFDVLR------T 133
           GG +F  Y    + +R G  + +    Y   VG +  +T+ L  Y  PF ++       T
Sbjct: 11  GGVEFHIYHLAQNLIRLGHSVVVITHAYKDRVG-VRYLTNGLKVYHVPFLIMYRETAFPT 69

Query: 134 RFAANSQGQLIKLRDEIMAIWSHEGLMGF 162
            F+A    + I +R+EI  I SH G+  F
Sbjct: 70  VFSAFPAIRNILIREEIQIIHSHGGVSTF 98

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,432,369
Number of extensions: 386799
Number of successful extensions: 2738
Number of sequences better than 10.0: 220
Number of HSP's gapped: 1616
Number of HSP's successfully gapped: 598
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)