Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F07843g61260230420.0
YGL142C (GPI10)61658915320.0
Scas_669.1159658914640.0
ADL281C59558814230.0
KLLA0E14762g60159714110.0
Kwal_23.347861859814050.0
Scas_714.365141861372e-08
CAGL0K09548g4962101221e-06
Sklu_1475.25082041112e-05
Kwal_47.188425081581113e-05
KLLA0C06567g53078989e-04
YOR149C (SMP3)516193950.002
YNL219C (ALG9)555182790.18
YGR117C47673770.29
Scas_606.6571138760.40
CAGL0K08206g116950740.88
KLLA0C08591g541104721.3
KLLA0D12892g45453711.6
Kwal_23.584036850683.4
AFR661W117972684.2
Kwal_33.13439120272684.5
YGL140C121972666.7
Scas_420.1259155647.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F07843g
         (602 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...  1176   0.0  
YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...   594   0.0  
Scas_669.11                                                           568   0.0  
ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...   552   0.0  
KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...   548   0.0  
Kwal_23.3478                                                          545   0.0  
Scas_714.36                                                            57   2e-08
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    52   1e-06
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          47   2e-05
Kwal_47.18842                                                          47   3e-05
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    42   9e-04
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    41   0.002
YNL219C (ALG9) [4385] chr14 complement(235995..237662) Mannosylt...    35   0.18 
YGR117C (YGR117C) [2074] chr7 complement(725051..726481) Protein...    34   0.29 
Scas_606.6                                                             34   0.40 
CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces c...    33   0.88 
KLLA0C08591g complement(752256..753881) similar to sp|P53730 Sac...    32   1.3  
KLLA0D12892g 1099951..1101315 weakly similar to sp|Q03236 Saccha...    32   1.6  
Kwal_23.5840                                                           31   3.4  
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    31   4.2  
Kwal_33.13439                                                          31   4.5  
YGL140C (YGL140C) [1847] chr7 complement(241356..245015) Protein...    30   6.7  
Scas_420.1                                                             29   7.4  

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score = 1176 bits (3042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/602 (95%), Positives = 576/602 (95%)

Query: 1   MVTNKKDTDENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKA 60
           MVTNKKDTDENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKA
Sbjct: 1   MVTNKKDTDENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKA 60

Query: 61  FGYGELTWEWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSK 120
           FGYGELTWEWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSK
Sbjct: 61  FGYGELTWEWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSK 120

Query: 121 LATEVARDLLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKND 180
           LATEVARDLLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKND
Sbjct: 121 LATEVARDLLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKND 180

Query: 181 DQLPKLSNITKIAXXXXXXXXXXXXXITRTFINSFEMILTSIALYNWDWSGGIEINTRSF 240
           DQLPKLSNITKIA             ITRTFINSFEMILTSIALYNWDWSGGIEINTRSF
Sbjct: 181 DQLPKLSNITKIALLLTLTNFFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSF 240

Query: 241 TKSLFFAMFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNV 300
           TKSLFFAMFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNV
Sbjct: 241 TKSLFFAMFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNV 300

Query: 301 VIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFS 360
           VIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFS
Sbjct: 301 VIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFS 360

Query: 361 NDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXXXXXXX 420
           NDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFC             
Sbjct: 361 NDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCLLSALGALKLAGK 420

Query: 421 VQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPW 480
           VQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPW
Sbjct: 421 VQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPW 480

Query: 481 QSYLHRNDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTN 540
           QSYLHRNDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTN
Sbjct: 481 QSYLHRNDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTN 540

Query: 541 SMDMENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSR 600
           SMDMENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSR
Sbjct: 541 SMDMENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSR 600

Query: 601 RN 602
           RN
Sbjct: 601 RN 602

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/589 (50%), Positives = 404/589 (68%), Gaps = 17/589 (2%)

Query: 23  SAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPML 82
           + IF V + FRV+N++LTRT+FQADEFWQ+LEPAH+KAF YGELTWEWK G+RSY FPM+
Sbjct: 15  TQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMI 74

Query: 83  FEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEY 142
           FE+ YRLV L +I    AL ++ +IG+ L++L  P+ +L+ +VA DL  +P + + + EY
Sbjct: 75  FELTYRLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAEDLKRLPFDVTRSFEY 134

Query: 143 YGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQL-----PKLSNITKIAXXXX 197
           YGVIYAPK+ MA+LA+ GEY+ ++ +QK+YL T+ K +++        LS ITK A    
Sbjct: 135 YGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERRSGLSEITKFALLLS 194

Query: 198 XXXXXXXXXITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSN 257
                    ITRTFINSFEMILTSIALY WDW+GG  I   SFTKSL FA  AC+QRPS+
Sbjct: 195 LTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSS 254

Query: 258 AIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKF 317
            +IW++    L +NL+ ++ Y L+   ++K+L  F +    N +ID YFY ++ FP F+F
Sbjct: 255 GLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRF 314

Query: 318 INFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLF---SNDSTTKNNIRFGAL 374
           + FNFT+ LS+FYGVAPWHFH  QSLPI+LG S+P F +GLF   S  S  K  +     
Sbjct: 315 LKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYL--NPF 372

Query: 375 RQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXXXXXXXV-QNYRYLKEYVWI 433
            Q+K  ++LN++ YS L HKEFRFI+PLQPLF                +    LK  +W+
Sbjct: 373 FQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWL 432

Query: 434 IPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHRNDIRQLW 493
           +P +S+ +++ + TF ESG I+VMK LH E +IDS+GF+MPCHSTP QSYLHR+DI+ LW
Sbjct: 433 VPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQDLW 492

Query: 494 AISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTNSMDMENVNNNASM 553
           +I+C PPLHLLG   A  +L+TYMDESD+LY++IS FI KNFP      D+ +     S 
Sbjct: 493 SITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPP-PFRKDLRSPGKTYS- 550

Query: 554 PQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRN 602
               HEWP +L++FE ++N F+  +L DS Y++YN+ FNS +HWDSRR+
Sbjct: 551 ----HEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRS 595

>Scas_669.11
          Length = 596

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/589 (51%), Positives = 401/589 (68%), Gaps = 22/589 (3%)

Query: 23  SAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPML 82
            ++F  ++ FR+ N+LLTRT+FQADEFWQ+LEPAH  AFGYGELTW+WK  +RSYAFP +
Sbjct: 7   GSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFI 66

Query: 83  FEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEY 142
           FE+ YRLV+L+   S+  + ++  + + L+LL FP ++    V  DL+ +P++ + ++EY
Sbjct: 67  FELTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDMANSLEY 126

Query: 143 YGVIYAPKLFMALLAATGEYFTIKLIQKVYL---KTVSKNDDQLPK---LSNITKIAXXX 196
            GVIY PK+ M L+AATGEY+TIKLIQK+YL   K+  +NDD+  K   L  ITKIA   
Sbjct: 127 IGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVL 186

Query: 197 XXXXXXXXXXITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPS 256
                     ITR+FINSFEM  T++ALY WDW+GG+ I +  FTKSL  AMF C+QRP+
Sbjct: 187 SLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPT 246

Query: 257 NAIIWIVLGFFLTINLLLR-RDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVF 315
           NA IWIVLG  L  N++ R  D+     L  KI++ F    L+NV IDFYFY +I  P+ 
Sbjct: 247 NAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLI 306

Query: 316 KFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTK-NNIRFGAL 374
            FI FN TS L+ FYG +PWHFHL QS+PI+LGY+L  F+ G+F + S  K  +      
Sbjct: 307 NFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPF 366

Query: 375 RQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXXXXXXXVQNYRYLKEYVWII 434
            QIK +++LN++ +S   HKEFRFIYPLQP F              ++ Y+Y     WI+
Sbjct: 367 FQIKMIILLNVLVFSLTTHKEFRFIYPLQPFF----MTVSVFALHKLKWYQY-SRMTWIL 421

Query: 435 PLMSMIVSIFITTFQESGVIQVMKDLHNEK-DIDSVGFVMPCHSTPWQSYLHRNDIRQLW 493
           PL S+++S+ +++FQESG I+VMK LHNE  D+ SVGF+MPCHSTPWQSYLHR DI  LW
Sbjct: 422 PLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDLW 481

Query: 494 AISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDMENVNNNAS 552
           AI+CEPPLHLLG  +A+ +LQ+YMDESD+LY N + F+ +NFP  F   +        + 
Sbjct: 482 AITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKEL-------RSP 534

Query: 553 MPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRR 601
              + HEWP++LIIFEQLD+  M  YL DS YV+Y + FNS+SHWDSRR
Sbjct: 535 GKVYTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRR 583

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/588 (45%), Positives = 381/588 (64%), Gaps = 14/588 (2%)

Query: 21  KTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFP 80
           K  +I   L  +R+IN+L  R++FQADE+WQSLEPAH KAFGYG LTWEW+ GLRSYAFP
Sbjct: 2   KERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFP 61

Query: 81  MLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETV 140
           MLFE+ Y +  +L +A++ AL  +    A L     P         + +  +P    E V
Sbjct: 62  MLFEMSYYVAWILGVATRMALQGLAHATA-LCGAVVPSGAAGVAAMKAVWELPEAAQELV 120

Query: 141 EYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQLPKLSNITKIAXXXXXXX 200
           EYYGV+Y P++ MA +AA GE++++ L++K+YL+   K DDQ    + ++++A       
Sbjct: 121 EYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGDDQKGDAAPVSRLALMLTMTN 180

Query: 201 XXXXXXITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSNAII 260
                  TRTFINSFEM LT++ALY+WDWSGG+++ +  F+ SL  A FAC+QRP+N +I
Sbjct: 181 FFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVLI 240

Query: 261 WIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINF 320
           W VLG FL +NL+  R + L+  L AK+     + +  N+ ID+YFY  ++ P+ +FI F
Sbjct: 241 WAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLRFIEF 300

Query: 321 NFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGA-LRQIKF 379
           N T+ L+ FYG APWHFHLLQS+P+++GY+LP F+  L +++    N    G+ + QIK 
Sbjct: 301 NVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKC 360

Query: 380 VLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXXX--XXXXVQNYRYLKE---YVWII 434
           V++LNI  YS + HKEFRF+YPLQPLF                 +   +LK     ++++
Sbjct: 361 VVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLYVL 420

Query: 435 PLMSMIVSIFITTFQESGVIQVMKDLHNE-KDIDSVGFVMPCHSTPWQSYLHRNDIRQLW 493
           P++S+  ++ + T  E+GV+ VM  LH+     +S+GF+MPCHSTPWQS+LHRND+ +LW
Sbjct: 421 PVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGKLW 480

Query: 494 AISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTNSMDMENVNNNASM 553
           AISC+PPL LL + +A  +L TYMDESD+LYENI  FI KNFP      D+ +       
Sbjct: 481 AISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRR-DLRSPGR---- 535

Query: 554 PQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRR 601
            Q+ +EWP+FL++FE +D  FM  YL DS YV+  + FN+ SHWDSRR
Sbjct: 536 -QYAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRR 582

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/597 (47%), Positives = 383/597 (64%), Gaps = 34/597 (5%)

Query: 25  IFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPMLFE 84
           +F V++  R + +LLTRT+FQADEFWQSLEPAHY AFGYGELTWEW  GLRSYAFP++F+
Sbjct: 10  LFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQ 69

Query: 85  IIYRLVKLLAIASKEALSIICSIGAGLMLL----CFPQSKLATEVARDLLTIPNEYSETV 140
           I Y LVK  AI+ +    +I       +LL      P S+   E+ +++ + P E    +
Sbjct: 70  IGYTLVKYAAISCE----LIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFI 125

Query: 141 EYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQL---PKLSNITKIAXXXX 197
           EY GVIYAPKL MA+LAA GE+  I L +K+Y  T+ K+DD      K S +        
Sbjct: 126 EYQGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKHSTVINFTLVAT 185

Query: 198 XXXXXXXXXITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSN 257
                    ITR+FINSFEMILTS++LY WDW+ G  I +  F KSL    F  +QRP+N
Sbjct: 186 VSNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTN 245

Query: 258 AIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKF 317
           A IW++LG ++ +NL+L + +  +  L  K++    I++  N+ ID+YFY  I  PV KF
Sbjct: 246 AFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKF 305

Query: 318 INFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRF-----G 372
           I FN TS LS+FYGVAPW+FH+ QSLPI+ GYSLPL I+  F   S TK   RF      
Sbjct: 306 IKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFC--SLTKK--RFLSPLVN 361

Query: 373 ALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXX------XXXXXXXXXVQNYRY 426
              QIK V++LN+I YS + HKEFRFIYPLQP F                     +   +
Sbjct: 362 PFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEF 421

Query: 427 LKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHR 486
             + +WI+P++SM+ S+ ++T  ESG + VM  LH+ ++IDS+GF+MPCHSTPWQS+ HR
Sbjct: 422 FSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHR 481

Query: 487 NDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDME 545
           ND+++LWAI+C PPLHLL   +A+ +L  YMDESDYLY+NIS F+ ++FP  F  S+   
Sbjct: 482 NDVKELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSL--- 538

Query: 546 NVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRN 602
                +   Q+ +EWP++L+IFE LD++FM+ YL+DS Y++  + FNS  HWD RR+
Sbjct: 539 ----RSPGKQYTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRS 591

>Kwal_23.3478
          Length = 618

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/598 (45%), Positives = 381/598 (63%), Gaps = 11/598 (1%)

Query: 9   DENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTW 68
           D++     S      +I  VL+ FRV++SL   +YFQ DEFWQ+LEPAH++AFGYG+LTW
Sbjct: 16  DQDMSQSSSKKPYGISIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTW 75

Query: 69  EWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARD 128
           EW  GLRSYAFP +FEI+YRLV +++  +++ ++I        +    P S+LA  +  +
Sbjct: 76  EWDYGLRSYAFPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNE 135

Query: 129 LLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQLPKLSN 188
           +   P E    +EYYGVI APK+ MAL+ A GE +    I+K+Y +  S ++    +   
Sbjct: 136 MQHFPQEIKSFLEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYTREFSGDEKNKMQSGK 195

Query: 189 ITKIAXXXXXXXXXXX-XXITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFA 247
           + K+A              ITRTF N+ EM LT  ALY WDW+GG  ++ R+FT SL+  
Sbjct: 196 LVKMAACLLSTTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCG 255

Query: 248 MFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFY 307
           +F C+QRP+NA+IW+ LG FL +NL  R+D+  +  L  K+L+VF   + VN+ IDFYFY
Sbjct: 256 IFLCLQRPTNALIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFY 315

Query: 308 NQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKN 367
            ++IFPVF+FI FN+TS LS FYG APWHFHLLQSLP++LG+S PLF+YG F + +    
Sbjct: 316 RELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGR 375

Query: 368 NIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXXXXXXXVQNYRY- 426
                ++ Q + V+I+NII +S + HKEFRF+Y L P F              ++     
Sbjct: 376 EGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNG 435

Query: 427 -LKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLH 485
            LK  VW  P  S+I S+ ++++ E+GV +V K LH+   I SVGF+MPCHSTPWQSY+H
Sbjct: 436 PLKYLVWAPPFFSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIH 495

Query: 486 RNDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDM 544
           RNDI+ +W+I+CEPPL LL   +A   L +YMDESD LY+N+  FI +N P  F   +  
Sbjct: 496 RNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKEL-- 553

Query: 545 ENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRN 602
                 +   ++ HEWP++LIIF+QLD+ FM  +L DS Y +  + FN++SHWDSRR+
Sbjct: 554 -----RSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRS 606

>Scas_714.36
          Length = 514

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 88/186 (47%), Gaps = 15/186 (8%)

Query: 284 LYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSL 343
           L   IL+  ++ +L++  I  Y  N+ +   +  + +NF     E +G+ PW+ H+L +L
Sbjct: 222 LSLSILLTTSLCILLDTAI--YESNEWVITPWNNLKYNFDISNLESHGLHPWYTHILVNL 279

Query: 344 PIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQ 403
           P +LG  + +F+  +    STT   +   +          +++  SY KH+EFRF+ PL 
Sbjct: 280 PQLLG-PMIIFLPLILLKTSTTIPTLSIMS----------SMVTLSYFKHQEFRFLTPLV 328

Query: 404 PLFCXXXXXXXXXXXXXVQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNE 463
           PL                   R +   +W+  L ++I ++ +  F +SGVIQ + +  + 
Sbjct: 329 PLLLIQLAACIPNSIQQSSFKRSVIRLLWV--LFNIIFAVIVGVFHQSGVIQSLSNFSSP 386

Query: 464 KDIDSV 469
             ++ +
Sbjct: 387 STLEPI 392

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 100/210 (47%), Gaps = 38/210 (18%)

Query: 289 LVVFTITMLVNVVIDFYF------YNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQS 342
           +VV  ++M ++  I  YF       ++II    K + +N        +G+ P + HLL +
Sbjct: 210 MVVIAVSMTLSTSIIVYFDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVN 269

Query: 343 LPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPL 402
           +P++LG  L +           TKN+     L  I    I ++ F S L+H+E RF+ P+
Sbjct: 270 IPLILGPGLLMI--------RNTKNDFLNLPLLSI----ISSLFFLSALRHQELRFLLPV 317

Query: 403 QPLFCXXXXXXXXXXXXXVQNYRYLKEY---VWIIPLMSMIVSIFITTFQESGVIQVMKD 459
            PLF              +  +RY + Y   +W++   +  + I +  F + GVI ++ +
Sbjct: 318 VPLFS-----------TLLTRFRY-RPYLFRIWLV--FNAAMCIIMGIFHQGGVIPMISN 363

Query: 460 LHNEKDIDSVGFVMPCHSTPWQSYLHRNDI 489
           ++ E+D+ ++      +S P  ++L+ NDI
Sbjct: 364 INAEQDL-TIDIWWKTYSPP--TWLYNNDI 390

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 86/204 (42%), Gaps = 27/204 (13%)

Query: 289 LVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSEF--YGVAPWHFHLLQSLPIM 346
           L  F +T  + VV D   YN   + V    NF++    S    +G+ P + H+L ++P +
Sbjct: 215 LFSFGLTSYLFVVADTRLYNSNTWCVAPLNNFSYNMDESNLATHGLHPRYTHILFNVPQI 274

Query: 347 LGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLF 406
           LG +L  F         + +  +    L  I  ++IL     S  KH+E RF+ PL PLF
Sbjct: 275 LGPALIFFF--------SRRYKLALPLLSCISGLVIL-----SLFKHQELRFLVPLLPLF 321

Query: 407 CXXXXXXXXXXXXXVQNYRYLKEYVWIIP---LMSMIVSIFITTFQESGVIQVMKDLHNE 463
           C             + N+  + ++  +I    L ++   I +    + GVI  +  L   
Sbjct: 322 C---------ISMNLSNFDKVIKWEHVIKLWLLFNICSGIIMGGLHQRGVILAIDHLRTS 372

Query: 464 KDIDSVGFVMPCHSTPWQSYLHRN 487
            D   V      +S P   Y+++N
Sbjct: 373 SDTAGVHVWWKTYSPPTWMYMNKN 396

>Kwal_47.18842
          Length = 508

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 19/158 (12%)

Query: 330 YGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYS 389
           +G+ P + HLL ++P MLG   PL I+ +       + N+ F A        I  II  S
Sbjct: 258 HGLHPRYTHLLLNVPQMLG---PLLIFFV---SRRQRINLSFLAC-------ISGIIVLS 304

Query: 390 YLKHKEFRFIYPLQPLFCXXXXXXXXXXXXXVQNYRYLKEYVWIIPLMSMIVSIFITTFQ 449
             +H+E RF+ PL PLFC              Q    L    W+    ++I  + + +  
Sbjct: 305 MFQHQELRFLIPLLPLFCVSVDLSNFDKFVSSQ----LVNKAWLA--FNVIFGVIMGSLH 358

Query: 450 ESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHRN 487
           + GV+ V+++L    +   V      +S P   Y++ N
Sbjct: 359 QRGVVTVIEELARPGEKIGVNLWWKTYSPPTWMYMNCN 396

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 13/78 (16%)

Query: 330 YGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYS 389
           +G+ P + HLL +LP++ G  + LFI        + K  ++  AL  I  +L+L     S
Sbjct: 285 HGLHPRYTHLLINLPLICGPIILLFI--------SQKAVLKLPALSCISGILML-----S 331

Query: 390 YLKHKEFRFIYPLQPLFC 407
             +H+E RFI P+ PL C
Sbjct: 332 LFRHQELRFIIPVLPLLC 349

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 85/193 (44%), Gaps = 23/193 (11%)

Query: 300 VVIDFYFYNQ----IIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFI 355
           V+ID   YN     +I P+   + +N      + +G+ P + HLL +LP ++G   P+ +
Sbjct: 229 VLIDTNIYNNGKGFVITPLNN-LKYNLNVQNLQVHGLHPRYTHLLVNLPQIVG---PVLL 284

Query: 356 YGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCXXXXXXXX 415
             +FS     K +          + +I  ++F S+ +H+E RF+ PL PL          
Sbjct: 285 LAIFSGYKLDKLS---------TYAIISGLLFLSFFQHQELRFLVPLVPLLV--TNLNWT 333

Query: 416 XXXXXVQNYRYLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKD-LHNEKDIDSVGFVMP 474
                + N +  K   W+  L ++I++  +    ++G+IQ + D  H   +   V     
Sbjct: 334 PLSSTLVNKKIFKG-TWL--LFNIIMAFIMGISHQAGIIQFLGDYFHFRTEQMGVHIWWK 390

Query: 475 CHSTPWQSYLHRN 487
            +S P   Y+  N
Sbjct: 391 TYSPPTWMYMSNN 403

>YNL219C (ALG9) [4385] chr14 complement(235995..237662)
           Mannosyltransferase involved in N-glycosylation,
           catalyzes transfer of mannose from Dol-P-Man to
           lipid-linked oligosaccharides [1668 bp, 555 aa]
          Length = 555

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 34/182 (18%)

Query: 236 NTRSFTKSLFFAMFACIQRPSNAIIWIVLG--FFLTINLLLRRDYTLIGRLYAKI----- 288
           +T +FTKSL +   A I           LG  F L ++L L   Y    R+ + I     
Sbjct: 165 STSNFTKSLAYNFLASI-----------LGWPFVLILSLPLCLHYLFNHRIISTIRTAFD 213

Query: 289 -LVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSE----FYGVAPWHFHLLQSL 343
             ++F++T    +V D  FY ++    +  + +N  +   E     +GV PW+++ L  L
Sbjct: 214 CCLIFSLTAFAVIVTDSIFYGKLAPVSWNILFYNVINASEESGPNIFGVEPWYYYPLNLL 273

Query: 344 PIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQ 403
                  L L I G+F        ++R   L    F  I     ++   HKE RF+YP+ 
Sbjct: 274 LNFPLPVLVLAILGIF--------HLRLWPLWASLFTWI---AVFTQQPHKEERFLYPIY 322

Query: 404 PL 405
            L
Sbjct: 323 GL 324

>YGR117C (YGR117C) [2074] chr7 complement(725051..726481) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.2270p [1431 bp, 476 aa]
          Length = 476

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 297 LVNVVIDFYFYNQIIFP-VFKF--INFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLP- 352
           L +VV D  +Y +  F   FK   IN +   I +  YG+ PW+  L  S+ + L  SLP 
Sbjct: 60  LQSVVEDRIYYKRRSFKDRFKTLSINDDLAPIDNAKYGIQPWNHSLKFSIDVKLNKSLPK 119

Query: 353 --LFIYGLFSNDS 363
             LFI   F+ DS
Sbjct: 120 DTLFISATFTEDS 132

>Scas_606.6
          Length = 571

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 63/138 (45%), Gaps = 16/138 (11%)

Query: 272 LLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSE--- 328
           L   R  + I  ++   LV+F IT +V +V+D  FY +     +  + +N  +  +E   
Sbjct: 207 LFTHRIISTIRTVFDTSLVLFIITTIV-IVVDSVFYGKFTPVSWNILFYNVINATNESGP 265

Query: 329 -FYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIF 387
             +GV  W +++L    + + + LP+    L          I   +L  +   L+  +I 
Sbjct: 266 NIFGVESWDYYILN---LTINFPLPVLFASLIG--------IFHLSLWPLWTSLLTWMII 314

Query: 388 YSYLKHKEFRFIYPLQPL 405
           +    HKE RF+YP+ PL
Sbjct: 315 FINQPHKEERFLYPIYPL 332

>CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces
           cerevisiae YGL140c, start by similarity
          Length = 1169

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 305 YFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLF 354
           +FY  I+FP+F  ++F F + LSE  GV    F    S P  LG ++ +F
Sbjct: 149 HFYFGIVFPLFLVVHFTFMAPLSETPGVIANSF----STPFYLGIAMSIF 194

>KLLA0C08591g complement(752256..753881) similar to sp|P53730
           Saccharomyces cerevisiae YNR030w ECM39 involved in cell
           wall biogenesis and architecture singleton, start by
           similarity
          Length = 541

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 7/104 (6%)

Query: 296 MLVNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFI 355
           + +++ +D YF+N++  P  +   FN     S  +G  P+  +L   LP+M      L +
Sbjct: 236 IFLSIQVDSYFWNRLTVPEIEAFIFNVVHGESSKWGTQPFFAYLTGYLPMMFIPPTALLL 295

Query: 356 YGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLKHKEFRFI 399
             L          I   + R +      +++  S   HKE+RFI
Sbjct: 296 NHL-------GFKIGPNSFRVVGIAAYFHVLVMSLQPHKEWRFI 332

>KLLA0D12892g 1099951..1101315 weakly similar to sp|Q03236
           Saccharomyces cerevisiae YMR187c hypothetical protein
           singleton, start by similarity
          Length = 454

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 121 LATEVARDLLTIP---NEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQK 170
           L+T+VA+  +T P   N + E +EY  VI  P+ + ALLAA    F  K + +
Sbjct: 328 LSTQVAQKSVTKPTVFNLFQEGLEYSDVIIKPQWYDALLAALAWPFLCKYLGR 380

>Kwal_23.5840
          Length = 368

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%)

Query: 538 FTNSMDMENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKY 587
           F+N     + ++ ASMP  PH  P  L+ F  +   F  +   D+ Y ++
Sbjct: 105 FSNGAQAFSPHSQASMPSPPHSAPPMLMPFNPMQAMFFPQLSQDTSYPRH 154

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 11/72 (15%)

Query: 288 ILVVFTITML-----VNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQS 342
           +L VF I ML     + VV   YF+  ++FP+F  ++F+F S LS    +         +
Sbjct: 135 VLAVFEICMLFFHGWMRVVNHNYFH--VVFPLFIVVHFSFLSPLS----IDAAQIAKTFT 188

Query: 343 LPIMLGYSLPLF 354
           +P  LG S+ LF
Sbjct: 189 IPFYLGISMSLF 200

>Kwal_33.13439
          Length = 1202

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 11/72 (15%)

Query: 288 ILVVFTITML-----VNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQS 342
           IL VF   ML     +  V   YF+  I+FP+F  ++F F + L++  G     F    S
Sbjct: 130 ILAVFETIMLFVHGWMRSVSHHYFH--IVFPLFLVVHFAFLAPLTQDAGTVAKAF----S 183

Query: 343 LPIMLGYSLPLF 354
            P  LG  L +F
Sbjct: 184 TPFYLGIGLSIF 195

>YGL140C (YGL140C) [1847] chr7 complement(241356..245015) Protein of
           unknown function [3660 bp, 1219 aa]
          Length = 1219

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 288 ILVVFTITML-----VNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQS 342
           IL VF + ML     +  V  +YF   I+FP+F  ++F F   L+E  G     +    S
Sbjct: 129 ILAVFEVIMLFFHGWMRSVSHYYF--GIVFPLFVVVHFAFMDPLNETAGTIAKAY----S 182

Query: 343 LPIMLGYSLPLF 354
            P  LG ++ +F
Sbjct: 183 TPFYLGIAMSIF 194

>Scas_420.1
          Length = 259

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 60/155 (38%), Gaps = 40/155 (25%)

Query: 234 EINTRSFTKSLFFAMFACIQRPSNAIIWIVLG-FFLTINLLLRRDYTLIGRLYAK----- 287
           +++ R  T+     + + I  P   +   + G  + T  L+    Y++ GR  A+     
Sbjct: 48  KVSARLGTEPAMLPLISVIVHPGRRVGGTIKGAIYCTTGLIFGLAYSIFGRFLAQQCMGS 107

Query: 288 -----------------------ILVVFTITML-----VNVVIDFYFYNQIIFPVFKFIN 319
                                  IL VF   ML     + V+  FYF   I+FP+F  ++
Sbjct: 108 NWNKYDEVDQYKYNFHGFRAGLAILAVFESIMLFVHGWMRVINHFYF--GIVFPLFLVVH 165

Query: 320 FNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLF 354
           F F + L+E  GV    F    S P  +G  + +F
Sbjct: 166 FAFMASLTESAGVIAKSF----SDPFYMGIGMSIF 196

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,127,175
Number of extensions: 824646
Number of successful extensions: 2813
Number of sequences better than 10.0: 39
Number of HSP's gapped: 2842
Number of HSP's successfully gapped: 43
Length of query: 602
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 495
Effective length of database: 12,891,983
Effective search space: 6381531585
Effective search space used: 6381531585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)