Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F07821g92190745600.0
YGL141W (HUL5)91091817740.0
Scas_669.1295896814840.0
Kwal_23.348190892214450.0
ADL280W93395512971e-164
KLLA0E14740g90692910821e-133
AER304C32583524532e-45
Kwal_47.1838932293524513e-45
Scas_717.6032593514398e-44
CAGL0K06303g32473514343e-43
YDR457W (TOM1)32683514282e-42
KLLA0B01804g32423584272e-42
KLLA0E13607g8193524106e-41
Kwal_47.173027873524071e-40
ADL055C8173523954e-39
YER125W (RSP5)8093523954e-39
Scas_627.28353523921e-38
CAGL0K02255g8223523813e-37
AEL068W8393833803e-37
KLLA0E22660g8063533633e-35
Kwal_34.160648493573242e-30
CAGL0I01672g8583693215e-30
YJR036C (HUL4)8923673011e-27
Scas_549.38423812912e-26
KLLA0B13585g14673762342e-19
Scas_668.2114283842314e-19
ABR013W14243692243e-18
Sklu_2101.24114252174e-18
Kwal_26.786914493722162e-17
YKL010C (UFD4)14832772136e-17
CAGL0M10175g14761751813e-13
ADR264C34650800.16
AER287W115378722.0
Scas_689.1287039704.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F07821g
         (907 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F07821g complement(762977..765742) similar to sp|P53119 Sac...  1761   0.0  
YGL141W (HUL5) [1846] chr7 (238356..241088) Putative ubiquitin-p...   687   0.0  
Scas_669.12                                                           576   0.0  
Kwal_23.3481                                                          561   0.0  
ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH] complement(...   504   e-164
KLLA0E14740g complement(1316238..1318958) similar to sp|P53119 S...   421   e-133
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...   179   2e-45
Kwal_47.18389                                                         178   3e-45
Scas_717.60                                                           173   8e-44
CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces c...   171   3e-43
YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required f...   169   2e-42
KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyce...   169   2e-42
KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces...   162   6e-41
Kwal_47.17302                                                         161   1e-40
ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH] (584035..58...   156   4e-39
YER125W (RSP5) [1555] chr5 (410185..412614) Essential ubiquitin-...   156   4e-39
Scas_627.2                                                            155   1e-38
CAGL0K02255g complement(199719..202187) highly similar to sp|P39...   151   3e-37
AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH] complement(...   150   3e-37
KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces...   144   3e-35
Kwal_34.16064                                                         129   2e-30
CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces c...   128   5e-30
YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative ...   120   1e-27
Scas_549.3                                                            116   2e-26
KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces...    95   2e-19
Scas_668.21                                                            94   4e-19
ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH] complement(4...    91   3e-18
Sklu_2101.2 YGL141W, Contig c2101 1350-2581                            88   4e-18
Kwal_26.7869                                                           88   2e-17
YKL010C (UFD4) [3246] chr11 complement(421067..425518) Ubiquitin...    87   6e-17
CAGL0M10175g complement(1014414..1018844) similar to sp|P33202 S...    74   3e-13
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    35   0.16 
AER287W [2789] [Homologous to ScYML104C (MDM1) - SH] complement(...    32   2.0  
Scas_689.12                                                            32   4.1  

>CAGL0F07821g complement(762977..765742) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase, start by similarity
          Length = 921

 Score = 1761 bits (4560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 862/907 (95%), Positives = 862/907 (95%)

Query: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60
           MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC
Sbjct: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60

Query: 61  KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNIY 120
           KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNIY
Sbjct: 61  KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNIY 120

Query: 121 SDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVIAPVLSAWKV 180
           SDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVIAPVLSAWKV
Sbjct: 121 SDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVIAPVLSAWKV 180

Query: 181 QFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVLLENMSYLYSKLKH 240
           QFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVLLENMSYLYSKLKH
Sbjct: 181 QFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVLLENMSYLYSKLKH 240

Query: 241 ANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSYLDSINIHTNFSSDLLNFIE 300
           ANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSYLDSINIHTNFSSDLLNFIE
Sbjct: 241 ANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSYLDSINIHTNFSSDLLNFIE 300

Query: 301 NAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHL 360
           NAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHL
Sbjct: 301 NAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHL 360

Query: 361 WLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLYTNEALPLLKIIYLR 420
           WLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLYTNEALPLLKIIYLR
Sbjct: 361 WLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLYTNEALPLLKIIYLR 420

Query: 421 DSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYRXXXXXXXXXXXXXXXXXXX 480
           DSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYR                   
Sbjct: 421 DSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYRSYKDNYDDLYDSDDEDNND 480

Query: 481 XXXXXXMNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRVEMFYTLIEXXXXXX 540
                 MNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRVEMFYTLIE      
Sbjct: 481 KEINDIMNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRVEMFYTLIELDKRRL 540

Query: 541 XXXXXXXXXXXXXXALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEF 600
                         ALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEF
Sbjct: 541 NLDDDSSLMMDVLNALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEF 600

Query: 601 GPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGKV 660
           GPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGKV
Sbjct: 601 GPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGKV 660

Query: 661 LGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLE 720
           LGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLE
Sbjct: 661 LGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLE 720

Query: 721 SLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHR 780
           SLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHR
Sbjct: 721 SLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHR 780

Query: 781 GLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEE 840
           GLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEE
Sbjct: 781 GLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEE 840

Query: 841 FEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYAD 900
           FEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYAD
Sbjct: 841 FEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYAD 900

Query: 901 KELLRQK 907
           KELLRQK
Sbjct: 901 KELLRQK 907

>YGL141W (HUL5) [1846] chr7 (238356..241088) Putative
           ubiquitin-protein ligase, associated with 26S proteasome
           [2733 bp, 910 aa]
          Length = 910

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/918 (43%), Positives = 563/918 (61%), Gaps = 33/918 (3%)

Query: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60
           MLNFTGQTR+RNVNLG + + +KK++L++AK ER+RRA++K +E ++  IQ+ IR+  S 
Sbjct: 1   MLNFTGQTRRRNVNLGNRTRNSKKDLLEKAKRERERRAQDKLKEDASKTIQKSIRRHFSN 60

Query: 61  KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNIY 120
            +      TS ++VH++P  G KL+ Y+  ++L  +L +S +FL+ +  +LGN +LL++ 
Sbjct: 61  VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL 120

Query: 121 SDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVIAPVLSAWKV 180
               D  +    ++ LN+  P +D  +D+   ++     L  +S      +A V+ AW+V
Sbjct: 121 KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSA---SKLADVIEAWEV 177

Query: 181 QFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVLLENMSYLYSKLKH 240
             S     +F I+     +    L FY  L   +LLP + +N + +L +NM+  YS    
Sbjct: 178 MHSSASISIFSISIGSYEKRPFALQFYCILAERNLLPQL-INTNPILWDNMAKTYSHCSK 236

Query: 241 ANQHLYNIIRQCVTNVRYEPVNIRMRG---YVTEIYQKDFIYSYLDSINIHTNFSSD--- 294
             Q   NI +  + N         +R    YV + Y+K FI    + I    N+ SD   
Sbjct: 237 GGQK--NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFID---EVIATTANYVSDEDH 291

Query: 295 ---LLNFIENAPSEAERDSVYVSLLSRENFVENLLNIF--SRFQDPEQTYWDDITHYPAF 349
              L+ +I ++P+++ ++SV ++LLS ++FV  L   F  ++F   +         +P F
Sbjct: 292 VKNLMCYIASSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASK------TEAHPLF 345

Query: 350 KLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLYTNE 409
            +L QLI +HL +STD ELL   + I +E+L  FT  +KD  F   W  P ++      E
Sbjct: 346 SVLAQLIDMHLLISTDRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKE 405

Query: 410 ALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYRXXXXXXXX 469
           A+PLL  +Y RDSR+ F  + N +  YW      FL    Y+++Q+YED YR        
Sbjct: 406 AVPLLSKVYERDSRLHFLSTEN-NPTYWENSEKQFLNLRFYEELQEYEDLYREHLEEESD 464

Query: 470 XXXXXXXXXXXXXXXXXMNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRVEMF 529
                              LK+  L  M+ +  +  +FRKL+ILLE PF++PFE+RV++F
Sbjct: 465 EDMEKEIDLDKERPP----LKSLLLNKMKKRLKSSLRFRKLEILLELPFFIPFEERVDLF 520

Query: 530 YTLIEXXXXXXXXXXXXXXXXXXXXALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFK 589
           Y  I                          + R+Q+  ISRDNVLEDA+++FN  GERFK
Sbjct: 521 YMFIALDKKRLSLDDDHNLINMFTPWASTGM-RKQSAIISRDNVLEDAFNAFNSIGERFK 579

Query: 590 GKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNAT 649
             L VTF NEFG EAGIDGGGITKEFLT+V++EGFK+ K++LF TN  YELYPS   +AT
Sbjct: 580 ASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDAT 639

Query: 650 KMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLV 709
           K+KY +FLGKV+GKC+Y+ VLID+ F DF LKKLLN SN ++S F DL S D  LY NL+
Sbjct: 640 KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLI 699

Query: 710 KLLAMSASDLESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNR 769
           KLL M+  +++SL+L FE+D+  +   +V +LIPNGSKT VTK+NVL Y+  + D+KLN+
Sbjct: 700 KLLNMTTDEIKSLDLTFEIDEPESSA-KVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNK 758

Query: 770 SLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSL 829
              K V+A H GLSV+IAPHW EMFNS ELQ LISGE  +I+L+DLKSNT YGG+ +   
Sbjct: 759 RCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQ 818

Query: 830 TIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATC 889
           TI  FW++L EF+ +++L+ LKFVTSVPQAPLQGF AL+PKFGIRN+G E+ RLPTA+TC
Sbjct: 819 TIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTC 878

Query: 890 VNLLKLPDYADKELLRQK 907
           VNLLKLPDY +K +LR+K
Sbjct: 879 VNLLKLPDYRNKTILREK 896

>Scas_669.12
          Length = 958

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/968 (39%), Positives = 555/968 (57%), Gaps = 85/968 (8%)

Query: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60
           M+NFTGQTR+RNVNLG +  TTKK++L RA+LER++RA+++ +  +A  IQ  IR  L+C
Sbjct: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60

Query: 61  KKTALLNLTSPKV---VHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGT-ALGNW-- 114
           ++    ++    +   +H+ P  G ++L Y     L  +L ++K ++  + + +  N+  
Sbjct: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120

Query: 115 -KLLNIYSDCHDVNIANMCIN--CLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVI 171
            KLL+    C  ++     I+   L++   + +G+I     F++  E +  T    + +I
Sbjct: 121 TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFMQNGLI----PFLNHFEHVNETEAT-VSLI 175

Query: 172 APVLSAW-KVQFSQN---YRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVL 227
              L +W K  F         +F++   +C   E    F E L+LN  L       S +L
Sbjct: 176 FEYLCSWYKDDFEAKSIVQLEIFQLNIHRCKSRE----FIEFLLLNSFLTFESSVFSHLL 231

Query: 228 ------LENMSYLYSKLKH----------ANQHLYNIIRQCVTNVRY----------EPV 261
                 LEN   +Y +L +          +N +  +++ + V ++ Y            +
Sbjct: 232 REPMRVLENYFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCL 291

Query: 262 NIRMRGYVTEIYQKDFIYSYLD---SINIHTNFSSDLLNFIENAPSEAERDSVYVSLLSR 318
             +   ++  +++  FI ++L+   S     +F      F++ A    ++ SV ++ LS 
Sbjct: 292 PTKDAYHIKNLFESKFIDTFLEKRPSYEHEVHFMG-WYKFLQLADMCNKKTSVLLNFLSN 350

Query: 319 ENFVENLLNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLE 378
           ++       +F  F   +Q+         AF+LL +L+ + L +STD +LL + ++I + 
Sbjct: 351 KSL------MFELFTSIDQS-----DSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMN 399

Query: 379 QLVLFTDGIKDMVFNDMWTKPTNDSFLYTNEALPLLKIIYLRDSRMKFC-KSSNGD---- 433
           QL+ FT  +KD+VF+++W    +D       AL LL  +YLRDSR+ F  K  N D    
Sbjct: 400 QLISFTKSLKDLVFHNLWDLSKDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGH 459

Query: 434 ----------KEYWTVYNTDFLKTAIYKQIQDYEDYYRXXXXXXXXXXXXXXXXXXXXXX 483
                     K++W   + +FLK  IYK + +Y+D YR                      
Sbjct: 460 EIKDPNITTSKDFWATDDQNFLKINIYKILSNYDDAYRSKAELNEDNNEEEAGMENENNT 519

Query: 484 XXXMNLKANYLVNMEVKP--NNIKQFRKLKILLEAPFYVPFEQRVEMFYTLI--EXXXXX 539
               +LK      M      N  KQ RKL ILL  PF++PF +RV++FYTLI  +     
Sbjct: 520 MKKRSLKLEVFEEMSRNQTRNETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLN 579

Query: 540 XXXXXXXXXXXXXXXALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNE 599
                           +   + R+ AV ISR++VLEDA++S+N  GERFK +LSVTF NE
Sbjct: 580 LDDPDRNMMFELAMPWMSNGMGRQTAV-ISREHVLEDAFNSYNKIGERFKSRLSVTFVNE 638

Query: 600 FGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGK 659
           FGPEAGIDGGGITKEFLTSV+EEGFK  +YKLF+TN  YELYPS++V   K+KY +F+GK
Sbjct: 639 FGPEAGIDGGGITKEFLTSVSEEGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGK 698

Query: 660 VLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDL 719
           ++GKC+Y+ VLID+ F +F LKKLLN SN++   FDDL SLD SLY NL KLLAM+  ++
Sbjct: 699 IVGKCLYEHVLIDVSFANFFLKKLLNYSNNFQLSFDDLSSLDSSLYMNLTKLLAMTDEEI 758

Query: 720 ESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALH 779
           +SL L FE+   S+ K++  ELIPNGS   VTK NVLQYL  ++++KLN S+ +Q  + H
Sbjct: 759 QSLGLTFEMT--SSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFH 816

Query: 780 RGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILE 839
            GLS MI P W EMFNS ELQ LISG GKDI+L+DLK+N  YGGFS    TI   W+I+ 
Sbjct: 817 GGLSTMILPTWVEMFNSIELQMLISGGGKDIDLDDLKNNVEYGGFSSDDKTIVALWEIMA 876

Query: 840 EFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYA 899
           E   ++RL  +KFVTSVPQAPLQGF ALEP+FGIRN+G E DRLPTA+TCVNLLKLPDY 
Sbjct: 877 ECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQ 936

Query: 900 DKELLRQK 907
           DKELLR+K
Sbjct: 937 DKELLREK 944

>Kwal_23.3481
          Length = 908

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/922 (38%), Positives = 521/922 (56%), Gaps = 43/922 (4%)

Query: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60
           MLNFTGQT++RNVNLG K   TK+E+L  A+ ER+RRA  ++ E +A  IQ  IR++ S 
Sbjct: 1   MLNFTGQTKRRNVNLGNKSGRTKQELLNEARKERERRALIRRNEENAVIIQSAIRRYESS 60

Query: 61  KK--TALLNLTSPKVVH-LVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLL 117
           K   TA +N     +   L+          LG      +LN     +T  G  + N ++ 
Sbjct: 61  KSSYTAFINNLDQDIARSLIIAYPVSTFHTLGEEVTQRVLNC----VTNEGQYVLNLRIT 116

Query: 118 NIYSD-----CHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGL-HIDVI 171
            + S+     C +  I  +    + I  P  +  + + IK ++S       + L HI  +
Sbjct: 117 RLLSELGSRECSETFINTVLSKLVPINPPKAE-YVQSIIKLLTSATYEFSAAILSHIVQL 175

Query: 172 APVLSAWKVQFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLP---MVELNGSSVLL 228
               + W+   SQ    +F I          +  F +  +L+   P   + E   S  L+
Sbjct: 176 VHDFNIWE---SQLLTLLFSIPIEDSKVASNIRQFLQ--LLSKTCPPQDLSEDTSSRHLV 230

Query: 229 ENMSYLY-SKLKHANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSYLDSINI 287
           +N++Y+Y + +  A   L + + + +   R   + +    + + +Y + F+   + S + 
Sbjct: 231 DNLAYIYTAAVDSAKPKLADAVLKSLKPFR--GLVLGDCPHFSGLYTRSFVDVVMRSSS- 287

Query: 288 HTNFSSDLLNFIENAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYWDDITHYP 347
              F   + + I  AP    +++V ++LL++   +    N     Q  ++    ++   P
Sbjct: 288 -DGFYDKMSDLISQAPDVDRKNNVLIALLAKPGALSQAYN-----QAIDKN--SEMASKP 339

Query: 348 AFKLL-CQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLY 406
              LL  +++ ++L +++D+E+L+N     L+ L   T  +K++ F ++W +      L 
Sbjct: 340 KNALLLVEMLNLYLSVASDYEILHNVETFPLQYLQKATVFLKNVCFENLWDESGRQEVL- 398

Query: 407 TNEALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYRXXXXX 466
            +  L  LK I+LRDSR+ FC S N   ++W+V +  FL   I   I+DYE +YR     
Sbjct: 399 ADCYLSTLKKIHLRDSRLHFC-SQNNKIDFWSVLDEGFLNVNITNYIKDYESFYRDHLNA 457

Query: 467 XXXXXXXXXXXXXXXXXXXXMNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRV 526
                                +  +   V+   +P   +Q+RKL IL  APFY+PF+QRV
Sbjct: 458 VENENDEKGYEDSMKRSDLRRDFLSAAQVSFSNRPTT-RQYRKLNILFNAPFYIPFQQRV 516

Query: 527 EMFYTLIEXXXXXXXXXXXXXXXXXXXXALGPSLSRRQAVNISRDNVLEDAYSSFNPAGE 586
           +  Y LI                      + P+  ++ A  ISR+N+LEDA++++NP GE
Sbjct: 517 DWLYLLISLDHQRLDLSQNGLGSVFSPWNMRPNFDKQNAT-ISRENLLEDAFAAYNPIGE 575

Query: 587 RFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEV 646
            FK KLS+TF NEFGPEAGIDGGGITKEFLTS+T++ FK+DKY+LF  N+N+E+YP+S +
Sbjct: 576 SFKSKLSITFVNEFGPEAGIDGGGITKEFLTSITDKAFKDDKYQLFKHNKNHEIYPASNL 635

Query: 647 N-ATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLY 705
           N +  + Y +FLGKVLGKC+YD VL+D+ F DF LKKLLN +N   S FDDL SLD  LY
Sbjct: 636 NDSANVNYVWFLGKVLGKCLYDHVLVDVTFADFFLKKLLNFNNSN-SSFDDLASLDPDLY 694

Query: 706 QNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADF 765
            NL KLL M++ +L++L L FE+ D  T  +R  EL+PNGS   V K+NVL +L+ ++DF
Sbjct: 695 SNLAKLLVMNSDELQALGLLFEITDEDT--HRTVELVPNGSSLRVDKSNVLHFLLAVSDF 752

Query: 766 KLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFS 825
           KLN+ L     A   GL  MI PHW EMFNS+ELQ LISG GKDI+LEDL++NT YG ++
Sbjct: 753 KLNKKLRVGTRAFTGGLYTMIPPHWIEMFNSAELQMLISGGGKDIDLEDLQNNTEYGDYT 812

Query: 826 DTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPT 885
               TI+ FW+IL E  P+ RL  +KFVTSVP+APLQGFG+L P+FGIRN+G +  RLPT
Sbjct: 813 YKHQTIKDFWEILAECSPEDRLKFVKFVTSVPRAPLQGFGSLSPRFGIRNAGQDTSRLPT 872

Query: 886 AATCVNLLKLPDYADKELLRQK 907
           A+TCVNLLKLPDY +KE+LR K
Sbjct: 873 ASTCVNLLKLPDYRNKEILRAK 894

>ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH]
           complement(209353..212154) [2802 bp, 933 aa]
          Length = 933

 Score =  504 bits (1297), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 322/955 (33%), Positives = 511/955 (53%), Gaps = 84/955 (8%)

Query: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60
           MLNF+G T++RNVNLG  ++  K E++++A+LER+RRA+EK+ + S   IQR  R++ + 
Sbjct: 1   MLNFSGSTKRRNVNLGSSKKINKSELIEKARLERERRAQEKRIQESTLCIQRCARRW-TA 59

Query: 61  KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQ---FGTALGNWK-- 115
           ++  L +L            G+++L+  G   L +    +   + +     +A   W+  
Sbjct: 60  RRRVLGSLDGVAAREY----GTQILVAFGAGILHYARGDAVAAVVEACSVDSATAYWRCT 115

Query: 116 -LLNIYSDCHDVNIANMCINCLNIG--IPLIDG-------------IIDANIKFISSNEV 159
            LL   +   +  +    ++ LN     PL D              ++ A ++ +   E 
Sbjct: 116 ELLEQVARGGETGLVRQLLDKLNAAGARPLTDAGAAPGGRLQRIERLVGARLRVL---EA 172

Query: 160 LRG--TSGLHIDVIAPVLSAWKVQFSQ--NYRRVFEITESQCVQFEEVLHFYEGLVLNDL 215
           +RG  T      ++A V S  +++  +   +  ++ + +++ V+    L  Y   +   L
Sbjct: 173 MRGELTRRDMNALLAVVPSGGEMRGDEAVQWAALYGVEQAR-VRVRANLLCYLRELAQRL 231

Query: 216 LPMVELNGSSVLLENMSYL----YSKLKHANQHLYNIIRQCV---TNVRYEPVNIRMRGY 268
            P V L      ++ + YL      +L      +Y ++  C+    +  ++  +   + Y
Sbjct: 232 SPEVVLQQGPCSVDTIYYLTYLFAERLGRDPDAIYAVLCACIDQHKSFEFDSGSFFFQ-Y 290

Query: 269 VTEIYQ---KDFIYSYLDSINIHTNFSSDLLNFIENAPSEAERDSVYVSLLSRENFVENL 325
           V  IY       +  YL + ++ T  S     F++ APS  + + + + +++  + ++ L
Sbjct: 291 VEGIYSYRTASLLAGYLRTHSVPTA-SQYAKVFLDRAPSPRQAEVLLLGIVADADAMQRL 349

Query: 326 LNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTD 385
           +         ++          +F LL + + ++L    D  LL  ++   LE LV+F +
Sbjct: 350 V---------QECKTSGAVTSASFSLLTECLDIYLSYVNDTVLLGPKSNFPLEDLVVFCN 400

Query: 386 GIKDMVFNDMWTKPTNDSFL-YTNEALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDF 444
            ++D +   +  +  +D  +     AL LL+ +Y+RD R  F  ++ GD ++W + +T  
Sbjct: 401 LVRDAISQAL--RAEHDYEVNKMRRALSLLQKLYIRDRRTNFLSAAKGD-DFWVIADTTV 457

Query: 445 LKTAIYKQIQDYEDYYRXXXXXXXXXXXXXXXXXXXXXXXXXMNLKANYLVNMEVKPNNI 504
               I   +  ++++YR                          ++K  +      K  + 
Sbjct: 458 KNCDITSLLLYFDEFYREQLDLFLAQGRARHEVPSGDLVAWENDIKVKFFSEKSSKHASW 517

Query: 505 KQF--RKLKILLEAPFYVPFEQRVEMFYTLIEXXXXXXXXXXXXXXXXXXXXALGPSL-- 560
                RK +++L APF +PF +RV  F TLI                       GP+L  
Sbjct: 518 GSLALRKFELVLRAPFLLPFRERVAYFETLIHHDRRRLQGRHT-----------GPALRL 566

Query: 561 -------SRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITK 613
                  SRRQ   ISR+N+LEDAY ++NP GE FK +L+VTF NEFGPEAGIDGGGITK
Sbjct: 567 PDLYFPSSRRQRAIISRNNILEDAYEAYNPLGEDFKDQLAVTFINEFGPEAGIDGGGITK 626

Query: 614 EFLTSVTEEGFKNDKYKLFDTNQNYELYPS-SEVNATKMKYYYFLGKVLGKCIYDRVLID 672
           EFLTSV++EGF  DKY+LF  N  YELYPS +  +  +++Y +FLGKVLGKC+Y++VLID
Sbjct: 627 EFLTSVSDEGFNKDKYRLFKANSVYELYPSDAATSPQQLQYLHFLGKVLGKCLYEKVLID 686

Query: 673 IHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLS 732
           +HF DF L KLL++S +    FD+L S D  LY NL KL  MS ++L+ L+L  E+ D +
Sbjct: 687 VHFADFFLHKLLSTSKNMACSFDNLPSFDRELYDNLNKLFDMSTAELQLLDLRMEIVDEN 746

Query: 733 TGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFE 792
           T K  + EL+P GS+  VT  NV QY + +A +++N  L +       G++V+I PHW  
Sbjct: 747 TMK--IVELVPGGSQIPVTTTNVRQYALAVASYRMNSQLARATFYFQTGMAVIIPPHWIA 804

Query: 793 MFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKF 852
           +F+SSEL KLISG G+DI+L DL++N  YGG+ ++  TIQ+ WQ+L EF P+QR   +KF
Sbjct: 805 IFSSSELSKLISGGGRDIDLADLRANVTYGGYVESDPTIQHLWQLLLEFTPEQRCKFIKF 864

Query: 853 VTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
            TSVP+APL GF  L PKFGIRN+G + +RLPTA+TCVNLLKLPDY DK+LLR+K
Sbjct: 865 ATSVPRAPLLGFQMLNPKFGIRNAGTDYNRLPTASTCVNLLKLPDYQDKDLLREK 919

>KLLA0E14740g complement(1316238..1318958) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase (E3), start by similarity
          Length = 906

 Score =  421 bits (1082), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 304/929 (32%), Positives = 483/929 (51%), Gaps = 59/929 (6%)

Query: 1   MLNFTGQTRKRNVNLG-RKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLS 59
           M+NF GQ  +RNVN+G R  + T+  IL+ A+LER RR  E+ +  +   IQR +RK +S
Sbjct: 1   MMNFNGQVTRRNVNMGSRAPRKTRDTILKNAELERARRQRERAEINAVLTIQRYMRKRIS 60

Query: 60  ----CKKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILN---VSKHFLTQFGTALG 112
                 +    +LT      ++ +   +L  YL  +E ++++N        L  F   LG
Sbjct: 61  NNLIFHRLVKQSLTDKTAASILKVFSKRLYAYLEPNEFVYLINRTVADSSALFLFSNMLG 120

Query: 113 NWKLLNIYSDCHDVNIANMCINCLNIGIPLIDGI-IDANIKFISSNEVLRGTSGLHIDVI 171
           +        +   +    +  +  ++  P      I   +KF+ +   L     L   + 
Sbjct: 121 DVSERKTSEELDTI----LMRSVKSLDTPAASETHIHNKLKFVLNCPYLITDEQLSA-LT 175

Query: 172 APVLSAWKVQFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVEL------NGSS 225
            P  ++   ++   +  ++ I+    ++ E  L F   L  ++L P ++       +  +
Sbjct: 176 QPSCNS-SGEYENYWNDLYFISSLHTMKKENYLLFISALFSSELKPQLQCALDRNKDDMA 234

Query: 226 VLLENMSYLYSKLKHANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYSYLDSI 285
             + N    +  +K A   ++      + +   EP++I +R  + +  Q+  +  + D +
Sbjct: 235 NYVVNFLAAFKGIKEATLSVHTSWFVIICSKLNEPLSIDVR-LIDDNLQESLLNCF-DWL 292

Query: 286 NIHTNFSSDLLNFIENAPSEAERDSVYVSLLSRENFVENLLNIFSRFQDPEQTYWDD--I 343
              ++     ++F  +     +R+S+ +S+L+  +   +LL +            DD   
Sbjct: 293 KEESSSYWKGIHFFLSQLPSMQRNSILMSILTNTHIRNDLLELLC----------DDSVA 342

Query: 344 THYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDS 403
            +  AF +  Q++  ++ LS D +L   +  I  ++L   +  I  ++ + +     +D+
Sbjct: 343 ANLNAFSVCSQMLNFYIPLSPDDQLF--KTIITRDRLQALSINIAKLLISSIL---GSDT 397

Query: 404 FLYTNEALPLLK----IIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDY 459
           F+ + E    ++    +IYL DSR++F K   G   +W +   +     I K+I ++E Y
Sbjct: 398 FIPSQELDTFIELMWNLIYL-DSRVQFLKK--GTSTFWDLVPEEMHNLNIKKEILEFEQY 454

Query: 460 YRXXXXXXXXXXXXXXXXXXXXXXXXXMNLKANYLVNMEVK-PNNIKQFRKLKILLEAPF 518
           YR                          N+K  YL +++ K   +  + RKL++L + PF
Sbjct: 455 YR-AYLVRFEEMDLNEDEMFDKKKFIDQNIKGQYLDDLKSKRRGSSSKIRKLELLFKFPF 513

Query: 519 YVPFEQRVEMFYTLIEXXXXXXXXXXXXXXXXXXXXALGPSLSRRQAVNISRDNVLEDAY 578
            + F +RV+ F  LIE                     + P  +R ++  I R++ LEDAY
Sbjct: 514 MIKFFERVDYFNDLIE-------ADKIRIYSRNSFFGVFPGENRLRST-IRREHALEDAY 565

Query: 579 SSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNY 638
           +++   GE FK KL + F NEFGPEAGIDGGGITKEFL ++ +EGF N  +KLFDT    
Sbjct: 566 NAYGAVGEMFKEKLGIQFVNEFGPEAGIDGGGITKEFLQTLVQEGFINQPFKLFDTTSFN 625

Query: 639 ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQ 698
           +LYPS  V+   +KY  F+GK+LGKC+Y+ +L+D+   DF LKK+LN  N+    F+DL 
Sbjct: 626 KLYPSKNVSPQNLKYISFMGKILGKCLYENILVDVELADFFLKKILNVENNMNVPFNDLY 685

Query: 699 SLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQY 758
           SLD   Y+NL+KLL MS ++L  ++L+FEV D   GK     LI +G  T VT+ NV +Y
Sbjct: 686 SLDPEYYRNLMKLLEMSENELAYMDLYFEVPDAPNGKR--IPLIKDGLSTKVTQKNVFEY 743

Query: 759 LVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSN 818
           +  I+ +KLN  L    +    GLS MI  HW  MF S EL+ LISG  KD +LEDLK N
Sbjct: 744 ITRISHYKLNLQLYTVTSRFITGLSYMIPAHWLRMFTSYELKTLISGSEKDFDLEDLKKN 803

Query: 819 TIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGP 878
           T YGGFS++S+TIQ+FWQ+L  F P++R   LKFV SVP APL+GF +L P FGIRN+G 
Sbjct: 804 TSYGGFSESSVTIQHFWQVLSSFTPEERRKFLKFVFSVPTAPLKGFHSLNPLFGIRNAGD 863

Query: 879 ERDRLPTAATCVNLLKLPDYADKELLRQK 907
           E DRLPTA+TC+NLLKLPDY +   LR+K
Sbjct: 864 ETDRLPTASTCINLLKLPDYQNYHTLREK 892

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
            (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score =  179 bits (453), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 184/352 (52%), Gaps = 23/352 (6%)

Query: 565  AVNISRDNVLEDAYSS-FNPAGERFK-GKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            ++++ R++V  D+Y S F  + E  K  KL ++F  E    AG+D GGIT+E+   ++ +
Sbjct: 2902 SISVRREHVFLDSYRSLFFKSNEDIKISKLEISFKGE----AGVDAGGITREWYQVLSRQ 2957

Query: 623  GFKNDKYKLF----DTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDF 678
             F  D Y LF         +    +S +N   + ++ F+G ++GK I D+  +D HF+  
Sbjct: 2958 MFNPD-YALFIPVASDKTTFRPNRTSGINPEHLSFFKFIGMIIGKAISDQCFLDCHFSRE 3016

Query: 679  LLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRV 738
            + K +L           D++SLD   Y++L+ +L    +D+       E DD   G+++V
Sbjct: 3017 VYKNILGKP----VALKDMESLDLDYYKSLIWILENDITDIIEETFSVETDDY--GEHKV 3070

Query: 739  TELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSE 798
             ELI NG+   VT+ N   Y+  I ++KL  S+  Q+    +G   +I      +F+  E
Sbjct: 3071 IELIENGAHVAVTEQNKHDYVKKIVEYKLQTSVKDQMENFLQGFYAIIPKDLISIFDEQE 3130

Query: 799  LQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQ 858
            L+ L+SG   DI+++D K+NTIY  ++ T   I YFW+ +  F+ ++R  LL+FVT   +
Sbjct: 3131 LELLVSG-LPDIDVDDWKNNTIYVNYTPTCKQINYFWRAVRSFDKEERAKLLQFVTGTSK 3189

Query: 859  APLQGFGALE-----PKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
             PL GF  L       KF I       DRLP++ TC N L LP Y   E LR
Sbjct: 3190 VPLNGFKELSGVNGISKFSIHRDYGSIDRLPSSHTCFNQLDLPAYDSYETLR 3241

>Kwal_47.18389
          Length = 3229

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 186/352 (52%), Gaps = 23/352 (6%)

Query: 565  AVNISRDNVLEDAYSS-FNPAGERFK-GKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            ++++ RD V  D+Y S F  + E  K  KL +TF  E    AG+D GG+T+E+   ++ +
Sbjct: 2873 SISVRRDQVFLDSYRSLFFKSNEDIKNSKLEITFKGE----AGVDAGGVTREWYQVLSRQ 2928

Query: 623  GFKNDKYKLF--DTNQNYELYP--SSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDF 678
             F  D Y LF    +     +P  +S +N   + ++ F+G ++GK I D+  +D HF+  
Sbjct: 2929 MFNPD-YALFLPVASDKTTFHPNRTSSINPEHLSFFKFIGMIIGKAICDQCFLDCHFSRE 2987

Query: 679  LLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRV 738
            + K +L           D++SLD   Y++L+ +L    +D+       E DD   G+++V
Sbjct: 2988 VYKNILGKP----VALKDMESLDLDYYKSLIWILENDITDIIEESFSVETDDY--GEHKV 3041

Query: 739  TELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSE 798
             +LI NG   +VT+ N  +Y+  I ++KL+ S+ +Q+     G   +I      +F+  E
Sbjct: 3042 IDLIENGRNILVTEQNKQEYVKKIVEYKLHTSVKEQMDNFLLGFYAIIPKELVAIFDEQE 3101

Query: 799  LQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQ 858
            L+ LISG   DI+++D K+NT Y  ++ T   I YFW+ +  F+ ++R  LL+FVT   +
Sbjct: 3102 LELLISG-LPDIDVDDWKNNTNYVNYTPTCKQINYFWRAVRSFDSEERAKLLQFVTGTSK 3160

Query: 859  APLQGFGALE-----PKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
             PL GF  L       KF I       DRLP++ TC N L LP Y   E LR
Sbjct: 3161 VPLSGFKELTGVNGISKFSIHRDYGATDRLPSSHTCFNQLDLPAYDSYETLR 3212

>Scas_717.60
          Length = 3259

 Score =  173 bits (439), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 184/351 (52%), Gaps = 23/351 (6%)

Query: 566  VNISRDNVLEDAYSS--FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEG 623
            + + RD V  D+Y +  F    E    KL +TF  E    +G+D GG+T+E+   ++ + 
Sbjct: 2904 ITVRRDQVFLDSYRALFFKKDEEIKDSKLEITFKGE----SGVDAGGLTREWYQVLSRQM 2959

Query: 624  FKNDKYKLF--DTNQNYELYP--SSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFL 679
            F  D Y LF    +     +P  +S +N   + ++ F+G V+GK I D+  +D HF+  +
Sbjct: 2960 FNPD-YALFLPVASDKTTFHPNRTSGINPEHLSFFKFIGMVIGKAIRDQCFLDCHFSREV 3018

Query: 680  LKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVT 739
             K +L           D++SLD   Y++LV +L    +D+       E+DD   G+++  
Sbjct: 3019 YKNILGKP----VSLRDMESLDPDYYKSLVWILENDITDIIEETFSVELDDY--GEHKTI 3072

Query: 740  ELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSEL 799
            +LI NG+   VT+ N  +Y+  I ++KLN S+ +Q+    RG   +I  +   +F+  EL
Sbjct: 3073 DLIENGANIPVTEENKQEYVKKIVEYKLNTSVKEQMDNFLRGFYALIPLNLISIFDEQEL 3132

Query: 800  QKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQA 859
            + LISG   DI+++D K+NT Y  ++ +   I YFW+ +  F+ ++R  LL+FVT   + 
Sbjct: 3133 ELLISG-LPDIDVDDWKNNTNYVNYTISDREIGYFWRAVRSFDGEERAKLLQFVTGTSKV 3191

Query: 860  PLQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
            PL GF  L       KF I       +RLP++ TC N L LP Y   E LR
Sbjct: 3192 PLNGFKELGGVNGVCKFSIHKDYGSTERLPSSHTCFNQLNLPAYNSYETLR 3242

>CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces
            cerevisiae YDR457w ubiqitin ligase, start by similarity
          Length = 3247

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 183/351 (52%), Gaps = 23/351 (6%)

Query: 566  VNISRDNVLEDAYSS-FNPAGERFK-GKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEG 623
            + + RD V  D+Y + F  + E  K  +L +TF  E    +G+D GG+T+E+   ++ + 
Sbjct: 2892 IPVRRDQVFLDSYRALFFKSNEEIKNSRLEITFKGE----SGVDAGGVTREWYQVLSRQM 2947

Query: 624  FKNDKYKLF----DTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFL 679
            F N  Y LF         +    +S VN   + ++ F+G V+GK I D+  +D HF+  +
Sbjct: 2948 F-NPGYALFTPVASDKTTFRPNRASGVNPEHLSFFKFVGMVIGKAIRDQCFLDCHFSREV 3006

Query: 680  LKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVT 739
             K +L           D++SLD   Y++LV +L    +D+       E DD   G++++ 
Sbjct: 3007 YKSILGKP----VALKDMESLDLDYYKSLVWILENDITDIIEETFSVETDDY--GEHKII 3060

Query: 740  ELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSEL 799
            +LI NG    VT++N   Y+  I ++KL+ S+ +Q+     G   +I      +F+  EL
Sbjct: 3061 DLIDNGRNVSVTESNKQDYVRKIVEYKLHTSVKEQMDNFLSGFYALIPKDVISIFDEQEL 3120

Query: 800  QKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQA 859
            + LISG   DI+++D K+NT Y  ++++   + YFW+ +  F+ +++  LL+FVT   + 
Sbjct: 3121 ELLISG-LPDIDVDDWKNNTTYVNYTESCKQVSYFWRAVRSFDAEEKAKLLQFVTGTSKV 3179

Query: 860  PLQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
            PL GF  L       KF I       +RLP++ TC N L LP YA  + LR
Sbjct: 3180 PLNGFKELSGVSGVCKFSIHRDYGSTERLPSSHTCFNQLNLPAYASYDTLR 3230

>YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required for
            the G2/M transition, has similarity to Rsp5p, a
            ubiquitin-protein ligase (E3 enzyme) [9807 bp, 3268 aa]
          Length = 3268

 Score =  169 bits (428), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 177/351 (50%), Gaps = 23/351 (6%)

Query: 566  VNISRDNVLEDAYSS--FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEG 623
            + + R+ V  D+Y +  F    E    KL +TF  E    +G+D GG+T+E+   ++ + 
Sbjct: 2913 ITVRREQVFLDSYRALFFKTNDEIKNSKLEITFKGE----SGVDAGGVTREWYQVLSRQM 2968

Query: 624  FKNDKYKLF----DTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFL 679
            F  D Y LF         +    +S +N   + ++ F+G ++GK I D+  +D HF+  +
Sbjct: 2969 FNPD-YALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREV 3027

Query: 680  LKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVT 739
             K +L           D++SLD   Y++LV +L    +D+       E DD   G+++V 
Sbjct: 3028 YKNILGRP----VSLKDMESLDPDYYKSLVWILENDITDIIEETFSVETDDY--GEHKVI 3081

Query: 740  ELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSEL 799
             LI  G   +VT+ N   Y+  + ++KL  S+ +Q+     G   +I+     +F+  EL
Sbjct: 3082 NLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQEL 3141

Query: 800  QKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQA 859
            + LISG   DI+++D K+NT Y  ++ T   + YFW+ +  F+ ++R  LL+FVT   + 
Sbjct: 3142 ELLISG-LPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKV 3200

Query: 860  PLQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
            PL GF  L       KF I       +RLP++ TC N L LP Y   E LR
Sbjct: 3201 PLNGFKELSGVNGVCKFSIHRDFGSSERLPSSHTCFNQLNLPPYESYETLR 3251

>KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyces
            cerevisiae YDR457w TOM1 E3 ubiqitin ligase required for
            G2/M transition, start by similarity
          Length = 3242

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 184/358 (51%), Gaps = 25/358 (6%)

Query: 561  SRRQAVNIS--RDNVLEDAYSS--FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFL 616
            + RQ ++I+  RD V  D+Y +  F    E    KL +TF  E    AG+D GG+T+E+ 
Sbjct: 2880 TTRQKLSITVLRDQVFLDSYRALFFKSNDEIKNCKLDITFKGE----AGVDEGGVTREWY 2935

Query: 617  TSVTEEGFKNDKYKLF----DTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLID 672
              ++ + F  D Y LF      N  +    +S +N   + ++ F+G ++GK I D   +D
Sbjct: 2936 QVLSRQMFNPD-YALFIPVGTDNTKFRPNRTSGINPEHLSFFKFVGMIIGKAISDNCFLD 2994

Query: 673  IHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLS 732
             HF+  + K +L           D++SLD   Y++L  +L    + +  ++  F VD   
Sbjct: 2995 CHFSREVYKNILGKP----VSLKDMESLDLEYYKSLNWMLENDITYV--IDETFSVDTDD 3048

Query: 733  TGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFE 792
             G+++  +LIPNG    VT+ N  +Y+  I ++KL  S+   +  L +G   +I      
Sbjct: 3049 YGEHKTIDLIPNGRNIPVTEENKKEYVQKIVEYKLQESVKDHMQNLLQGFYAVIDKDLIS 3108

Query: 793  MFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKF 852
            +F+  EL+ LISG   DI+++D K+NT Y  ++ T   I YFW+ +  F+ ++R  LL+F
Sbjct: 3109 IFDEQELELLISG-LPDIDVDDWKNNTTYVNYTPTCKQINYFWRAVRSFDKEERAKLLQF 3167

Query: 853  VTSVPQAPLQGFGAL-----EPKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLR 905
            VT   + PL GF  L     + KF I       +RLP++ TC N L LP Y   E LR
Sbjct: 3168 VTGTSKLPLNGFKDLSGINGDSKFSIHRDYGSTERLPSSHTCFNQLDLPAYDSYEQLR 3225

>KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces
           cerevisiae YER125w RSP5 hect domain E3 ubiquitin-protein
           ligase, start by similarity
          Length = 819

 Score =  162 bits (410), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/352 (30%), Positives = 182/352 (51%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R N+ ED+Y        E  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 467 IRVRRKNIFEDSYQEIMRQTPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 522

Query: 625 KNDKYKLFD--TNQNY--ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+   + NY  ++ P+S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 523 -NPFYCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 581

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L           D++ +D  +Y +L  +L  S   +  L+L F VDD   G+  V +
Sbjct: 582 KMMLRKK----VVLQDMEGVDSEVYNSLKWILENSIDGI--LDLTFNVDDERFGELVVVD 635

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L PNG +  VT  N  +Y+ L   +++   + +Q  A   G + ++      +F+  EL+
Sbjct: 636 LKPNGREIEVTDENKKEYVELYTQWRIADRVQEQFKAFMDGFNELVPEDLVNVFDERELE 695

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++   IQ+FW+ + E++ +QR  LL+F T   + P
Sbjct: 696 LLIGGIA-EIDVEDWKKHTDYRGYQESDEVIQWFWKCITEWDNEQRARLLQFTTGTSRIP 754

Query: 861 LQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF  L+      +F I  +G E  +LP + TC N + LP Y D E  +QK
Sbjct: 755 VNGFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPPYTDYESFKQK 805

>Kwal_47.17302
          Length = 787

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/352 (30%), Positives = 181/352 (51%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R N+ EDAY        E  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 435 IKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 490

Query: 625 KNDKYKLFD--TNQNY--ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+   + NY  ++ P S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 491 -NPFYCLFEYSAHDNYTIQINPKSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 549

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L    H      D++ +D  +Y +L  +L  S   +  L+L F  DD + G+    +
Sbjct: 550 KMML----HKKVVLQDMEGVDAEVYNSLKWILENSIEGV--LDLTFSADDETFGEVMTVD 603

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L P+G    VT  N  +Y+ L   +K    + +Q  A   G + +I      +F+  EL+
Sbjct: 604 LKPDGRNIEVTDENKKEYVELFTQWKTCSRVQEQFKAFMDGFNELIPEDLVNVFDERELE 663

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++  TI++FW+ + E++ +Q+  LL+F T   + P
Sbjct: 664 LLIGGIA-EIDVEDWKKHTDYRGYQESDETIKWFWKAISEWDNEQKARLLQFTTGTSRIP 722

Query: 861 LQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF  L+      +F I  +G E  +LP + TC N + LP Y D E L+QK
Sbjct: 723 VNGFKDLQGSDGPRRFTIEKAG-EIQQLPKSHTCFNRVDLPPYDDYESLKQK 773

>ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH]
           (584035..586488) [2454 bp, 817 aa]
          Length = 817

 Score =  156 bits (395), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 184/352 (52%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R N+ EDAY      + +  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 465 IRVRRKNIFEDAYQEIMRQSPDDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 520

Query: 625 KNDKYKLFD--TNQNY--ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+  ++ NY  ++ P+S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 521 -NPFYCLFEYSSHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 579

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L           D++ +D  +Y +L  +L  S + +  L+L F  DD   G+    +
Sbjct: 580 KMMLRKK----VVLQDMEGVDSEVYNSLKWILENSIAGI--LDLTFSADDERFGEVVTVD 633

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L PNG    VT +N  +Y+ L   +K+   +  Q  A   G + +I      +F+  EL+
Sbjct: 634 LKPNGRNIDVTDDNKKEYVELFTQWKICSRVEDQFKAFIDGFNELIPEDLVNVFDERELE 693

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++   I++FW+ + E++ +Q+  LL+F T   + P
Sbjct: 694 LLIGGIA-EIDVEDWKKHTDYRGYQESDEVIKWFWKCISEWDNEQKARLLQFTTGTSRIP 752

Query: 861 LQGF----GALEP-KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF    G+  P +F I  +G E  +LP + TC N + LP Y D + L+QK
Sbjct: 753 VNGFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPAYHDYDTLKQK 803

>YER125W (RSP5) [1555] chr5 (410185..412614) Essential
           ubiquitin-protein ligase (E3 enzyme), a member of HECT
           domain family of ligases, may be involved in the
           maintenance and remodeling of actin cytoskeleton during
           endocytosis [2430 bp, 809 aa]
          Length = 809

 Score =  156 bits (395), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 179/352 (50%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R N+ EDAY        E  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 457 IKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 512

Query: 625 KNDKYKLFD----TNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+     N   ++ P+S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 513 -NPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 571

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L           D++ +D  +Y +L  +L  S   +  L+L F  DD   G+    +
Sbjct: 572 KMMLRKK----VVLQDMEGVDAEVYNSLNWMLENSIDGV--LDLTFSADDERFGEVVTVD 625

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L P+G    VT  N  +Y+ L   +++   + +Q  A   G + +I      +F+  EL+
Sbjct: 626 LKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELE 685

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++   IQ+FW+ + E++ +QR  LL+F T   + P
Sbjct: 686 LLIGGIA-EIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIP 744

Query: 861 LQGF----GALEP-KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF    G+  P +F I  +G E  +LP + TC N + LP Y D + ++QK
Sbjct: 745 VNGFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPQYVDYDSMKQK 795

>Scas_627.2
          Length = 835

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 181/352 (51%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R N+ EDAY      + E  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 483 IKVRRKNIFEDAYQEIMRQSPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 538

Query: 625 KNDKYKLFD--TNQNY--ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+   + NY  ++ P+S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 539 -NPFYCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 597

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L           D++ +D  +Y +L  +L  S   +  L+L F  DD   G+    +
Sbjct: 598 KMMLRKK----VILQDMEGVDADVYNSLNWMLENSIDGV--LDLTFSADDERFGEVVTVD 651

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L  NG    VT  N  +Y+ L A +K+   + +Q  A   G + +I      +F+  EL+
Sbjct: 652 LKENGRDIEVTDENKKEYVELFAQWKIVDRVQEQFRAFMDGFNELIPEDLVTVFDERELE 711

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++   +++FW+ + E++ +QR  LL+F T   + P
Sbjct: 712 LLIGGIA-EIDVEDWKKHTDYRGYQESDEVVKWFWKCISEWDNEQRARLLQFTTGTSRIP 770

Query: 861 LQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF  L+      +F I  +G E  +LP + TC N + LP Y D + L+QK
Sbjct: 771 VNGFKDLQGSDGPRRFTIEKAG-EAQQLPKSHTCFNRVDLPVYEDYDNLKQK 821

>CAGL0K02255g complement(199719..202187) highly similar to sp|P39940
           Saccharomyces cerevisiae YER125w Ubiquitin--protein
           ligase, start by similarity
          Length = 822

 Score =  151 bits (381), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 182/352 (51%), Gaps = 23/352 (6%)

Query: 566 VNISRDNVLEDAYSS-FNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF 624
           + + R+N+ EDAY        E  K +L + F  E     G+D GG+++EF   ++ E F
Sbjct: 470 IKVRRNNIFEDAYQEIMRQTPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMF 525

Query: 625 KNDKYKLFD--TNQNY--ELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLL 680
            N  Y LF+   + NY  ++  +S +N   + Y+ F+G+V+G  ++ R  +D  F   L 
Sbjct: 526 -NPFYCLFEYSAHDNYTIQINSNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALY 584

Query: 681 KKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE 740
           K +L           D++ +D  +Y +L  +L  S   +  L+L F  DD   G+    +
Sbjct: 585 KMMLRKK----VALQDMEGVDADVYNSLKWMLENSIDGV--LDLTFSADDERFGEVVTVD 638

Query: 741 LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQ 800
           L P+G    VT     +Y+ L + +++   +++Q  A   G + +I      +F+  EL+
Sbjct: 639 LKPDGRNIEVTDEVKKEYVELYSQWRIVDRVSEQFKAFMDGFNELIPEDLVTVFDERELE 698

Query: 801 KLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAP 860
            LI G   +I++ED K +T Y G+ ++   IQ+FW+ + E++ +QR  LL+F T   + P
Sbjct: 699 LLIGGIA-EIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIP 757

Query: 861 LQGFGALEP-----KFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           + GF  L+      +F I  +G E ++LP + TC N + LP YAD + + +K
Sbjct: 758 VNGFKDLQGSDGPRRFTIEKAG-EVEQLPKSHTCFNRVDLPPYADYDSMAKK 808

>AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH]
           complement(505311..507830) [2520 bp, 839 aa]
          Length = 839

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 174/383 (45%), Gaps = 49/383 (12%)

Query: 555 ALGPSLSRRQAVNI------SRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDG 608
           A   +L R+Q V++       R+ V  D+  S     +  K  L + F NE     GID 
Sbjct: 462 AFLKALDRKQVVDVYLKIRVRREFVTTDSLRSIQNQQKDLKKSLRIEFVNE----PGIDA 517

Query: 609 GGITKEFLTSVTEEGFKNDKYKLFDTNQNYELY-PSSEV----------------NATKM 651
           GG+ KE+   +T +        LF+ N    +Y P S +                  +  
Sbjct: 518 GGLRKEWFLLLTRD--------LFNPNNGLFVYVPESRLCWFSIMESIEHELLQGEGSSS 569

Query: 652 KYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKL 711
           + YY  G VLG  IY+  ++D+ F     KK+       +   +D   L      N++K+
Sbjct: 570 ELYYLFGVVLGLAIYNSTILDLKFPRAFYKKICGE----VLSVNDFLELYPETGTNMLKM 625

Query: 712 LAMSASDLESL-ELHFEV---DDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKL 767
           L     D E +  L FE    D     K    +L P+GS   VT+ N  +Y  L  DF L
Sbjct: 626 LEYDGEDFEDIFALTFETCFPDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYL 685

Query: 768 NRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEG-KDINLEDLKSNTIY-GGFS 825
           NRS+     +   G   +I  + F +F S EL++L+ G   + +++  L+S T Y GGF 
Sbjct: 686 NRSIAPGFESFRNGFFHVIEGNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFD 745

Query: 826 DTSLTIQYFWQILEEFE-PQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLP 884
           D S  +Q+FW+IL E E PQQR  LL FVT   + P  G   +  +     SG   DRLP
Sbjct: 746 DNSPVVQWFWEILSEMEYPQQR-KLLHFVTGSDRVPATGVTTIPFRISRIRSGA--DRLP 802

Query: 885 TAATCVNLLKLPDYADKELLRQK 907
            + TC N + L +Y DKE LR K
Sbjct: 803 LSHTCFNEICLHEYKDKETLRNK 825

>KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 806

 Score =  144 bits (363), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 170/353 (48%), Gaps = 25/353 (7%)

Query: 566 VNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFK 625
           + + R +V +D+ +S        K  L V F+NE     GID GG+ KE+   +T E F 
Sbjct: 448 IKVRRSHVTQDSLTSIQRHPHDLKKSLRVEFSNE----PGIDAGGLKKEWFLLLTRELF- 502

Query: 626 NDKYKLFDTNQNYELYPSSEVNATKMKY--------YYFLGKVLGKCIYDRVLIDIHFTD 677
           +  + LF   +   L   +  N T +K         YY  G VLG  IY+  ++D+HF  
Sbjct: 503 HPNHGLFQYVEESRLSWFAYGN-TGLKLHGENNNELYYLFGVVLGLAIYNSTILDLHFAR 561

Query: 678 FLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESL-ELHFEVD--DLSTG 734
            + KKL N        F+D + L     +NL K+L+ S  D   +  L FE    D+++G
Sbjct: 562 AMYKKLCNER----ITFEDYEELYPETARNLKKMLSYSELDFSDIFGLSFETTYYDVASG 617

Query: 735 KNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHW-FEM 793
            N    L   G    VT  N  +++    +F +N  ++   +A   G + +I     F M
Sbjct: 618 INVTKPLCDGGESIPVTSENKTEFVERWVNFYMNEGVSSSFSAFQSGFTRVIGDGLAFPM 677

Query: 794 FNSSELQKLISGE-GKDINLEDLKSNTIY-GGFSDTSLTIQYFWQILEEFEPQQRLDLLK 851
           F S E+++LI G   +D++ E L++ T Y GGF + +  +++ W+IL +   +Q+   L 
Sbjct: 678 FKSCEVERLICGSIEQDMDFEQLRAVTKYQGGFHNQTPVVEWLWEILPQLSHEQQRQFLH 737

Query: 852 FVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELL 904
           FVT   + P+ G   L  K     SG   D+LPTA TC N L L +Y  ++ L
Sbjct: 738 FVTGSDRVPVTGLATLPFKVTRTTSG-SHDQLPTAHTCFNELCLYEYESRDTL 789

>Kwal_34.16064
          Length = 849

 Score =  129 bits (324), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 164/357 (45%), Gaps = 29/357 (8%)

Query: 566 VNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFK 625
           V + RD++ +D+           K  L +    EF  E GID GG+ KE+   +T E F 
Sbjct: 493 VKVRRDSITQDSLRCIETNLSDLKKSLKI----EFVDEPGIDAGGLRKEWFLLLTRELFN 548

Query: 626 ND----------KYKLFDTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHF 675
            D          ++  F  N  Y    + + NA K+  Y+ LG VLG  IY+  ++D+ F
Sbjct: 549 PDNGLFTVIEESRFSWF--NIAYTDLDAGKENAHKL--YFLLGVVLGLAIYNGTILDLSF 604

Query: 676 TDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESL-ELHFEVDDLSTG 734
              L KK+       +   D LQ    S   NL+KLL     D E +  L FE+      
Sbjct: 605 PMALYKKM---KGEPLKRADFLQLYPIS-GNNLLKLLEYDNDDFEEIFSLTFEITYPGAW 660

Query: 735 KNRV--TELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFE 792
              +   EL   GS   VT+ N  +Y+ L  DF + +++ +       G   ++  H FE
Sbjct: 661 DTWLHKKELCSGGSTRHVTRENREEYINLWMDFHMTQAIGESFVNFSNGFQRVVDNHAFE 720

Query: 793 MFNSSELQKLISGEG-KDINLEDLKSNTIYG-GFSDTSLTIQYFWQILEEFEPQQRLDLL 850
           +F   E++ L+ G   K+I++  LKS T Y  G +  S  +Q+ W+I+  F   +R  LL
Sbjct: 721 LFTPEEVELLLCGSHEKEIDVSVLKSVTKYSIGLNRESRIVQWLWEIIYMFSHAERCKLL 780

Query: 851 KFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQK 907
           +FVT   + P  G   +   F I   GP+ + LP A TC N L + +Y   E LR K
Sbjct: 781 EFVTGSDRIPATGISTV--PFKITRLGPDSENLPLAHTCFNELCIYEYKSMEKLRVK 835

>CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 858

 Score =  128 bits (321), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 111/369 (30%), Positives = 168/369 (45%), Gaps = 42/369 (11%)

Query: 566 VNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFK 625
           V + R N+  D+  S     +  +G L  +   EF  E GID GG+ KE+   +T+  F 
Sbjct: 491 VRVRRSNISSDSLQSI----KEHQGDLFKSLKVEFVGEPGIDAGGLRKEWFMLLTKTLF- 545

Query: 626 NDKYKLF------------DTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDI 673
           + +  LF            ++ QN    P  E     M+ YY  G V+   I++  ++++
Sbjct: 546 DPRTSLFVYVPESRLIWFSNSAQNEASIPDKET----MELYYLFGVVMALAIFNSTILNL 601

Query: 674 HFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDL-ESLELHFE---VD 729
           HF   L KK+          FDD   +     QNL KLL     D  E   L+FE   ++
Sbjct: 602 HFPKALYKKICGEPLK----FDDYAEIYPETAQNLQKLLEYDGDDFSEVFALNFETTFIN 657

Query: 730 DL------STGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLS 783
           D+      +  K    EL  NG    VT +N  +Y+ L  DF LN++++        G  
Sbjct: 658 DMWEINPKNIKKYNTVELCANGKNMSVTSSNKEEYVKLWIDFYLNKNISTTFEKFLLGFK 717

Query: 784 -VMIAPHWFEMFNSSELQKLISGEGKDINLED---LKSNTIY-GGFSDTSLTIQYFWQIL 838
            V       ++FN  ELQ+L+ G+ +D N  D   LKS T Y GG ++     ++FW+I 
Sbjct: 718 RVFSVSKSIKLFNFEELQRLVCGD-QDTNKYDFGMLKSVTKYIGGMNENMPVAKWFWEIA 776

Query: 839 EEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDY 898
           +E++  ++  L++FVT     P  G   L  K  +  S  + D+LP A TC N L L  Y
Sbjct: 777 QEWDITKQKKLMRFVTGSDGVPATGMSTLPFKLSLLGSS-DSDKLPIAHTCFNELCLWQY 835

Query: 899 ADKELLRQK 907
             KE L  K
Sbjct: 836 RSKEKLESK 844

>YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative
           ubiquitin-protein ligase [2679 bp, 892 aa]
          Length = 892

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 176/367 (47%), Gaps = 34/367 (9%)

Query: 557 GPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFL 616
           G S+     + + RD +  D+        +  +G L  +   EF  E GID GG+ KE+ 
Sbjct: 514 GKSVDVYFKIKVRRDVISHDSLRCI----KEHQGDLLKSLRIEFVNEPGIDAGGLRKEWF 569

Query: 617 TSVTEEGFKNDKYKLF-----DTNQNYELYP----SSEVNATKMKYYYFLGKVLGKCIYD 667
             +T+  F N    LF      +   + + P     S+   ++++ YY  G V+G  I++
Sbjct: 570 FLLTKSLF-NPMNGLFIYIKESSRSWFAIDPPNFDKSKGKNSQLELYYLFGVVMGLAIFN 628

Query: 668 RVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESL-ELHF 726
             ++D+ F   L KKL +        F+D   L     +NL+K+L  +  + E +  L F
Sbjct: 629 STILDLQFPKALYKKLCSEPLS----FEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTF 684

Query: 727 E---------VDDLSTGKNRVT-ELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVA 776
           E         ++D  + K  VT EL  NG    +T++N  ++++   +F L +S+  Q  
Sbjct: 685 ETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYN 744

Query: 777 ALHRGLSVMIAP-HWFEMFNSSELQKLISG--EGKDINLEDLKSNTIY-GGFSDTSLTIQ 832
               G   + A  +  ++FNS EL++L+ G  E    + + L+S T Y GGFSD S  + 
Sbjct: 745 KFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC 804

Query: 833 YFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNL 892
           +FW+I+E ++   +  LL+FVT+  + P  G   +  K  +  S  + D LP A TC N 
Sbjct: 805 WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSH-DSDDLPLAHTCFNE 863

Query: 893 LKLPDYA 899
           + L +Y+
Sbjct: 864 ICLWNYS 870

>Scas_549.3
          Length = 842

 Score =  116 bits (291), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 182/381 (47%), Gaps = 37/381 (9%)

Query: 555 ALGPSLSRRQAVNI------SRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDG 608
           A   SL +++ V++       R+ +  D+         + +G L  +   EF  E GID 
Sbjct: 457 AFLTSLDKKKVVDVYFRIRVRRERITNDSLKCI----RQHQGDLLKSLRVEFINEPGIDA 512

Query: 609 GGITKEFLTSVTEEGFK--NDKYKLFDTNQ--NYELYPSSEVNA---TKMKYYYFLGKVL 661
           GG+ KE+   +T+  F   N  +K  + ++   + + P  E  +   ++ + YY  G VL
Sbjct: 513 GGLKKEWFLLLTKSLFNPMNGLFKYLEDSRLSWFAIQPICEEESDIESQKELYYLFGVVL 572

Query: 662 GKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLES 721
              +++  ++D+ F   L KKL     +    F+D + L     +NL K+L+    D E 
Sbjct: 573 ALALFNSTILDLKFPKALYKKLCKEPLN----FEDYRELYPETAKNLEKMLSYPGKDFED 628

Query: 722 L-ELHFEV--DDLSTG-------KNRVT-ELIPNGSKTVVTKNNVLQYLVLIADFKLNRS 770
           L  L F     D + G        ++VT EL   G    VT+ N  +++ L  DF L +S
Sbjct: 629 LFCLSFTTTYQDATLGIFGSQSQTDKVTVELCKGGKGINVTQENKQRFVDLWVDFYLTKS 688

Query: 771 LNKQVAALHRGLSVMIAPHW-FEMFNSSELQKLISG-EGKD-INLEDLKSNTIYGG-FSD 826
           ++        G + +    +   +F+S EL+KL+ G EGK+  + + L+S T YGG F+D
Sbjct: 689 ISNSFDHFQTGFNRVCGKCYSISLFDSDELEKLVCGDEGKENYDFKILRSITKYGGGFND 748

Query: 827 TSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTA 886
            S  +++FW+I+E +  Q +  LL FVT   + P  G   L  K   R    +++ LP +
Sbjct: 749 QSKIVEWFWKIVESWSNQLQRKLLLFVTGSDRIPATGISTLPFKV-TRLGTKDKEDLPLS 807

Query: 887 ATCVNLLKLPDYADKELLRQK 907
            TC N L L +Y  +E L+ K
Sbjct: 808 HTCFNELCLWEYTTEEKLKNK 828

>KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces
            cerevisiae YKL010c SOS1, start by similarity
          Length = 1467

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 96/376 (25%), Positives = 165/376 (43%), Gaps = 45/376 (11%)

Query: 563  RQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            R  + +SRD++           G      L + + +E G      G G T EF + +++E
Sbjct: 1091 RHKLRVSRDSLFLSGIKILKKYGSS-PNVLEIEYKDEEGT-----GLGPTLEFYSLMSKE 1144

Query: 623  GFKNDKYKLFDTNQNYE----------LYP------SSEVNATKMKYYYFLGKVLGKCIY 666
             F     K++ TN +            L+P      + E N   +K +  LG ++ + + 
Sbjct: 1145 -FARKSLKMWKTNSDTSDDEEEYVTGALFPGPLLGTTEENNEKTLKLFENLGTLVARSML 1203

Query: 667  DRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQS-------LDESLYQNLVKLLAMSASD- 718
            D  ++D  F     + +     +     +D ++        D  L ++L  L      D 
Sbjct: 1204 DNRILDFRFNAVFFELMHKCCKNDRLDLEDFETCIHLVGQFDVQLGKSLAFLYDNRHDDS 1263

Query: 719  LESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAAL 778
            +++L+L+F +           EL+  GSK +V   NV +YL+ + D  L + ++ Q+AA 
Sbjct: 1264 IKNLDLYFMLPGYDI------ELLEGGSKILVESFNVEEYLIRVFDQFLGKGVDMQLAAF 1317

Query: 779  HRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYG--GFSDTSLTIQYFWQ 836
              G S         +   +EL  L     +D +++ L S +I+   G+S  S  I     
Sbjct: 1318 RNGFSKSFPYSSLLILTPTELSDLFGAVAEDWSVQTLYS-SIHADHGYSMDSPIITDLID 1376

Query: 837  ILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERD-----RLPTAATCVN 891
            IL  F  QQ+   L+F+T  P+ PL GF  L+PKF +    P+ +      LP+  TC N
Sbjct: 1377 ILSNFSTQQKRLFLQFITGSPKLPLGGFKNLKPKFTVVLKHPDGNISADHCLPSVMTCAN 1436

Query: 892  LLKLPDYADKELLRQK 907
             LKLP Y+DK +L+ +
Sbjct: 1437 YLKLPKYSDKLVLKDR 1452

>Scas_668.21
          Length = 1428

 Score = 93.6 bits (231), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 168/384 (43%), Gaps = 53/384 (13%)

Query: 563  RQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            R  + +SR N+           G      L + + +E G      G G T EF  S+++E
Sbjct: 1044 RHKLRVSRKNMFLTGLKIIGKYGSS-PSVLEIEYIDEVGS-----GLGPTLEFYASISKE 1097

Query: 623  GFKND----KYKLFDTNQNYE------------LYP----SSEVNATKMKYYYFLGKVLG 662
              KN     + + FD   N              L+P    S   NA  ++ +  LG  + 
Sbjct: 1098 FAKNSLHLWRSEDFDKKANATDGESSSDYVKDLLFPAPLDSKCDNAKTLELFESLGTFIA 1157

Query: 663  KCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESL 722
            + + D  ++D  F   L  +LL+     ++  D+L  L + + Q L ++    A  LE L
Sbjct: 1158 RSMLDSRILDFRFNK-LFFELLHKRFTKVALLDNLGDL-KGMLQMLSRVDEQLAKSLEYL 1215

Query: 723  ELHFEVDDLSTGKNRVT--------ELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQ 774
              H + D +S     +T        ELIP+G+ T V   NV  ++  + +  L R + KQ
Sbjct: 1216 YDHKD-DSVSLEALSLTFVLPGYNIELIPDGTNTFVNATNVEDFIQKVLESTLGRGIEKQ 1274

Query: 775  VAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYG------GFSDTS 828
            + A   G S +       +    EL +L    G+ I+ ED  + T+Y       G++  S
Sbjct: 1275 LDAFIDGFSKVFPYVALLILRPEELTELF---GR-ID-EDWSTETLYNCMNADHGYTMDS 1329

Query: 829  LTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGI----RNSGPERDR-L 883
             TI     I+ +F  Q+R    +F+T  P+ P+ GF  L+PKF +       G   D+ L
Sbjct: 1330 QTIHDLISIVTQFTVQERRLFCQFLTGSPKLPIDGFKGLKPKFTVVLKHAEDGLTPDQYL 1389

Query: 884  PTAATCVNLLKLPDYADKELLRQK 907
            P+  TC N LKLP Y+ ++++R +
Sbjct: 1390 PSVMTCANYLKLPKYSSRDVMRAR 1413

>ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH]
            complement(412721..416995) [4275 bp, 1424 aa]
          Length = 1424

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 155/369 (42%), Gaps = 36/369 (9%)

Query: 563  RQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            R  + ISR+N+   A    +  G             E+  E GI G G T EF  SV++E
Sbjct: 1053 RHKLRISRENMFLSALKILSKYGSS-----PSVLEIEYQDEVGI-GMGPTLEFYASVSKE 1106

Query: 623  ------GFKNDKYKLFDTNQNYELYP---SSEVNATKM-KYYYFLGKVLGKCIYDRVLID 672
                  G  +      D   +  L+P   S + N  K+ + +  LG  + + + D  ++D
Sbjct: 1107 FARKSLGMWHGSSVPGDDFLDGLLFPAPLSPKRNGAKIYELFTHLGTFVARSMLDNRILD 1166

Query: 673  IHFTDFLLKKLLNSSN-------HYISYFDDLQSLDESLYQNLVKLL-AMSASDLESLEL 724
              F       +  ++        H     + L+ +D  L ++L  +    +  DLES+ L
Sbjct: 1167 FRFNRVFFDLMHTAARREELDFAHPAKLLESLRLIDPQLAKSLAFVREPRNWPDLESMAL 1226

Query: 725  HFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSV 784
             F V           +L+  G+ T VT  N   Y+  + D  L   + +Q+ A  +G S 
Sbjct: 1227 SFTVPGYDF------DLVEGGANTPVTAANAELYVARVLDAFLGSGVRQQLRAFMKGFSR 1280

Query: 785  MIAPHWFEMFNSSELQKLISGEGKDINLEDLKSN-TIYGGFSDTSLTIQYFWQILEEFEP 843
                    +    EL +L     +D ++E L S  T   G+S  S T+     ++  F+ 
Sbjct: 1281 AFPYSSLLVLTPDELSELYGRVEEDWSVETLYSYITADHGYSMDSPTLHDLIAVMAAFDQ 1340

Query: 844  QQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERD-----RLPTAATCVNLLKLPDY 898
              R   L+F+T  P+ P+ GF  L+P   +    PE D      LP+  TC N LKLP Y
Sbjct: 1341 HHRRLFLQFLTGSPKLPVGGFKNLKPHLTVVLKHPEGDLSPDQYLPSVMTCANYLKLPKY 1400

Query: 899  ADKELLRQK 907
            + +E+LR +
Sbjct: 1401 SSREVLRAR 1409

>Sklu_2101.2 YGL141W, Contig c2101 1350-2581
          Length = 411

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 116/425 (27%), Positives = 200/425 (47%), Gaps = 59/425 (13%)

Query: 2   LNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSCK 61
           +NFTGQT++RN+NLG K + +K+E+L  AK ER+RRA E++ E SA  IQ  IR  L  +
Sbjct: 1   MNFTGQTKRRNINLGSKSRKSKEELLLNAKKERERRAIERRNEDSATRIQSSIRSHLVTR 60

Query: 62  K--------------TALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQF 107
           K              TA+L   +P++ ++     +  LI+        I+N+    L Q 
Sbjct: 61  KLLLDLISHPTADSATAILIAYTPRMYYMYDQHLTATLIH-SIRNDRPIVNIK---LAQL 116

Query: 108 GTALGNWKLLNIYSDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLH 167
              +G       Y D  +  +  + ++  N   PL +   +A +  +     L  T  L 
Sbjct: 117 LQVVG-------YFDISE-ELTELVLSKFNTKYPLTNHFYEAVVGLL-----LNSTKNLS 163

Query: 168 IDVIAPVLSAWKV--QFSQNY-RRVFEITESQCVQFEEVLHFYE--GLVLNDLLPMVELN 222
             V+  V+   KV  + S +Y   +F I  S+    +  L F    G V    L     +
Sbjct: 164 KWVMDRVMQLLKVLDEESNHYVTSLFAIDTSKTRHLDNNLRFLSQLGSVFYPELTANIKS 223

Query: 223 GSSVLLENMSYLYSKLKHANQHLYN--IIRQCVTNVRYEPVNIRMRGYVTEIYQKDFIYS 280
             S+LLEN++++Y++ K   + ++   I+   + +         +  Y   +Y KDF   
Sbjct: 224 NKSILLENLAFIYAQSKDEGREVFGRCILEYLIESSGPYKATSSLSNYFHGLYSKDF--- 280

Query: 281 YLDSINIHTNFSSD-----LLNFIENAPSEAERDSVYVSLLSR----ENFVENLLNIFSR 331
               ++   N+SS      +  FI+++P +  +++V + L+S+    +N  +NL+    +
Sbjct: 281 ----LDFLVNYSSQNQAGYISAFIKSSPDDVSKNNVLIWLISKAGLMKNINKNLMRTNEK 336

Query: 332 FQDPEQTYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMV 391
           FQD +Q      T      LL  L+K  L +S+D+ELL+N +   +E L  FT  +K MV
Sbjct: 337 FQDLDQK-----TTEEDLFLLLHLLKNDLSVSSDYELLHNIDTYPIENLQEFTSRLKGMV 391

Query: 392 FNDMW 396
           F+ +W
Sbjct: 392 FDCLW 396

>Kwal_26.7869
          Length = 1449

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 99/372 (26%), Positives = 156/372 (41%), Gaps = 39/372 (10%)

Query: 563  RQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEE 622
            R  + +SRD++L  A       G      L + + NE G      G G T EF   V++E
Sbjct: 1075 RHKLRVSRDDLLLSAIKILTKYGSS-PNILEIEYQNEVGT-----GLGPTLEFYAIVSKE 1128

Query: 623  G-------FKNDKYKLFDTNQNYE--LYPSS--EVNATK--MKYYYFLGKVLGKCIYDRV 669
                    ++ D Y   D     E  LYP+     N  K  ++ +  LG  + + + D  
Sbjct: 1129 FARKSLGLWRCDNYAFHDKTGFVEGLLYPAPLRAANDEKRILELFSQLGAFVSRSMLDDR 1188

Query: 670  LIDIHFT-DFLLKKLLNSSNHYISYFD------DLQSLDESLYQNLVKLLAM-SASDLES 721
            L+D  F   F     +      +S+ D       L  +D  L ++L  +L + +  D+ES
Sbjct: 1189 LLDFRFNRAFFELSHMRCRGETLSFADLEFALQYLDMVDPQLTKSLRYVLGLKNDQDIES 1248

Query: 722  LELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRG 781
            L L F +           EL+ NG  T VT +N+ +YL  + D  L   + KQ+++  +G
Sbjct: 1249 LALTFYLPGYDV------ELVENGKNTPVTASNLREYLEKVLDQVLGTGVEKQISSFIQG 1302

Query: 782  LSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYG-GFSDTSLTIQYFWQILEE 840
             S         +    EL KL     +D     L S      G++  S  I     ++  
Sbjct: 1303 FSQAFPYSSLLILTPDELTKLFGRIEEDWTTGTLLSYIDADHGYNQDSEIIHNLVTVMSS 1362

Query: 841  FEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERD-----RLPTAATCVNLLKL 895
            F   +R   L+F+T  P+ P+ GF +L PK  +     E +      LP+  TC N LKL
Sbjct: 1363 FTDSERRLFLQFLTGSPKLPIGGFKSLSPKLTVVRKHTEDNLEPDQYLPSVMTCANYLKL 1422

Query: 896  PDYADKELLRQK 907
            P Y+  E+LR +
Sbjct: 1423 PKYSSLEVLRSR 1434

>YKL010C (UFD4) [3246] chr11 complement(421067..425518)
            Ubiquitin-protein ligase (E3 enzyme) functioning in
            ubiquitin fusion degradation pathway [4452 bp, 1483 aa]
          Length = 1483

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 124/277 (44%), Gaps = 21/277 (7%)

Query: 647  NATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYF-DDLQS------ 699
            N   ++ + +LG  + + + D  ++D  F+    + L   S   ++    D+++      
Sbjct: 1197 NEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIE 1256

Query: 700  LDESLYQNLVKLLAMSASD---LESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVL 756
            L + L    +K +  +  D   LESL L F V       N   ELIP G    +  +NV 
Sbjct: 1257 LVDPLLAKSLKYIVANKDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVE 1311

Query: 757  QYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLK 816
            +Y+  + D  L + + KQ+ A   G S + +     +    EL  +     +D ++  L 
Sbjct: 1312 EYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDELVDIFGRVEEDWSMATLY 1371

Query: 817  SN-TIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGI-- 873
            +N     G++  S  I  F  I+  F   +R   L+F+T  P+ P+ GF +L PKF +  
Sbjct: 1372 TNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVL 1431

Query: 874  --RNSGPERDR-LPTAATCVNLLKLPDYADKELLRQK 907
                 G   D  LP+  TC N LKLP Y  K+++R +
Sbjct: 1432 KHAEDGLTADEYLPSVMTCANYLKLPKYTSKDIMRSR 1468

>CAGL0M10175g complement(1014414..1018844) similar to sp|P33202
            Saccharomyces cerevisiae YKL010c Ubiquitin fusion
            degradation protein 4, hypothetical start
          Length = 1476

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 89/175 (50%), Gaps = 7/175 (4%)

Query: 740  ELIPNGSKTVVTK-NNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSE 798
            EL+ +G+   V    +V +Y+ L+ D  L   +  Q+ +   G S +       +F+ +E
Sbjct: 1287 ELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAPQLNSFIDGFSRLFPYKNMLLFSPNE 1346

Query: 799  LQKLISGEGKDINLEDLKSNTIYG-GFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSVP 857
            +  L     +D + E L +  +   G++  S TI+    I+  F+ Q++   L+F+T  P
Sbjct: 1347 IADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIRDLISIISTFDNQEKRMFLQFLTGSP 1406

Query: 858  QAPLQGFGALEPKFGIRNSGPE-----RDRLPTAATCVNLLKLPDYADKELLRQK 907
            + PL GF +L+PK  +     E      D LP+  TC N LKLP Y+ +E++RQ+
Sbjct: 1407 KLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVMTCANYLKLPKYSSREVMRQQ 1461

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%)

Query: 737 RVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMI 786
           R  E  P G + +   +NV+ Y   I  F + R  N Q+   + GLS  I
Sbjct: 97  RRVEFSPTGDRVLAVLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEI 146

>AER287W [2789] [Homologous to ScYML104C (MDM1) - SH]
           complement(1164517..1167978) [3462 bp, 1153 aa]
          Length = 1153

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 338 TYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQ----LVLFTDGIKDMVFN 393
           TY   + H     +  Q +K+ L       LLY   R+KLE     L+L TD  +D  F 
Sbjct: 860 TYGSLVGHLQRKHIFPQKVKISLKYHVSKSLLYEERRLKLENYLRMLLLITDVCQDTTFR 919

Query: 394 DMWTKPTNDSFLYTNEAL 411
              T  +N +F+  +E L
Sbjct: 920 RFLTDVSN-AFMTGDEEL 936

>Scas_689.12
          Length = 870

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 81  GSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNI 119
           G   L+ + + EL + L V++H L   G   GNWKLLN+
Sbjct: 219 GEIALLKINSGELPYSLTVTEHLLENLGD--GNWKLLNL 255

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,410,392
Number of extensions: 1332247
Number of successful extensions: 4530
Number of sequences better than 10.0: 44
Number of HSP's gapped: 4546
Number of HSP's successfully gapped: 46
Length of query: 907
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 796
Effective length of database: 12,753,511
Effective search space: 10151794756
Effective search space used: 10151794756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)