Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06985g63062031090.0
YGL060W (YBP2)6416475632e-63
Scas_563.106666715362e-59
Kwal_14.18126846944922e-53
AAR159C6135933994e-41
KLLA0C05698g7026623634e-36
Scas_686.196636383511e-34
YBR216C (YBP1)6745953004e-28
CAGL0K06743g6554932923e-27
Scas_668.1125550750.34
Kwal_26.9424195665693.1
YPL003W (ULA1)46248675.1
Kwal_26.92881240122675.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06985g
         (620 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...  1202   0.0  
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   221   2e-63
Scas_563.10                                                           211   2e-59
Kwal_14.1812                                                          194   2e-53
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   158   4e-41
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   144   4e-36
Scas_686.19                                                           139   1e-34
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   120   4e-28
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   117   3e-27
Scas_668.11                                                            33   0.34 
Kwal_26.9424                                                           31   3.1  
YPL003W (ULA1) [5434] chr16 (552015..553403) Rub1-activating enz...    30   5.1  
Kwal_26.9288                                                           30   5.2  

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score = 1202 bits (3109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/620 (95%), Positives = 593/620 (95%)

Query: 1   MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTP 60
           MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTP
Sbjct: 1   MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTP 60

Query: 61  LNDELLWGLPKALIKNISSKNVEDKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRA 120
           LNDELLWGLPKALIKNISSKNVEDKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRA
Sbjct: 61  LNDELLWGLPKALIKNISSKNVEDKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRA 120

Query: 121 EDTNIYDDSNDTYILEAFKVRVELLLEEFILPALKTLGQTNPSKFLSVIVSALVELISNN 180
           EDTNIYDDSNDTYILEAFKVRVELLLEEFILPALKTLGQTNPSKFLSVIVSALVELISNN
Sbjct: 121 EDTNIYDDSNDTYILEAFKVRVELLLEEFILPALKTLGQTNPSKFLSVIVSALVELISNN 180

Query: 181 MQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKDEEDIVQKILESFWSFSIG 240
           MQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKDEEDIVQKILESFWSFSIG
Sbjct: 181 MQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKDEEDIVQKILESFWSFSIG 240

Query: 241 RCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEAC 300
           RCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEAC
Sbjct: 241 RCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEAC 300

Query: 301 FEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLY 360
           FEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLY
Sbjct: 301 FEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLY 360

Query: 361 YIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNT 420
           YIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNT
Sbjct: 361 YIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNT 420

Query: 421 LQSELMSVPDYXXXXXXXXXXXXTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTI 480
           LQSELMSVPDY            TCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTI
Sbjct: 421 LQSELMSVPDYVLKVFFQLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTI 480

Query: 481 LSCPYLDAKIAIAGILKDLMAKKSDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHR 540
           LSCPYLDAKIAIAGILKDLMAKKSDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHR
Sbjct: 481 LSCPYLDAKIAIAGILKDLMAKKSDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHR 540

Query: 541 IASIHSLVKLCIEDCLKPLNNKTQGNXXXXXXXXXXXXXXXKQWDGFLLKEINDEIKKLF 600
           IASIHSLVKLCIEDCLKPLNNKTQGN               KQWDGFLLKEINDEIKKLF
Sbjct: 541 IASIHSLVKLCIEDCLKPLNNKTQGNLILLQYYINILITLYKQWDGFLLKEINDEIKKLF 600

Query: 601 SQRQEQEFPELEFIRLANDT 620
           SQRQEQEFPELEFIRLANDT
Sbjct: 601 SQRQEQEFPELEFIRLANDT 620

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  221 bits (563), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 183/647 (28%), Positives = 298/647 (46%), Gaps = 79/647 (12%)

Query: 32  ECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVED------K 85
           E +N     +++  + D L  +L      L  E+ W LPK L++  S KN+         
Sbjct: 4   EQVNSGKSIKEKERYLDALLKILKDNPVTLK-EIGWDLPKGLLQFFSRKNINVNIHLVFS 62

Query: 86  ALVKAICNCMKLVARVGTDDYNFLFGTELLRECRA---------------EDTNIYDDSN 130
            LV ++  C   +A  G      L   EL+                     D+N  D SN
Sbjct: 63  PLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEENEDLNDSNRNDASN 122

Query: 131 DTYILEAF---------KVRVELL-------LEEFILPALKTLGQTNPSKFLSVIVSALV 174
            T  L            K  VE +       L EF+   LK +    PSKFL+++ SA++
Sbjct: 123 ITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSAII 182

Query: 175 ELISNNMQCGEEIEMSNILLDVIIRFYDSYE--LPSAKVT----TPDGAMANKDEEDIVQ 228
           + ++ N+Q  ++    + +L ++  F  +Y    PSA +T    T D    + DE  + +
Sbjct: 183 KYVTTNVQAMDD---PHFILRIVYNFCTNYSPAQPSASLTDGISTNDLEKIHDDESALQK 239

Query: 229 KILESFWSFSIGRCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNE- 287
           K+L +   F I  C+KN     + I    +      + EID          ++++I ++ 
Sbjct: 240 KLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDA---------SVLQICHQY 290

Query: 288 -----KLQLDLQKMMEACFEETRKIYELLPPNP---TVQDGNDLTEEIYQMSYVNGVTTL 339
                 L + +++++E C  E+R IY  L  NP   T +   ++ + +Y++SY   +  L
Sbjct: 291 YEYVTSLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKL 350

Query: 340 EEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFV 399
            ++K  L LD  GV+ LS ++Y  N   L  +I++  A+ LYLR ++ASL+S I++N F+
Sbjct: 351 ADEKN-LELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFL 409

Query: 400 EGICRFWLWSYTLGENRDKNTLQSELMSVPDYXXXXXXXXXXXXTCNEASTLQKRINFNL 459
           E   R+WLW  T   + +K  ++  L  +P +            TCNE++   K     L
Sbjct: 410 ESSVRYWLWVSTTETSTEK--IKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITL 467

Query: 460 LTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLM------AKKSDDIHLKEAR 513
           L +LL       +F FI +T+L CPY+ AKIA+  IL+D+M      A + + + L E +
Sbjct: 468 LRRLLYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQ 527

Query: 514 QVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGNXXXXXXX 573
              N  N+    P LP RP IT++E R+ASIHS+  +C     +    +TQG+       
Sbjct: 528 NPGNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQ--KKRTQGDLLLVLTY 585

Query: 574 XXXXXXXXKQWDGFLLKEINDEIKKLFSQRQEQEFPELEFIRLANDT 620
                    +WD  LL  IN EI + F    E   PEL FI ++N+T
Sbjct: 586 MKFFVSLRNKWDLGLLTLINKEISESFQGEGE---PELAFINISNNT 629

>Scas_563.10
          Length = 666

 Score =  211 bits (536), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 190/671 (28%), Positives = 320/671 (47%), Gaps = 71/671 (10%)

Query: 1   MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTP 60
           + TE+I      A E +KE  D +T + +++  + G   +ED ++  DE    L+   + 
Sbjct: 7   IDTESIYAKLTRAFEEQKE--DPVTLVTIID--MYGQEINEDGSI--DEKNKYLEHLCSL 60

Query: 61  LND------ELLWGLPKALIKNISSKNVE------DKALVKAICNCMKLVARVGTDDYNF 108
           LND      E+ W LPK L++ +S +N++      D ++V  +  C   +A  G      
Sbjct: 61  LNDNPHILREISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECL 120

Query: 109 LFGTELLRECRAEDT-------------NIYDDSNDTYILEAFKVRVELLLEEFILPALK 155
           L   ELL E   E               N   D ++T         +E  L EFI P+LK
Sbjct: 121 LAACELLSELTVEPVMENETEEEEGGKDNKKTDGDETPTDLNSSDYIERDLTEFI-PSLK 179

Query: 156 ----------TLGQT---NPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYD 202
                     TLG+     PSKFL++ +SA+++ ++ N+    +I     LL  I  F +
Sbjct: 180 VYAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNIN---DIADVTFLLRRIHEFCN 236

Query: 203 SYELPSAKVTTPDGAMANK--------DEEDIVQKILESFWSFSIGRCIKNQSCFPEYIL 254
           +Y++ +      DG+  N         DE D+  K+++  +  ++  C+KNQ    +   
Sbjct: 237 NYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKY 296

Query: 255 LSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEACFEETRKIYELLPPN 314
              +    F + E      + +     + + N K ++D+++    C +E+R+IYE LP +
Sbjct: 297 FESLTHQKFEESE-----HYAVIRTQYLGLVN-KYKIDIKEEFLQCLQESRQIYESLPSD 350

Query: 315 PTVQD---GNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVK 371
               D    + L + IYQ+SY   +  +  Q   L +D   ++ LSG YY      L  +
Sbjct: 351 IDESDEKKKSALNQVIYQLSYRYQMQKISNQ-DTLEIDFNSIILLSGSYYAETGLHLLPQ 409

Query: 372 INLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDY 431
           I++ DAV LYLR S+ SLYS  F N  V+G+ R+WLW   + ++  K  ++  L+ +P +
Sbjct: 410 ISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLW-VAITQSPIKE-IEQNLLKIPSH 467

Query: 432 XXXXXXXXXXXXTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIA 491
                        CNE     +   F LLT++L     +++F FI+DT+L+CPY  AK +
Sbjct: 468 FNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSS 527

Query: 492 IAGILKDLMAKKSD-DIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKL 550
           +  ILKDLM K +     L+E     +  +  N  P LP RP I ++E R+AS+HS+  +
Sbjct: 528 VLAILKDLMLKDNQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASM 587

Query: 551 CIEDCLKPLNNKTQGNXXXXXXXXXXXXXXXK-QWDGFLLKEINDEIKKLFSQRQEQEFP 609
           CI + LK L+N  +                 + +W+  LL+ I+DE+    +  +++  P
Sbjct: 588 CISN-LKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAP 646

Query: 610 ELEFIRLANDT 620
           EL FI++AN+T
Sbjct: 647 ELGFIKIANET 657

>Kwal_14.1812
          Length = 684

 Score =  194 bits (492), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 183/694 (26%), Positives = 303/694 (43%), Gaps = 104/694 (14%)

Query: 2   STEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDEL-------YGLL 54
           S+  + KL    +E +++    IT + L    +N   G E++A F + L       + L+
Sbjct: 4   SSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLI 63

Query: 55  DQFGTPLNDELLWGLPKALIKNISSKNVE------DKALVKAICNCMKLVARVGTDDYNF 108
            Q G        W LPK LI+ I+++NV+         +V     C   +A  G     F
Sbjct: 64  QQVG--------WDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECF 115

Query: 109 LFGTELLRECRAEDTNIYDDSNDTYILEAFKVRV-------------------------- 142
           L G ELL E     +    + ++    EA +V                            
Sbjct: 116 LTGCELLGELELHPSEKVQEEHEEDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVR 175

Query: 143 -------ELLLE-------EFILPALKTLGQTNPSKFLSVIVSALVELISNNMQCGEEIE 188
                  EL+LE       E I   L+ +    PS+FL++ VS++   + +N     +I+
Sbjct: 176 PLSRDPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSN---SIDID 232

Query: 189 MSNILLDVIIRFYDSYELPSAK------VTTPDGAMANKDEEDIVQKILESFWSFSIGRC 242
            +  +L  +  F  ++  P +       ++T +      DEE + +K+L    +FSIG+ 
Sbjct: 233 DTTFVLRRVYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQL 292

Query: 243 IKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFIIKSR-NIIRITNEKLQLDL-------Q 294
           ++     P  +    I    F + +     DF  + R N+  I +   QL         +
Sbjct: 293 VR-----PRVL---NIATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKE 344

Query: 295 KMMEACFEETRKIYELLPPNPT-VQDG--NDLTEEIYQMSYVNGVTTLEEQKGKLSLDTA 351
           + ++ C +++  IY+ LP +   + D   N +T+ +YQ+SY  G+     +K  LSLD A
Sbjct: 345 EFLKQCVKDSSAIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKN-LSLDPA 403

Query: 352 GVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLW-SY 410
           G+L L+  +Y+     L+  I    A+ +YLRF +  +Y+P   NT+    C FWLW + 
Sbjct: 404 GLLVLATQHYLETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAV 463

Query: 411 TLGENRDKNTLQSELMSVPDYXXXXXXXXXXXXTCNEASTLQKRINFNLLTQLLAFSNAE 470
           T    +D    +  L ++P Y            + NE     + ++F LLT+LL     E
Sbjct: 464 TKSSCKDS---KEALQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEE 520

Query: 471 VAFDFIVDTILSCPYLDAKIAIAGILKDLMAKKSDDI-----HLKEARQVKNEPNNHNCP 525
             F+F  DT+LSCP++D K  + GILKDLM      +      L E +  ++E  +H+ P
Sbjct: 521 TTFEFAKDTLLSCPFIDLKCCMLGILKDLMLNSKIPVSNLATELSELKLSEDE-KSHSKP 579

Query: 526 PKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGNXXXXXXXXXXXXXXXKQWD 585
           P LP RP I ++E R+A+IHSL  L  ED ++   N  +GN                +WD
Sbjct: 580 P-LPSRPFIMINEDRMATIHSLALLSFEDTIE---NADKGNLRLSLTYINFFVGLRLKWD 635

Query: 586 GFLLKEINDEIKKLFSQRQEQEFPELEFIRLAND 619
             LL E+     K+ +   +    EL FI +A D
Sbjct: 636 KHLLAEVEGAASKIVNSVTKDNSTELGFIEIALD 669

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  158 bits (399), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 144/593 (24%), Positives = 258/593 (43%), Gaps = 54/593 (9%)

Query: 44  ALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKN------VEDKALVKAICNCMKL 97
           A F + L+  L +    + D L W +PK L++ I + N      + D  + + +  C + 
Sbjct: 47  ASFLEALWEQLREHPALVGD-LGWDIPKVLVRCIRADNFNLNEGLGDDMVWRLLVGCFRE 105

Query: 98  VARVGTDDYNFLFGTELLRECRA-----EDTNIYDDSNDTYILEAFKVRVELLLEEFILP 152
           V R G     FL G + L E        ED ++ +        E F ++  +L+E F+  
Sbjct: 106 VGREGNARECFLTGCQQLAELSVAAEEEEDADLRE--------EMFALKFHMLME-FVTT 156

Query: 153 ALKTLGQTNPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKVT 212
            L       PS+FL  I+  LV+L+  N    +E+   ++LL  +  F   Y  P +  +
Sbjct: 157 TLGRTTTAYPSRFLGEIIGVLVKLVERN---ADELCDVHLLLRRLYTFCRDYTAPVS--S 211

Query: 213 TPDGAMANKDEEDIVQKIL-ESFWSFSIGRCIKNQSC--FPEYILLSQIPRMDFVKQEID 269
           + D  +  + +ED +Q+ L  SF ++++ + ++ QS    PEY   S          E  
Sbjct: 212 SEDEEL--RAQEDYLQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSH-------GLEFK 262

Query: 270 VPDDFIIKSRNIIRITNEKLQLDLQ---KMMEACFEETRKIYELLPPNPTVQDGNDLTEE 326
           + DD +     + R        D+       + C  E+R +Y  +  +    DG    E 
Sbjct: 263 LHDDHVELRETLGRYFQLAHSFDIDIEGAFQKQCILESRDVYACVSADADKADG---AEV 319

Query: 327 IYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSS 386
           IYQ++Y   +  + E +  + +D  G+  L+ L++      + + + L DA+ ++LRF++
Sbjct: 320 IYQLAYTYELKKIAELQS-MPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNT 378

Query: 387 ASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYXXXXXXXXXXXXTCN 446
             +YS  F N  V     +++     G + ++N     +   P               C 
Sbjct: 379 PEIYSKSFGNIAVTDASLYFVLLALEGNSHEEN--HKLVREFPQTVFAVFIQVLLLNMCR 436

Query: 447 EASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKKSDD 506
             S    R+  ++L ++L  ++   AFDF++DT+L CPY  AK  I  I K +M     D
Sbjct: 437 LPSREIGRMTHSILARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVS---D 493

Query: 507 IHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGN 566
            +    R V +        P LP RP I +++ R+A+ H+L  +  + C +  + K    
Sbjct: 494 QYTICTRDVPSHTRTDTKAPPLPPRPFIKLNDDRMAAFHTLAMMSAKFCTETEDPK---Q 550

Query: 567 XXXXXXXXXXXXXXXKQWDGFLLKEINDEIKKLFSQRQEQEFPELEFIRLAND 619
                          K+WD  LL+E+   +      R+E + PE+ FI++AND
Sbjct: 551 LTTLLSYLNLITVLRKKWDQVLLRELTVAVSNCIEPRKE-DIPEIGFIKIAND 602

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  144 bits (363), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 164/662 (24%), Positives = 277/662 (41%), Gaps = 110/662 (16%)

Query: 24  ITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNV- 82
           +T L L  E +N     E +  +  E+  LL Q    +  E+ W LPK LIK I   N  
Sbjct: 30  VTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQ-NKDVVYEIGWDLPKILIKFIHWGNNN 88

Query: 83  -----EDKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRAEDTNIY----------- 126
                  K  +  I  C   VA  G     F  G EL+   R  D ++            
Sbjct: 89  HLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDESLVRFIVEEEPVMD 148

Query: 127 ----DDSNDTYILE------------------------------------AFKVRV--EL 144
               D  ++TY  +                                    AF  R+  E+
Sbjct: 149 PENEDSGDETYTEDEGSSDKTEEEEEKNAVKDSPTPKSANESIPDLKEGYAFYGRLPQEV 208

Query: 145 LLEEFILPALKTLGQT-------NPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVI 197
           + E      ++ +G T       +PSKFLS  V A       N+Q  E+++    +L  +
Sbjct: 209 ITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRF---NLQNNEDVDDCLFILRRL 265

Query: 198 IRFYDSYELPSA------KVTTPDGAMANKDEEDIVQKILESFWSFSIGRCIKNQSCFP- 250
             F   Y  PS       +V+  +       EE + +K+L +  + ++ + +K ++C   
Sbjct: 266 YSFIRGYIPPSPPPDADKQVSAEELEEIKVSEEVLQRKLLCNILTSALHQLLKARTCISL 325

Query: 251 --EYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEACFEETRKIY 308
              +  L  IP +    + +    D + +   +    +  +  + +++   C +E+ +IY
Sbjct: 326 LNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRL---CVDESVRIY 382

Query: 309 ELLPPNPTVQDGNDL---TEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIAND 365
             LP +  ++   +L   T  +YQ++Y   V  +   K  L LD AG+L L      +N+
Sbjct: 383 RSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEIL-LDPAGILILRSF---SNE 438

Query: 366 NKL---NVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQ 422
           + L   + KI L +A+ +YLRF + S++S +F+N     + R W+  + L  N   + + 
Sbjct: 439 DFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWIL-FALTNNSTHDLMD 497

Query: 423 SELMSVPDYXXXXXXXXXXXXTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILS 482
           S L  +P Y             C + +   +R  F++LT++L     + AF+FI DT+LS
Sbjct: 498 S-LKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLS 556

Query: 483 CPYLDAKIAIAGILKDLM------AKKSDDIHL-KEARQVKNEPNNHNCPPKLPDRPPIT 535
           CPY  AK     ILKD+M       +KSD+  L K+  ++K +    N PP LP R  + 
Sbjct: 557 CPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIK----NSPPPLPSRAYML 612

Query: 536 VDEHRIASIHSLVKLCIEDCLK-PLNNKTQGNXXXXXXXXXXXXXXXKQWDGFLLKEIND 594
           +++ RIA++HS+  L I+ C   P + K +                  +WD   LKEI D
Sbjct: 613 LNDDRIATLHSITLLAIDSCAADPESKKVK----TLLTYLNFLNAFLTKWDSVFLKEICD 668

Query: 595 EI 596
            +
Sbjct: 669 AV 670

>Scas_686.19
          Length = 663

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 148/638 (23%), Positives = 272/638 (42%), Gaps = 84/638 (13%)

Query: 22  DGITYLVLLEECINGLSGS---EDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNIS 78
           D ++   +LE  I+ ++     +D+  F   L GL+      +   + W  PK ++K ++
Sbjct: 21  DSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVA-RISWDFPKEILKFLT 79

Query: 79  SKNVE------DKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRAEDTNIY------ 126
           + NV+         ++  +  C   +A         L G ELL     E+ NI       
Sbjct: 80  TANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCELLSNLSLENENIELEMEQG 139

Query: 127 DDSND---TYILEA-------------FKVRVEL-LLEEFILPALKTLGQTNPSKFLSVI 169
           D +N    T+   A             F V V++ +L E I   L+ +   NPSK+L + 
Sbjct: 140 DHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLA 199

Query: 170 VSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKV-TTPDGAMANKD-----E 223
            SA++  I  N     ++    I++  I  F  +Y  P   +    D ++  +D     E
Sbjct: 200 TSAMIRFIKANCDGINDVR---IVMRRIFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEE 256

Query: 224 EDIV--QKILESFWSFSIGRCIK---NQSCFPEYILLS--QIPRMDFVKQEIDVPDDFII 276
            ++   ++IL +  +  +  C+K    ++    +  LS  +     F K   +V   F  
Sbjct: 257 RELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTLAGFYKDISEVNSRFFN 316

Query: 277 KSRNIIRITNEKLQLDLQKMMEACFEETRKIYELLPPNPTV--QDGNDLTEE-IYQMSYV 333
            + +          +D++K    C + +  IY+ LP + ++  ++   L ++ +Y+++Y 
Sbjct: 317 LALS--------FDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYS 368

Query: 334 NGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSPI 393
             +  + + K  + LD  G++ LSG+YY+  D  L  +I + DA+ LYLR ++ SL+S  
Sbjct: 369 YELQRIAKHKN-VQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTTPSLFSKF 427

Query: 394 FDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYXXXXXXXXXXXXTCNEASTLQK 453
           ++N  VE + R+WLW      N     L+ EL  +P Y             C + +   +
Sbjct: 428 YENFSVESVVRYWLWVSI--TNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIR 485

Query: 454 RINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKKS--------- 504
            ++F L T++L      V F FI++T+ +  Y   K ++ GILKDLM+K+          
Sbjct: 486 MVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSCQDLCAND 545

Query: 505 DDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNN--- 561
           +D  L  +       +  N    +  +  + V E R+  IH L        L+ +N+   
Sbjct: 546 NDEALSNSLAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLA-------LRAINSLEE 598

Query: 562 --KTQGNXXXXXXXXXXXXXXXKQWDGFLLKEINDEIK 597
              T+ N                +WD  LL+ I+DEI+
Sbjct: 599 EKTTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIE 636

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 137/595 (23%), Positives = 245/595 (41%), Gaps = 83/595 (13%)

Query: 24  ITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVE 83
           +T + +  E +N     E++  F + L  LL+        E+ W LPK L+K +S  NV+
Sbjct: 26  VTLIDIYGEQVNQEGSYEEKTRFIETLNTLLED-NPSTTGEIGWDLPKGLLKFLSKDNVD 84

Query: 84  ------DKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRAEDTNIYDDSNDTYIL-- 135
                    +V+ +  C   ++  G      + G ELL    ++D +  D  N    +  
Sbjct: 85  VNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSLCSKDFSKSDQQNKEDFVDK 144

Query: 136 ------------------------------EAFKVRVELLLEEFILPALKTLGQTNPSKF 165
                                         E F      +L EFI  +LK +    PSK+
Sbjct: 145 KANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYILFEFIGASLKRISTLFPSKY 204

Query: 166 LSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAMANKD--- 222
           L   VS + + + ++    +  E +  LL  +  F  +Y  P      P     N+D   
Sbjct: 205 LGAAVSTIEKFVYSH---ADTFEDALFLLRRVYTFCRNYIPPDP----PKDIQLNEDFTR 257

Query: 223 ---------EEDIVQKILESFWSFSIGRCIKNQSCFPE---YILLSQIPRMDFVKQEIDV 270
                    E ++  ++L    +F I   IK  +   +   Y  L+Q        Q+ ++
Sbjct: 258 EMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQ--------QKFEL 309

Query: 271 PDDFIIKSRNIIRITNE--KLQLDLQKMMEACFEETRKIYELLPPN-PTVQDGNDLTEE- 326
              +        R       L +D++   +   +E R IY+ +P     V D   L  E 
Sbjct: 310 SAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVNDEAKLVLER 369

Query: 327 -IYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFS 385
            +Y+++Y   V    ++K  + LD  GV+  SG++Y+  +  L  ++N+ DA+ LYLRF+
Sbjct: 370 MVYKLAYTFEVQKAAKEKN-VGLDYNGVILFSGIHYLETNQHLVKEMNITDAIYLYLRFT 428

Query: 386 SASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYXXXXXXXXXXXXTC 445
           + SLYS ++ N  VE + R+WLW     E  +   ++ EL ++  +             C
Sbjct: 429 TPSLYSKVYYNVAVESVSRYWLWYAITTEPLED--VKKELKNLSVFVTKTLLHVLLQKNC 486

Query: 446 NEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKK-- 503
            + +   + I F LLT+LL     +VAF+FI+D + + P   AK ++  + KDL  ++  
Sbjct: 487 IQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDLSRRRIS 546

Query: 504 ----SDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIED 554
                 +  L   +  K + N+ N   +   R  I +D  ++ ++H      I+D
Sbjct: 547 TKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQD 601

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 120/493 (24%), Positives = 227/493 (46%), Gaps = 69/493 (13%)

Query: 59  TPLNDELLWGLPKALIKNISSKNVED-----KALVKAIC----NCMKLVAR-----VGT- 103
           T L   + W LP+ L++  ++KN+++     K  V  IC    N + L A+     V T 
Sbjct: 61  TELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTL 120

Query: 104 ---DDYNFLFGTELLRECR-----AEDTNIYDDSNDT---YILEA------FKVRVELLL 146
               + NF     ++ EC        D N  ++ ND    Y+ +       F V+   L 
Sbjct: 121 ELLSELNF---KNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYALF 177

Query: 147 EEFILPALKTLGQTNPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYEL 206
           E      ++ +   +PSK+L   V+A+ + ++NN +  E+++    +L  +  F   Y  
Sbjct: 178 E-LAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKF---ILRRVFAFCRGYIP 233

Query: 207 PSA-KVTTPDGAMANKDEEDIVQ-------KILESFWSFSIGRCIKNQSCFPEYILLSQI 258
           P   +    D  M +++ ++I+        ++L +  +FS+  C+K  +   E +   ++
Sbjct: 234 PEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKL 293

Query: 259 PRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQL------DLQKMMEACFEETRKIYE--L 310
                + +++ +P+ +    R++  I +   Q+      DL         ETR IYE  +
Sbjct: 294 -----INKDLQLPEFY----RSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVI 344

Query: 311 LPPNPTVQ-DGNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLN 369
              N T   D N  ++ + +  Y   V     +K +++ DT G++ LSG  YI N + L 
Sbjct: 345 KRINETNNTDKNAKSDILLKAGYYYEVQKTAREK-EINPDTKGIILLSGFNYIENGDHL- 402

Query: 370 VKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVP 429
           + I++ DA+ LYLRF+S SL+SP   N  +EG+ R+W+W+       D N L+ +L  + 
Sbjct: 403 IDIDIADALYLYLRFASESLFSPTCHNVTIEGVARYWIWAAL--TTTDNNILKEKLAELS 460

Query: 430 DYXXXXXXXXXXXXTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAK 489
                          C++ +   + I F L+T++L       +++F++D + +C  +  K
Sbjct: 461 PLVLHSVLNLLLVKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGK 520

Query: 490 IAIAGILKDLMAK 502
             + GIL+DL+ K
Sbjct: 521 SCVLGILRDLVIK 533

>Scas_668.11
          Length = 255

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 492 IAGILKDLMAKKSDDIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRI 541
           I  ILK  +AKK D++  K   Q  + P++ + P    D+P I + +H++
Sbjct: 5   IGSILKKEIAKKQDELRKKTDTQKSSGPDSTSVPKVEEDKPKIDIAKHKL 54

>Kwal_26.9424
          Length = 1956

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 15/65 (23%)

Query: 275  IIKSRNIIRITNEKLQLDLQKMMEACFEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVN 334
            +I  +++IR  NE LQ  LQ+               L P PT    N L EE+Y   Y N
Sbjct: 1095 VISFQHLIRPHNETLQTKLQR---------------LRPLPTSALNNGLLEELYPFGYFN 1139

Query: 335  GVTTL 339
             + T+
Sbjct: 1140 PMQTM 1144

>YPL003W (ULA1) [5434] chr16 (552015..553403) Rub1-activating
           enzyme, similar to ubiquitin-activating E1-like proteins
           [1389 bp, 462 aa]
          Length = 462

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 21  FDGITYLVLLEECINGLSGSEDQA-LFFDELYGLLDQFGTPLNDELLW 67
           F GI Y VLL +CI  L    +   +  D++  +LDQ   PL +++++
Sbjct: 192 FSGIPYTVLLMKCIAKLERDGNNGRITIDQMKKVLDQICLPLGNDVIY 239

>Kwal_26.9288
          Length = 1240

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 1/122 (0%)

Query: 263 FVKQEIDVPDDFIIKSRNIIRITN-EKLQLDLQKMMEACFEETRKIYELLPPNPTVQDGN 321
           F+ Q +  P  +I+  R II+ +  EK + DL+ M  A       +  +   +   QD +
Sbjct: 685 FLSQGVSRPGRYILLVREIIKSSEPEKNKRDLENMTRALEALREFMTRIDRASGASQDRH 744

Query: 322 DLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLY 381
           D+     ++ + N    L    G+  +   GVL+   L    N    +++  L D +LL+
Sbjct: 745 DIELLKQKILFKNEYVNLGLNDGRRKIKHEGVLSRKELTKSDNSFGGDIQFYLLDNMLLF 804

Query: 382 LR 383
           L+
Sbjct: 805 LK 806

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,529,912
Number of extensions: 913367
Number of successful extensions: 2628
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2652
Number of HSP's successfully gapped: 27
Length of query: 620
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 512
Effective length of database: 12,857,365
Effective search space: 6582970880
Effective search space used: 6582970880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)