Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06963g21220911121e-157
Scas_563.112162213488e-41
YGL061C (DUO1)2472483438e-40
Kwal_14.18092232132992e-33
KLLA0C05742g2081962337e-24
AAR161W2091062214e-22
AER414W76934700.45
KLLA0E03333g444101661.2
CAGL0K08250g297104661.4
AER171W42139616.4
YLR011W (LOT6)19141597.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06963g
         (209 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06963g complement(683862..684500) similar to sp|P53168 Sac...   432   e-157
Scas_563.11                                                           138   8e-41
YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein co...   136   8e-40
Kwal_14.1809                                                          119   2e-33
KLLA0C05742g 511607..512233 some similarities with sp|P53168 Sac...    94   7e-24
AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH] complement(6...    90   4e-22
AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH] complement(...    32   0.45 
KLLA0E03333g complement(313281..314615) similar to sp|P38705 Sac...    30   1.2  
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    30   1.4  
AER171W [2674] [Homologous to ScYDR057W - SH] complement(954447....    28   6.4  
YLR011W (LOT6) [3429] chr12 (169102..169677) Protein with simila...    27   7.2  

>CAGL0F06963g complement(683862..684500) similar to sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein, hypothetical start
          Length = 212

 Score =  432 bits (1112), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%)

Query: 1   MSESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQSLLRELETLDKVI 60
           MSESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQSLLRELETLDKVI
Sbjct: 1   MSESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQSLLRELETLDKVI 60

Query: 61  ATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRTGSKTGSN 120
           ATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRTGSKTGSN
Sbjct: 61  ATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRTGSKTGSN 120

Query: 121 SNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQPTGRVTKAT 180
           SNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQPTGRVTKAT
Sbjct: 121 SNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQPTGRVTKAT 180

Query: 181 ALRNARNRPSGIPQISSRLTRPTASSNLK 209
           ALRNARNRPSGIPQISSRLTRPTASSNLK
Sbjct: 181 ALRNARNRPSGIPQISSRLTRPTASSNLK 209

>Scas_563.11
          Length = 216

 Score =  138 bits (348), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 133/221 (60%), Gaps = 26/221 (11%)

Query: 3   ESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEES-----GSITTQSLLRELETLD 57
           E LD+S IN+LIP+IF QMR N     D    S+ + +S      +ITTQSLL ELE+LD
Sbjct: 4   EQLDDSTINKLIPQIFAQMRSNF----DTATSSSSITDSNQVHRSNITTQSLLNELESLD 59

Query: 58  KVIATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRTGSK- 116
           K+I  ++++D  +K A P H+++IHHVC+STN +LD+WINIQSQAGY + +M      K 
Sbjct: 60  KIITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKF 119

Query: 117 ------TGSNSN-EEVVEQYKQEIAELQKSIKMEEDKLIPAQ-VKGNGNGPTGQRLYGNS 168
                 TG  +  +E +   ++E+ +L++ +++E+ K    Q V  + +   G+    NS
Sbjct: 120 AHEQLVTGDTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQNVSNSSSSSRGRE--KNS 177

Query: 169 YRQPTGRVTKATALRNARNRPSGIPQISSRLTRPTASSNLK 209
             +    + ++  +   R+RPSGIP   +RL RPTASS+ K
Sbjct: 178 INKSNSNIRRSVPV---RSRPSGIP---TRLARPTASSSRK 212

>YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein
           component of Dad1p-Duo1p-Dam1p complex
           (Dad1p-Duo1p-Dam1p-Ask1p-Spc19p-Spc34p-Dad2p), required
           for maintenance of metaphase and anaphase spindle
           integrity [744 bp, 247 aa]
          Length = 247

 Score =  136 bits (343), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 140/248 (56%), Gaps = 43/248 (17%)

Query: 1   MSES--LDNSAINQLIPEIFDQMRHNAARTRDAKKP--------------SAMVEESGSI 44
           MSE   LD+S I++LIP+IF++MR N   T + K P              S  +    SI
Sbjct: 1   MSEQSQLDDSTIDKLIPQIFNEMRSNLNNTTN-KFPKSTGGGASDNISANSNSIRSFNSI 59

Query: 45  TTQSLLRELETLDKVIATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGY 104
           TTQSLL+E E+LDK+ A I+++ + +K  LP ++N++H VCKSTN +LD+WINI SQAGY
Sbjct: 60  TTQSLLKESESLDKITAMIKNVTAALKNNLPVYVNQVHEVCKSTNSILDSWINIHSQAGY 119

Query: 105 AHHIMDSRTGSKT--------GSNSNEE-------VVEQYKQEIAELQKSI---KMEEDK 146
            H +M  +T  K           N+N+E       V+   K+EI +L++ +   K E+D 
Sbjct: 120 IHKLMSDQTYLKLINDRLHNENVNTNDEDGSTLHNVIALKKKEILDLRQKLENRKGEKDA 179

Query: 147 LIPAQVKGNGNGP-----TGQRLYGNSYRQPTGRVTKATALRNARNRPSGIPQISSRLTR 201
             PA+    G  P     +G+R   ++     GRV K      A  RPSGIP++++R T+
Sbjct: 180 -APAKPPNQGLNPRYGVQSGRRPVPSAGISNNGRVRKTHVP--ASKRPSGIPRVTNRWTK 236

Query: 202 PTASSNLK 209
           PTASS+ K
Sbjct: 237 PTASSSRK 244

>Kwal_14.1809
          Length = 223

 Score =  119 bits (299), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 123/213 (57%), Gaps = 15/213 (7%)

Query: 3   ESLDNSAINQLIPEIFDQMRHN---AARTRDAKKPSAMVEESGSITTQSLLRELETLDKV 59
           E+LD S IN+LIPEIFDQMR N   A  T+ A+ P    + + SITTQSLL E ++LDK+
Sbjct: 4   ETLDRSNINKLIPEIFDQMRSNLSIAPSTKGAR-PFLSQKATSSITTQSLLEESKSLDKI 62

Query: 60  IATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRT------ 113
           I  I+ ++  +  + P H+ +I   C+S+NK+LD WI IQSQAGYA+ +M   +      
Sbjct: 63  IPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEYVT 122

Query: 114 -GSKTGSNSNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQP 172
              K  S + E  + + +  + +L++S++ E+  L  + V+ + N  T +    +  R  
Sbjct: 123 AAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQD-NRQTKE--MASLQRVG 179

Query: 173 TGRVTKATALRNARNRPSGIPQISSRLTRPTAS 205
            G  TK   +R    RP+GIP+ ++R+T+   S
Sbjct: 180 RGLGTKR-VIRGGMKRPTGIPRSTTRITKAPVS 211

>KLLA0C05742g 511607..512233 some similarities with sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein singleton, hypothetical start
          Length = 208

 Score = 94.4 bits (233), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 99/196 (50%), Gaps = 22/196 (11%)

Query: 5   LDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQSLLRELETLDKVIATIR 64
           LD S I+++IP+IFDQMR        A  P+       SI+TQSLL+E E LDK+I  I+
Sbjct: 6   LDASTISKMIPQIFDQMRRQTGSKNFASTPA-------SISTQSLLKEQEQLDKIIPVIQ 58

Query: 65  SIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSR--TGSKTGSNSN 122
           +++  +K      M +I   C + N +LD +I+IQSQA Y + +M++           S 
Sbjct: 59  NLNERIKDCKEGDMERIKETCHAMNTILDKFISIQSQASYVNSMMNNEEYLDYVASGKSE 118

Query: 123 EEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQPTGRVTKATAL 182
           EE +   ++E+ EL+K +K       P+ VK     P   ++       P G  T+    
Sbjct: 119 EEYISAKQREVEELEKRVKQYTTMHAPS-VK-----PPASKI-------PVGNDTRKVTK 165

Query: 183 RNARNRPSGIPQISSR 198
              RN  SG+  IS+R
Sbjct: 166 PGQRNGRSGLYSISTR 181

>AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH]
           complement(633395..634024) [630 bp, 209 aa]
          Length = 209

 Score = 89.7 bits (221), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 71/106 (66%), Gaps = 5/106 (4%)

Query: 5   LDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQSLLRELETLDKVIATIR 64
           +D++A+++LIP+IFDQMR N     D    +A    + +++T +LL+E+E LD++I  ++
Sbjct: 26  VDSAALDELIPQIFDQMRTNQL---DGSGAAAW--GTAAVSTATLLKEMEQLDQIIPVLQ 80

Query: 65  SIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMD 110
            ++  ++ +   ++++I   C++ N++LD WI IQSQAGY   +MD
Sbjct: 81  QLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQAGYVGELMD 126

>AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH]
           complement(1431488..1433797) [2310 bp, 769 aa]
          Length = 769

 Score = 31.6 bits (70), Expect = 0.45,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 6   DNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVE 39
           D + +N++ P I+D+++H  ART D  +  +M+E
Sbjct: 442 DITLVNRVTPSIYDRVKHIYARTDDKTRAFSMLE 475

>KLLA0E03333g complement(313281..314615) similar to sp|P38705
           Saccharomyces cerevisiae YHR011w DIA4, start by
           similarity
          Length = 444

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 14/101 (13%)

Query: 12  QLIPEIFDQMR---HNAARTRDAKKPSAMVEESGSITTQSLLRELETLDK----VIATIR 64
           +++PE++ + R   H  A  + ++K      +      + L  EL++L K    ++ T R
Sbjct: 53  KMLPELYQKSRVADHTIANLQHSRKTIEAQVKQDKTRARELGSELKSLKKQYQDLLKTQR 112

Query: 65  SI-DSV--VKGALPSHMNKIH-HVCKSTNKMLDNWINIQSQ 101
            + D +  V G+LP   N IH  V K+++ ++D WIN Q+Q
Sbjct: 113 EVKDQITEVCGSLP---NLIHPSVPKTSSPIIDQWINKQAQ 150

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 1   MSESLDNSAI-------NQLIPEIFDQ-MRHNAARTRDAKKPSAMVEESGSITTQSLLRE 52
           M E +D  A+       +QL+   F   M H+     DA K       SG+  TQ L+++
Sbjct: 1   MDEEIDYEALPPCAPLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGA-ATQGLIKQ 59

Query: 53  LE---TLDKVIATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLD 93
           +    T +  +A  + + SV+ GA P+H         S +K++D
Sbjct: 60  ISKITTAEGSLALWKGVQSVILGAGPAHAVYFATYEFSKSKLID 103

>AER171W [2674] [Homologous to ScYDR057W - SH]
           complement(954447..955712) [1266 bp, 421 aa]
          Length = 421

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/39 (25%), Positives = 21/39 (53%)

Query: 10  INQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSITTQS 48
           I+ ++PE+ + M    +   + + P  + EE   +T+QS
Sbjct: 361 IDHVVPEVLEDMEQGNSEDYEQQAPEQLDEEEAELTSQS 399

>YLR011W (LOT6) [3429] chr12 (169102..169677) Protein with
           similarity to E. coli 20.4 kDa protein of unknown
           function, corresponding gene is induced by cold or
           cycloheximide [576 bp, 191 aa]
          Length = 191

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 116 KTGSNSNEEVVEQYKQEIAELQK---SIKMEEDKLIPAQVK 153
           +T  NS E + ++ K ++ +LQ+    +  ++D+LIPAQ+K
Sbjct: 25  RTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIK 65

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.124    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,480,667
Number of extensions: 268180
Number of successful extensions: 1054
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1043
Number of HSP's successfully gapped: 33
Length of query: 209
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 112
Effective length of database: 13,238,163
Effective search space: 1482674256
Effective search space used: 1482674256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)