Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06941g1180116258230.0
YBR218C (PYC2)1180115552110.0
YGL062W (PYC1)1178115652030.0
CAGL0K06787g1175115551890.0
Scas_686.171176115251000.0
Kwal_14.18031174115450740.0
KLLA0C05764g1173115450740.0
Scas_563.121216115950540.0
Sklu_1458.11132111649530.0
AAR162C1171115449360.0
CAGL0M05533g18344537484e-81
YBR208C (DUR1,2)18354717051e-75
Scas_721.4018344686782e-72
KLLA0E08107g18294486712e-71
Sklu_2124.118304626533e-69
ADR051C18194806524e-69
Kwal_27.1195118694716481e-68
AAR071W22315584678e-47
CAGL0L10780g22335424671e-46
Scas_720.7422315264642e-46
KLLA0F06072g22315654598e-46
Kwal_23.615722305114543e-45
YNR016C (ACC1)22335264535e-45
YMR207C (HFA1)21234454472e-44
CAGL0L05676g22113321198e-06
Kwal_33.1406122213301172e-05
Sklu_2331.122203301162e-05
Scas_582.4*21932821126e-05
YJL130C (URA2)22143251082e-04
ABR157W11132221072e-04
Kwal_55.1978311212261053e-04
ACR263C22403321045e-04
Sklu_2413.41122223910.019
KLLA0E15444g2228299890.032
KLLA0E23782g39394870.042
Scas_691.191117222830.16
Scas_701.3543094810.22
KLLA0F05489g44194810.23
Kwal_27.1209039494800.24
Sklu_2431.2394120800.27
KLLA0F03190g1117229810.28
CAGL0J09240g43794780.45
YDL131W (LYS21)44094780.46
Scas_704.343894780.47
Sklu_1841.226170770.52
ADR107W44294770.55
CAGL0C04917g1113156780.59
CAGL0J06402g43194770.62
YDL182W (LYS20)42894770.67
YJR109C (CPA2)1118178770.71
Kwal_56.2440144194741.3
Scas_712.17793100732.1
Kwal_23.4958649122722.6
YMR023C (MSS1)52670722.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06941g
         (1162 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2247   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2011   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2008   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  2003   0.0  
Scas_686.17                                                          1969   0.0  
Kwal_14.1803                                                         1959   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  1959   0.0  
Scas_563.12                                                          1951   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1912   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1905   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   292   4e-81
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   276   1e-75
Scas_721.40                                                           265   2e-72
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   263   2e-71
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          256   3e-69
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   255   4e-69
Kwal_27.11951                                                         254   1e-68
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   184   8e-47
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   184   1e-46
Scas_720.74                                                           183   2e-46
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   181   8e-46
Kwal_23.6157                                                          179   3e-45
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   179   5e-45
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   176   2e-44
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    50   8e-06
Kwal_33.14061                                                          50   2e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            49   2e-05
Scas_582.4*                                                            48   6e-05
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    46   2e-04
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    46   2e-04
Kwal_55.19783                                                          45   3e-04
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    45   5e-04
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          40   0.019
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    39   0.032
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    38   0.042
Scas_691.19                                                            37   0.16 
Scas_701.35                                                            36   0.22 
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    36   0.23 
Kwal_27.12090                                                          35   0.24 
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            35   0.27 
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    36   0.28 
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    35   0.45 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    35   0.46 
Scas_704.3                                                             35   0.47 
Sklu_1841.2 YOR115C, Contig c1841 2744-3529                            34   0.52 
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    34   0.55 
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    35   0.59 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    34   0.62 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    34   0.67 
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    34   0.71 
Kwal_56.24401                                                          33   1.3  
Scas_712.17                                                            33   2.1  
Kwal_23.4958                                                           32   2.6  
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    32   2.8  

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2247 bits (5823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1097/1162 (94%), Positives = 1097/1162 (94%)

Query: 1    MPQSGQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLS 60
            MPQSGQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLS
Sbjct: 1    MPQSGQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLS 60

Query: 61   THRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ 120
            THRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ
Sbjct: 61   THRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ 120

Query: 121  KAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVI 180
            KAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVI
Sbjct: 121  KAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVI 180

Query: 181  IKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLAD 240
            IKAAY              DIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLAD
Sbjct: 181  IKAAYGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLAD 240

Query: 241  NHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEF 300
            NHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEF
Sbjct: 241  NHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEF 300

Query: 301  LVDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGF 360
            LVDNQNRHYFIEINPRIQVEHTITEEIT               SLTELGLLQDRITTRGF
Sbjct: 301  LVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGF 360

Query: 361  AIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCS 420
            AIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCS
Sbjct: 361  AIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCS 420

Query: 421  GSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVS 480
            GSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVS
Sbjct: 421  GSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVS 480

Query: 481  SQNRAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWR 540
            SQNRAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWR
Sbjct: 481  SQNRAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWR 540

Query: 541  QVLLEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXX 600
            QVLLEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHD                
Sbjct: 541  QVLLEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAF 600

Query: 601  XXECWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHF 660
              ECWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHF
Sbjct: 601  ALECWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHF 660

Query: 661  VKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYY 720
            VKQAKDNGVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYY
Sbjct: 661  VKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYY 720

Query: 721  LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
            LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM
Sbjct: 721  LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780

Query: 781  AACAFAGADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLL 840
            AACAFAGADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLL
Sbjct: 781  AACAFAGADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLL 840

Query: 841  YSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVK 900
            YSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVK
Sbjct: 841  YSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVK 900

Query: 901  VTPTSKVVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSD 960
            VTPTSKVVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSD
Sbjct: 901  VTPTSKVVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSD 960

Query: 961  ILRNKRRKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKEL 1020
            ILRNKRRKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKEL
Sbjct: 961  ILRNKRRKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKEL 1020

Query: 1021 YGDLSVLPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMR 1080
            YGDLSVLPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMR
Sbjct: 1021 YGDLSVLPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMR 1080

Query: 1081 KIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKM 1140
            KIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKM
Sbjct: 1081 KIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKM 1140

Query: 1141 EMVVSSQADGQVKDVFVKDAEN 1162
            EMVVSSQADGQVKDVFVKDAEN
Sbjct: 1141 EMVVSSQADGQVKDVFVKDAEN 1162

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2011 bits (5211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1155 (83%), Positives = 1031/1155 (89%)

Query: 8    KKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKAD 67
            KKLAGLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRT+AIYSHEDRLS HRLKAD
Sbjct: 5    KKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKAD 64

Query: 68   EAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWI 127
            EAYVIGEEGQYTPVGAYLA+DEII+IAKKH VDFIHPGYGFLSENSEFADKV KAGITWI
Sbjct: 65   EAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWI 124

Query: 128  GPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXX 187
            GPP EVI+SVGDKVSAR+LAA+A VPTVPGTPGPI+TV+EA  FV EYGYPVIIKAA+  
Sbjct: 125  GPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGG 184

Query: 188  XXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIH 247
                        D+ DAFQRATSEA+TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+H
Sbjct: 185  GGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVH 244

Query: 248  LFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 307
            LFERDCSVQRRHQKVVEVAPAKTLPR+VRDAILTDAVKLAK  GYRNAGTAEFLVDNQNR
Sbjct: 245  LFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNR 304

Query: 308  HYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRIT 367
            HYFIEINPRIQVEHTITEEIT               +LT+LGLLQD+ITTRGF+IQCRIT
Sbjct: 305  HYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRIT 364

Query: 368  TEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIV 427
            TEDP+KNFQPDTGR+EVY S GGNGVRLDGGNAYAGA ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 365  TEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIV 424

Query: 428  RRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQK 487
            RRK+IRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSSQNRAQK
Sbjct: 425  RRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK 484

Query: 488  LLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKG 547
            LLHYLADLAVNGSSIKGQIGLPKL + P++PHLHD +G +I+VTK APP GWRQVLLEKG
Sbjct: 485  LLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKG 544

Query: 548  PEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGG 607
            P  FAK VR F GTLLMDTTWRDAHQSLLATRVRTHD                  ECWGG
Sbjct: 545  PSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGG 604

Query: 608  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 667
            ATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 605  ATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 664

Query: 668  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKI 727
            GVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLEV +KI
Sbjct: 665  GVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVEKI 724

Query: 728  VEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAG 787
            V+MGTH+LGIKDMAGT+KP AAKLLIGS+R +YPDLPIHVHSHDSAGTAVASM ACA AG
Sbjct: 725  VQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAG 784

Query: 788  ADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEAD 847
            ADVVDVAINSMSG+TSQ SINALLASL+G IDTG+NV+H RELDAYWAEMRLLYSCFEAD
Sbjct: 785  ADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEAD 844

Query: 848  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKV 907
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY+EAN+LLGDIVKVTPTSKV
Sbjct: 845  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKV 904

Query: 908  VGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRR 967
            VGDLAQFMV+N+LTS+D++RLANSLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+LRNKRR
Sbjct: 905  VGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRR 964

Query: 968  KLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVL 1027
            KLT RPGLELEPFDLE IREDL+NRFG+IDECDVASYNMYP+VYEDFQK++E YGDLSVL
Sbjct: 965  KLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVL 1024

Query: 1028 PTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDR 1087
            PTKNFLAP    E+IEV +EQGKTLIIKLQAVGDLNK+TG R+VYFELNGE+RKIRV D+
Sbjct: 1025 PTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADK 1084

Query: 1088 SQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQ 1147
            SQ ++ V+KPKAD HD  QIGAPMAGVI+EVKVHKGSLVKKG+ +A+LSAMKMEMVVSS 
Sbjct: 1085 SQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSP 1144

Query: 1148 ADGQVKDVFVKDAEN 1162
            ADGQVKDVF+KD E+
Sbjct: 1145 ADGQVKDVFIKDGES 1159

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2008 bits (5203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1156 (83%), Positives = 1028/1156 (88%)

Query: 7    KKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKA 66
            ++K AGLR NFN+LGEK+KILVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLSTH+ KA
Sbjct: 3    QRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKA 62

Query: 67   DEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITW 126
            DEAYVIGE GQYTPVGAYLAIDEII IA+KH VDFIHPGYGFLSENSEFADKV KAGITW
Sbjct: 63   DEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITW 122

Query: 127  IGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYX 186
            IGPP EVI+SVGDKVSARNLAAKA VPTVPGTPGPI+TVEEA  FV EYGYPVIIKAA+ 
Sbjct: 123  IGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFG 182

Query: 187  XXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVI 246
                         D+ DAFQRATSEA+TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+
Sbjct: 183  GGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 242

Query: 247  HLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 306
            HLFERDCSVQRRHQKVVEVAPAKTLPR+VRDAILTDAVKLAKE GYRNAGTAEFLVDNQN
Sbjct: 243  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQN 302

Query: 307  RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRI 366
            RHYFIEINPRIQVEHTITEEIT               SL +LGL QD+ITTRGFAIQCRI
Sbjct: 303  RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRI 362

Query: 367  TTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426
            TTEDPAKNFQPDTGRIEVY S GGNGVRLDGGNAYAG +ISPHYDSMLVKCSCSGSTYEI
Sbjct: 363  TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEI 422

Query: 427  VRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQ 486
            VRRK+IRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSSQNRAQ
Sbjct: 423  VRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQ 482

Query: 487  KLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEK 546
            KLLHYLAD+AVNGSSIKGQIGLPKL + P++PHLHD +G +I+VTK APP GWRQVLLEK
Sbjct: 483  KLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEK 542

Query: 547  GPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWG 606
            GP  FA+ VR F GTLLMDTTWRDAHQSLLATRVRTHD                  ECWG
Sbjct: 543  GPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWG 602

Query: 607  GATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 666
            GATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD
Sbjct: 603  GATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 662

Query: 667  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDK 726
            NGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYLE+ +K
Sbjct: 663  NGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIAEK 722

Query: 727  IVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFA 786
            IV+MGTH+LGIKDMAGT+KP AAKLLIGS+RAKYPDLPIHVH+HDSAGTAVASM ACA A
Sbjct: 723  IVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALA 782

Query: 787  GADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEA 846
            GADVVDVAINSMSG+TSQ SINALLASL+G IDTG+NV+H RELDAYWAEMRLLYSCFEA
Sbjct: 783  GADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEA 842

Query: 847  DLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSK 906
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY+EAN+LLGDIVKVTPTSK
Sbjct: 843  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSK 902

Query: 907  VVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKR 966
            VVGDLAQFMV+N+LTS+DV+RLANSLDFPDSVMDFFEGL+GQPYGGFPEP RSD+LRNKR
Sbjct: 903  VVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKR 962

Query: 967  RKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSV 1026
            RKLT RPGLELEPFDLE IREDL+NRFG++DECDVASYNMYP+VYEDFQKM+E YGDLSV
Sbjct: 963  RKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSV 1022

Query: 1027 LPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPD 1086
            LPT++FL+P    E+IEV +EQGKTLIIKLQAVGDLNK+TG R+VYF+LNGEMRKIRV D
Sbjct: 1023 LPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVAD 1082

Query: 1087 RSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSS 1146
            RSQKVE V+K KAD HDP  IGAPMAGVIVEVKVHKGSL+KKGQPVA+LSAMKMEM++SS
Sbjct: 1083 RSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISS 1142

Query: 1147 QADGQVKDVFVKDAEN 1162
             +DGQVK+VFV D EN
Sbjct: 1143 PSDGQVKEVFVSDGEN 1158

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 2003 bits (5189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/1155 (83%), Positives = 1028/1155 (89%), Gaps = 1/1155 (0%)

Query: 8    KKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKAD 67
            K L GLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRTVAIYSHEDRLSTHRLKAD
Sbjct: 5    KMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKAD 64

Query: 68   EAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWI 127
            EAYVIG+EG+YTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSEN+EFADKVQKAGITWI
Sbjct: 65   EAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWI 124

Query: 128  GPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXX 187
            GPPPEVIESVGDKVSARNLAAKA VPTVPGTPGPI+TVEEA+ FV +YGYPVIIKAAY  
Sbjct: 125  GPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGG 184

Query: 188  XXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIH 247
                        D+ DAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+H
Sbjct: 185  GGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVH 244

Query: 248  LFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 307
            LFERDCSVQRRHQKVVEVAPAKTLPR+VRD+ILTDAV+LAKEAGYRNAGTAEFLVDNQNR
Sbjct: 245  LFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNR 304

Query: 308  HYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRIT 367
            HYFIEINPRIQVEHTITEEIT               SL +LGLLQDRITTRGFAIQCRIT
Sbjct: 305  HYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRIT 364

Query: 368  TEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIV 427
            TEDPAKNFQPDTGR+EVY S GGNGVRLDGG AYAGAVISPHYDSMLVKCSCSGSTYEIV
Sbjct: 365  TEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIV 424

Query: 428  RRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQK 487
            RRK++RALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLFHMVSS+NRAQK
Sbjct: 425  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQK 484

Query: 488  LLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKG 547
            LLHYLADLAVNGSSIKGQIG PKL T P IP LHDE G  + V+ V P  GWR +L  +G
Sbjct: 485  LLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVS-VPPQKGWRYLLQSEG 543

Query: 548  PEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGG 607
            PE FAKAVR  +GTL+MDTTWRDAHQSLLATRVRT+D                  ECWGG
Sbjct: 544  PEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGG 603

Query: 608  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 667
            ATFDVAMRFLHEDPWERLR+LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 604  ATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 663

Query: 668  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKI 727
            GVDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYL+VT+KI
Sbjct: 664  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKI 723

Query: 728  VEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAG 787
            V MGTH+LGIKDMAGT+KP AAKLLIG+IRAK+PDLPIHVHSHDSAGTAVASMAACA AG
Sbjct: 724  VAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAG 783

Query: 788  ADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEAD 847
            ADVVDVAINSMSG+TSQAS+NA+LASLDG+IDTG+NVKH  ELDAYWAEMRLLYSCFEAD
Sbjct: 784  ADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEAD 843

Query: 848  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKV 907
            LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETK+AYK+AN LLGDIVKVTPTSKV
Sbjct: 844  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKV 903

Query: 908  VGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRR 967
            VGDLAQFMV+NQLT +D++RLANSLDFPDSVMDFFEGLMGQPYGGFPEPLR+DIL+NKRR
Sbjct: 904  VGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRR 963

Query: 968  KLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVL 1027
            KL  RPGLEL PFDL  IREDLE RFG+I+ECDVASYNMYPKVYEDFQK+ E YGDLSVL
Sbjct: 964  KLNRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVL 1023

Query: 1028 PTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDR 1087
            PT+NFLA P +GE+IEVH+EQGKTLIIKLQAVGDLN+ETG+R+VYFELNGE RKIR+ D+
Sbjct: 1024 PTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADK 1083

Query: 1088 SQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQ 1147
            SQ V+ ++KPKAD HDP QIGAPMAGVIVEVKVHKGS VKKGQPVA+LSAMKMEMV+SS 
Sbjct: 1084 SQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISST 1143

Query: 1148 ADGQVKDVFVKDAEN 1162
             +G VKDV VKD EN
Sbjct: 1144 GEGLVKDVLVKDGEN 1158

>Scas_686.17
          Length = 1176

 Score = 1969 bits (5100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1152 (81%), Positives = 1021/1152 (88%), Gaps = 1/1152 (0%)

Query: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68
            KL+GLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRTVAIYSHEDRLSTHRLKADE
Sbjct: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64

Query: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128
            +YVIGEEGQ+TPVGAYLAIDEII+IAKKH VDFIHPGYGFLSENSEFADKV KAGITWIG
Sbjct: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124

Query: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            PP EVI+SVGDKVSAR LAA+A VPTVPGTPGPIK+V+EAE FVA+YGYPVIIKAA+   
Sbjct: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGG 184

Query: 189  XXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248
                       DI DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GNV+HL
Sbjct: 185  GRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244

Query: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308
            FERDCSVQRRHQKVVEVAPAK +PR+VRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 309  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITT 368
            YFIEINPRIQVEHTITEEIT               SL +LGLLQDRITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITT 364

Query: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428
            EDPAKNFQPDTGR+EVY S GGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424

Query: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488
            RK+IRALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLF MVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484

Query: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548
            LHYLADLAVNGSSIKGQIGLPKL   P++PHLHD +G +I+V    P  GWR+VLLE+GP
Sbjct: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLLEQGP 543

Query: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGGA 608
              FAK VR F+GTLLMDTTWRDAHQSLLATRVRTHD                  ECWGGA
Sbjct: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603

Query: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668
            TFDVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663

Query: 669  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKIV 728
            VDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLEVT+KIV
Sbjct: 664  VDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIV 723

Query: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788
            +MGTH+LGIKDMAGT+KP AA+LLIGSIRAKYPDLPIHVH+HDSAGTAV+SM   A +GA
Sbjct: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783

Query: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848
            DVVDVAINSMSG+TSQ SINALLASLDG+IDTG+NV++ RELDAYWAEMRLLYSCFEADL
Sbjct: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843

Query: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908
            KGPD EVY HEIPGGQLTNLLFQAQQ GLGE+W ETKRAY+EAN+LLGDIVKVTPTSKVV
Sbjct: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903

Query: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968
            GDLAQFMVTN+  S+D+KRLAN+LDFPDS+MDFFEGL+GQPYGGFPEPLRSDILRNKRRK
Sbjct: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963

Query: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028
            LT RPGLEL PF+++ IREDLE RFG+IDECD+ASYNMYPKVYEDFQK+KE YGDLSVLP
Sbjct: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023

Query: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088
            TK+FL+P  + E+IEV +EQGKTLI+KLQA+GDLNK TG+R+VYF+LNGE+RKIRV DRS
Sbjct: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083

Query: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148
            QKVE ++KPKAD HDP+QIGAPMAGV+VEVKVHKGSLVKKG+ VA+LSAMKMEMV+SS A
Sbjct: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143

Query: 1149 DGQVKDVFVKDA 1160
            DGQVK+V V + 
Sbjct: 1144 DGQVKEVLVSNG 1155

>Kwal_14.1803
          Length = 1174

 Score = 1959 bits (5074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 933/1154 (80%), Positives = 1025/1154 (88%)

Query: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68
            KLAGLR + N+LGEK+KILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62

Query: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128
            AY+IG++G+YTPVGAYLAIDEI++IAK+H VDFIHPGYGFLSENSEFA KV++AGITWIG
Sbjct: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122

Query: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            P  EVI+SVGDKVSARNLAAKA VP VPGTPGPI +VEEA+AFVAEYGYPVIIKAA+   
Sbjct: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGG 182

Query: 189  XXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248
                       DI DAFQRATSEAKT+FGNGTCF+ERFL+KPKHIEVQLLAD +GNV+HL
Sbjct: 183  GRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242

Query: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308
            FERDCSVQRRHQKVVEVAPAKTLP+DVRDAILTDAVKLA  A Y+NAGTAEFLVD+QNRH
Sbjct: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302

Query: 309  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITT 368
            YFIEINPRIQVEHTITEEIT               SL +LGLLQDRITTRGFAIQCRITT
Sbjct: 303  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITT 362

Query: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428
            EDPAKNFQPDTGRIEVY S GGNGVRLDGGNAYAG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422

Query: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488
            RK++RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF MVSSQNRAQKL
Sbjct: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482

Query: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548
            LHYLADLAVNGSSIKGQ+GLPKL T+P +P +HD +G +I V   APP GWRQVLLEKGP
Sbjct: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542

Query: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGGA 608
              FAKAVR   GTLLMDTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602

Query: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668
            TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 669  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKIV 728
            VDIFRVFDALNDLEQL                  CYSGDMLQ GKKYNLDYYLE+TDKIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKIV 722

Query: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788
             MGTH+LGIKDMAGTLKP+AAKLLIGSIRAKYPDLPIHVH+HDSAGTAVASMAACAFAGA
Sbjct: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782

Query: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848
            DVVDVA NSMSG+TSQ SINALLASLDGEI+T +NV   RELDAYWA+MRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842

Query: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETKRAY+EAN+LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902

Query: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968
            GDLAQFMV+N+L+S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+L+NKRRK
Sbjct: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962

Query: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028
            LT RPGLE+ PFDL  I+EDL++RFG+I+ECDVASYNMYPKVYEDF+K++E YGDLSVLP
Sbjct: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088
            TKNFL+PP++GE+I V +E+GKTLIIK QA+G+LNKETG+R+VYF+LNGE+RK+ V D+S
Sbjct: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082

Query: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148
            QKV+ +SKPKAD HD +QIGAPMAGVI+EVKVH GSLVK+GQPVA+LSAMKMEMV+SS  
Sbjct: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142

Query: 1149 DGQVKDVFVKDAEN 1162
            DGQVK+V VKD EN
Sbjct: 1143 DGQVKEVLVKDGEN 1156

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 1959 bits (5074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1154 (81%), Positives = 1019/1154 (88%), Gaps = 1/1154 (0%)

Query: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68
            +LAGLR N N++GEK+K+LVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63

Query: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128
            AYVIGE+G+YTPVGAYLAIDEII+IAK HGV+FIHPGYGFLSENSEFA+KV  +GITW+G
Sbjct: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123

Query: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            PP  VI+SVGDKVSARNLA KA VP VPGTPGPI+TVEEA+AFV +YG+PVIIKAA+   
Sbjct: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGG 183

Query: 189  XXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248
                       DI DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNV+HL
Sbjct: 184  GRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243

Query: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308
            FERDCSVQRRHQKVVEVAPAKTLP +VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303

Query: 309  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITT 368
            YFIEINPRIQVEHTITEEIT               +L +LGL+QD+ITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITT 363

Query: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428
            EDP+KNFQPDTGRI+VY S GGNGVRLDGGNA+AG+VISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488
            RK++RALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF MVSSQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483

Query: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548
            LHYLADLAVNGSSIKGQIGLPKL+T P IPHLH+E G ++ V+   PP GWR VLL+ GP
Sbjct: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDYGP 542

Query: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGGA 608
            E FAK VR F GTLLMDTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 543  EEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGA 602

Query: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668
            TFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 603  TFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 662

Query: 669  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKIV 728
            VDIFRVFDALNDLEQL                  CYSGDML PGKKYNLDYYL++T+KIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKIV 722

Query: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788
              GTH+LGIKDMAGTLKP+AA+LLIGSIRAKYP+LPIHVH+HDSAGT VASMAACA +GA
Sbjct: 723  NSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGA 782

Query: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848
            DVVDVA NSMSG+TSQ SINALLA+LDGEID  VNV + RELDAYWAEMRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADL 842

Query: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETKRAY+EAN LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVV 902

Query: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968
            GDLAQFMV+N+LTS+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+LRNKRRK
Sbjct: 903  GDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRK 962

Query: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028
            LT RPGLEL PF+LE I+EDL  RF +IDECDVASYNMYPKVYEDF+K+KE YGDLSVLP
Sbjct: 963  LTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLP 1022

Query: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088
            TKNFL+PP IGE+I V +EQGKTLIIK QA+GDLNKETG+R+VYFELNGE+RK+ V DRS
Sbjct: 1023 TKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRS 1082

Query: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148
            QKVE VSKPKAD HDPFQIG+PMAGV+VEVKVHKGSL+ KGQPVA+LSAMKMEMV+SS A
Sbjct: 1083 QKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPA 1142

Query: 1149 DGQVKDVFVKDAEN 1162
            DGQVK+V VKD EN
Sbjct: 1143 DGQVKEVLVKDGEN 1156

>Scas_563.12
          Length = 1216

 Score = 1951 bits (5054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1159 (80%), Positives = 1020/1159 (88%), Gaps = 4/1159 (0%)

Query: 8    KKLAGLRANFNILGEKDK----ILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHR 63
            KKL G R NFN+LG +++    I+V +    P+  FR+AHELSM+TVAIYSHEDRLSTHR
Sbjct: 41   KKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLSTHR 100

Query: 64   LKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAG 123
            LKADE+YVIGE  Q+TPVGAYLAIDEII+IAK+HGVD+IHPGYGFLSENSEFADKV KAG
Sbjct: 101  LKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAKAG 160

Query: 124  ITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKA 183
            ITWIGPP  VI+SVGDKVSARNLA KA VPTVPGTPGPI+TV++A+ FV EYGYPVIIKA
Sbjct: 161  ITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVIIKA 220

Query: 184  AYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHG 243
            A+              D+ DAFQRA+SEA TAFG+GTCFVERFL+KPKHIEVQLLAD HG
Sbjct: 221  AFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADTHG 280

Query: 244  NVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVD 303
            NVIHLFERDCSVQRRHQKVVEVAPAKTLPR+VRDAILTDAVKLAKE GY+NAGTAEFLVD
Sbjct: 281  NVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFLVD 340

Query: 304  NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQ 363
            +QNRHYFIEINPRIQVEHTITEEIT               SL +LGLLQD+ITTRGFAIQ
Sbjct: 341  DQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFAIQ 400

Query: 364  CRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGST 423
            CRITTEDPAKNFQPDTGR+EVY S GGNGVRLDGGNAYAGA+ISPHYDSMLVKCSCSGST
Sbjct: 401  CRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSGST 460

Query: 424  YEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQN 483
            YE+VRRK+IRALIEFRIRGVKTNIPFLLTLLTHPVFI+G YWTTFIDDTPQLF MVSSQN
Sbjct: 461  YEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSSQN 520

Query: 484  RAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVL 543
            RAQKLLHYLADLAVNGSSIKGQ+G+P+L   P+IPH+HD +G +I VT V PP GWRQVL
Sbjct: 521  RAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQVL 580

Query: 544  LEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXE 603
            LE+GPE FAK VR F+GTLLMDTTWRDAHQSLLATRVRTHD                  E
Sbjct: 581  LEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFALE 640

Query: 604  CWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 663
            CWGGATFDVAMRFLHEDPW+RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ
Sbjct: 641  CWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 700

Query: 664  AKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEV 723
            AKDNGVDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLEV
Sbjct: 701  AKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEV 760

Query: 724  TDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAAC 783
            T+KIV+MGTH+LGIKDMAGT+KP AA+LLIGSIRAKYPDLPIHVH+HDSAGTAVASM+A 
Sbjct: 761  TEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMSAA 820

Query: 784  AFAGADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSC 843
            A+AGADV+DVA NSMSG+TSQ SINALLASLDGEI+T +NV+H RELDAYWAEMRLLYSC
Sbjct: 821  AYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLYSC 880

Query: 844  FEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTP 903
            F ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+W ETKRAYKEAN LLGDIVKVTP
Sbjct: 881  FGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKVTP 940

Query: 904  TSKVVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILR 963
            TSKVVGDLAQFMV+N+LTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILR
Sbjct: 941  TSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILR 1000

Query: 964  NKRRKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGD 1023
            NKRRKLT RPGLEL PF+L +I+EDL+ RFG+I+ECD+ASYNMYPKVYEDFQKMKE YGD
Sbjct: 1001 NKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKYGD 1060

Query: 1024 LSVLPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIR 1083
            LSVLPTK+FLAP  IGE+I V ++QGKTLIIKLQA+GDLNKETG R+V+FELNGEMRKI 
Sbjct: 1061 LSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRKIS 1120

Query: 1084 VPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMV 1143
            V D+SQKVE V+KPKAD HDPFQIGAPMAGVIVEVKVHKGSLVKKG+ VA+LSAMKMEMV
Sbjct: 1121 VTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKMEMV 1180

Query: 1144 VSSQADGQVKDVFVKDAEN 1162
            +SS ADG VK+V V ++EN
Sbjct: 1181 ISSPADGLVKEVLVNESEN 1199

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1912 bits (4953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/1116 (82%), Positives = 991/1116 (88%), Gaps = 1/1116 (0%)

Query: 47   MRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGY 106
            M+TVAIYS+EDRLS HRLKADEAY+IGE G+YTPVGAYLAIDEII IAK+HGV FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 107  GFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVE 166
            GFLSEN+EFA KV  AGITWIGPPPEVI SVGDKVSAR+LAAKA VPTVPGTPGPI++VE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 167  EAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERF 226
            EAEAFVAEYGYPVIIKAA+              DIGDAFQRATSEAKTAFGNGTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 227  LDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKL 286
            LDKPKHIEVQLLADN+GNVIHLFERDCSVQRRHQKVVEVAPAKTLP++VRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 287  AKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLT 346
            AKEA YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEIT               SL 
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 347  ELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVI 406
            +LGLLQD+ITTRGFAIQCRITTEDP+KNFQPDTGRIEVY S GGNGVRLDGGNAYAGAVI
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 407  SPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWT 466
            SPHYDSMLVKCSCSGSTYEIVRRK++RALIEFRIRGVKTNIPFLLTLLTH VF SG+YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 467  TFIDDTPQLFHMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGE 526
            TFIDDTPQLF MVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKL+T+P++P LHD  G 
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 527  IISVTKVAPPDGWRQVLLEKGPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXX 586
            ++ V   APP GWR VLLE+GPEGFAK VR + GTLLMDTTWRDAHQSLLATRVRTHD  
Sbjct: 481  VVDVL-AAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLA 539

Query: 587  XXXXXXXXXXXXXXXXECWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 646
                            ECWGGATF VAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG
Sbjct: 540  TIAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 599

Query: 647  VAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSG 706
            VAYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDLEQL                  CYSG
Sbjct: 600  VAYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSG 659

Query: 707  DMLQPGKKYNLDYYLEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIH 766
            DMLQPGKKYNLDYYLE+TDKIV+MGTH+LGIKDMAGTLKP+AAKLLIGSIRAKYPDLPIH
Sbjct: 660  DMLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH 719

Query: 767  VHSHDSAGTAVASMAACAFAGADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKH 826
            VH+HDSAGTAVASMAACA AGADVVDVA NSMSG+TSQ SINALLASLDGEI+  V+V  
Sbjct: 720  VHTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNM 779

Query: 827  ARELDAYWAEMRLLYSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKR 886
             RELDAYWA+MRLLYSCFEADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKR
Sbjct: 780  VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKR 839

Query: 887  AYKEANHLLGDIVKVTPTSKVVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLM 946
            AY+EAN+LLGD+VKVTPTSKVVGDLAQFMVTN+L S+DV+RLA+SLDFPDSVMDFFEGL+
Sbjct: 840  AYREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLI 899

Query: 947  GQPYGGFPEPLRSDILRNKRRKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNM 1006
            GQPYGGFPEPLR+D+L+NKRRKLT RPGLEL PFDLE I+EDL +RFG+IDECDVASYNM
Sbjct: 900  GQPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNM 959

Query: 1007 YPKVYEDFQKMKELYGDLSVLPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKET 1066
            YPKVYEDF+K++E YGDLSVLPTKNFL+PP++GE+I V +EQGKTLIIK QA+GDLNK+T
Sbjct: 960  YPKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDT 1019

Query: 1067 GMRDVYFELNGEMRKIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLV 1126
            G+R+VYFELNGE+RK+ V DRSQKVE +SKPKAD HDP+Q+GAPMAGV+VEVKVHKGSLV
Sbjct: 1020 GIREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLV 1079

Query: 1127 KKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAEN 1162
            KKGQPVA+LSAMKMEMV+SS A G VKDV +KD EN
Sbjct: 1080 KKGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGEN 1115

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1905 bits (4936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/1154 (79%), Positives = 997/1154 (86%), Gaps = 1/1154 (0%)

Query: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68
            +LAG R + N+LGEK+K+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLS HR KADE
Sbjct: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63

Query: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128
            AY+IG EGQYTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV+ AGITWIG
Sbjct: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123

Query: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            PP  VIE+VGDKVSARNLAA A VPTVPGT GPI +VEEAE FV +YGYPVIIKAA+   
Sbjct: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGG 183

Query: 189  XXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248
                       DI DAFQRA SEA+TAFGNGTCFVERFLD+PKHIEVQLLADN+GNV+HL
Sbjct: 184  GRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243

Query: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308
            FERDCSVQRRHQKVVEVAPAKTL ++VRDAILTDAVKLAK +GYRNAGTAEFLVD QNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303

Query: 309  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITT 368
            YFIEINPRIQVEHTITEEIT               SL +LGL+QDRITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITT 363

Query: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428
            EDP+KNFQPDTGR++VY S GGNGVRLDGGNA+AGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488
            RK++RALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLF MV+SQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483

Query: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548
            L YL+DLAVNGSSIKGQ+G+PKL  +P+IP LH+ KGE+I V +  PP GWRQVLLE GP
Sbjct: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542

Query: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDXXXXXXXXXXXXXXXXXXECWGGA 608
            E FAK VR F GTLL DTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGA 602

Query: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668
            TFDVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 669  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTDKIV 728
            VDIFRVFDALNDLEQL                  CYSGDMLQPGKKYNLDYYLE+T+KIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722

Query: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788
             MGTH+LGIKDMAGT+KP AAKLLIGSIRAKYPDLPIHVH+HDSAGT VASM  CA +GA
Sbjct: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782

Query: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848
            DVVDVA NSMSG+TSQ SI AL ASL G+I TGV+  HA ELDAYWAEMRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842

Query: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902

Query: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968
            GDLAQFMV+N+L S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+LRNKRRK
Sbjct: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 962

Query: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028
            L VRPGLEL PFDL+ IRE+L +RF  IDECDVASYNMYPKVYEDF+K++E YGDLSVLP
Sbjct: 963  LKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088
            T NFL+PP IGE+I V +EQGK LIIKLQA+GDLNKETG R+VYFELNGE+RK+ V D+S
Sbjct: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082

Query: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148
            QK+E VSK KAD HD FQ+GAPMAGVI+EVKVHKGS V KGQPVA+LSAMKMEMV+SS +
Sbjct: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142

Query: 1149 DGQVKDVFVKDAEN 1162
            DGQVKDVFV D E 
Sbjct: 1143 DGQVKDVFVSDGET 1156

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  292 bits (748), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 172/453 (37%), Positives = 250/453 (55%), Gaps = 15/453 (3%)

Query: 21   GEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTP 80
            G    +LVANRGEI +RI +T   + ++++AIYS  D+ S H L  D A  +     +T 
Sbjct: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD---GHTV 684

Query: 81   VGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDK 140
               YL +++II IAKK+ VD I PGYGFLSEN+ FAD+ ++ GI +IGP  E I  +G K
Sbjct: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744

Query: 141  VSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXD 200
             SAR +A  A VP VPG+P  +K  +EA       GYPV++K+                D
Sbjct: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803

Query: 201  IGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ 260
            +  AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+QRR+Q
Sbjct: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863

Query: 261  KVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQV 319
            KV+E  PA  LPR+ R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N R+QV
Sbjct: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923

Query: 320  EHTITEEIT--XXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITTEDPAKNFQP 377
            EH ITE +T                 SL E  + Q+     G +I+ R+  E+P K+F+P
Sbjct: 924  EHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN-----GASIEVRVYAENPLKDFRP 978

Query: 378  DTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIE 437
              G  E+      N  R+D      G  ISP +D  L K    G        K+ +AL E
Sbjct: 979  SPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNE 1035

Query: 438  FRIRGVKTNIPFLLTLLTHPVFISGQYWTTFID 470
             +I G  TN+ +L +L++  +F + Q  T +++
Sbjct: 1036 TKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%)

Query: 1107 IGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAE 1161
            I +  AG   +  V  G+ ++K Q VA++ AMK EM+VSS   G++K    K+ +
Sbjct: 1766 IFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFLFKNGD 1820

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  276 bits (705), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 171/471 (36%), Positives = 249/471 (52%), Gaps = 19/471 (4%)

Query: 9    KLAGLRANFNILGEK--------DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLS 60
            K  G RA F +L +K        D +L+ANRGEI +RI +T  +L +R+VA+YS  D+ S
Sbjct: 611  KYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670

Query: 61   THRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ 120
             H   AD +  +      T    YL +++IID AK+     I PGYGFLSEN++F+D   
Sbjct: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727

Query: 121  KAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVI 180
             AGIT++GP  ++I  +G K SAR +A KA VP VPG+   I +VEEA+   AE  YPV+
Sbjct: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVM 786

Query: 181  IKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLAD 240
            +K+                DI   F+    + +T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846

Query: 241  NHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEF 300
              G  I L ERDCS+QRR+QKV+E  PA  LP   R A+   A  L     Y+ AGT EF
Sbjct: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906

Query: 301  LVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRG 359
            + D  ++  YF+E+N R+QVEH ITE +T               +         ++   G
Sbjct: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNG 963

Query: 360  FAIQCRITTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSC 419
             +++ R+  E+P KNF+P  G +        +  R+D      G  ISP YD  L K   
Sbjct: 964  VSMEARLYAENPLKNFRPSPGLL--VDVKFPDWARVDTW-VKKGTNISPEYDPTLAKIIV 1020

Query: 420  SGSTYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFID 470
             G   +    K+ +AL E ++ G  TNI +L +++T   F   +  T  ++
Sbjct: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

>Scas_721.40
          Length = 1834

 Score =  265 bits (678), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 248/468 (52%), Gaps = 13/468 (2%)

Query: 5    GQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRL 64
            G K  L  L  N         +LVANRGEI +RI +T  ++ +++VAI+S  DR S H +
Sbjct: 609  GFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVI 668

Query: 65   KADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGI 124
             AD    +  +G  +    YL I++IID AKK G   I PGYGFLSEN++F+++    GI
Sbjct: 669  DAD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGI 725

Query: 125  TWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAA 184
            T++GP  +V+  +G K SAR +A KA VP VPG+   I T  EA+   A+  YP+++K+ 
Sbjct: 726  TFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKST 784

Query: 185  YXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 244
                           DI   F+    +    FG+   F+ERF++  +H+EVQ++ D  GN
Sbjct: 785  AGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGN 844

Query: 245  VIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN 304
             + + ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D 
Sbjct: 845  ALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDE 904

Query: 305  -QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQ 363
             ++  YF+E+N R+QVEH ITE +T               +       Q +I   G A++
Sbjct: 905  IRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNGVAME 961

Query: 364  CRITTEDPAKNFQPDTGR-IEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGS 422
             R+  E+P  +F+P  G+ +EV         R+D   +  G +++P YD  L K    G 
Sbjct: 962  ARLYAENPVHDFKPSPGQLVEVEFP---KWARIDTWVS-KGTIVTPEYDPTLAKIIVHGK 1017

Query: 423  TYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFID 470
                   K+ +AL+E ++ G  TNI +L ++ +  +F   +  T  ++
Sbjct: 1018 DRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%)

Query: 1120 VHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDA 1160
            V +G  VK GQ + I+ AMK EM+V +  DG+V  +  K+ 
Sbjct: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNG 1817

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  263 bits (671), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/448 (34%), Positives = 239/448 (53%), Gaps = 11/448 (2%)

Query: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83
            + +L+ANRGEI +RI +T   + +++VA+YS  D+ S H   AD  + +   G+ T    
Sbjct: 625  ETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAET 681

Query: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143
            YL ID+II+ AKK G   I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SA
Sbjct: 682  YLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSA 741

Query: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGD 203
            R +A +AKVP VPG+ G IK  +EA+    +  YPV++K+                DI  
Sbjct: 742  REIAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIER 800

Query: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263
             F+    + K+ FG+   F+ERF++  +H+E+Q++ D  G  I + ERDCS+QRR+QKV+
Sbjct: 801  VFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVI 860

Query: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 322
            E  PA  LP   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 861  EETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHP 920

Query: 323  ITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 382
            ITE +T               S         +I   G +I+ R+  E+P K+F+P  G++
Sbjct: 921  ITEMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQL 977

Query: 383  EVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRG 442
                 +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G
Sbjct: 978  T--SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYG 1034

Query: 443  VKTNIPFLLTLLTHPVFISGQYWTTFID 470
              TNI +L ++ +  +F   +  T  +D
Sbjct: 1035 CITNIDYLRSIASSKMFKEAKVATKVLD 1062

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  256 bits (653), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 159/462 (34%), Positives = 240/462 (51%), Gaps = 16/462 (3%)

Query: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83
            + +L+ANRGEI +RI +T  +L++R+VA+YS  D+ S H + AD    +      T    
Sbjct: 627  ETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAET 683

Query: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143
            YL ID+II  AK      I PGYGFLSEN+EFADK  + GI ++GP  E I  +G K SA
Sbjct: 684  YLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSA 743

Query: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGD 203
            R +A KA VP VPG+ G + + +EA+    +  YPV++K+                +I  
Sbjct: 744  REIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIER 802

Query: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263
             F+    + K  FG+   F+ERF++  +H+E+Q++ D +G  I + ERDCS+QRR+QK++
Sbjct: 803  VFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKII 862

Query: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHT 322
            E  PA  L    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 863  EETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHP 922

Query: 323  ITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 382
            ITE +T               +          I   G +I+ R+  E+PAK+F+P  G +
Sbjct: 923  ITEMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLL 979

Query: 383  -EVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIR 441
             +V+        R+D   +  G  +S  YD  L K    G        K+ +AL E  + 
Sbjct: 980  TDVHFP---EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVY 1035

Query: 442  GVKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHMVS 480
            G  TNI +L ++ +  +F + +  T  +D     P  F + S
Sbjct: 1036 GCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 1120 VHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAE 1161
            V  G  V KG  + I+ AMK EMVV ++  G+V  +  K+ +
Sbjct: 1777 VSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGD 1818

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  255 bits (652), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 162/480 (33%), Positives = 240/480 (50%), Gaps = 19/480 (3%)

Query: 5    GQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRL 64
            G ++ +  LR   ++    D +LVANRGEI +RI RT   L +R+VA+YS  DR S H  
Sbjct: 604  GFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVR 663

Query: 65   KADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGI 124
             AD A  +G     +    YL ID+I+  AKK     I PGYGFLSEN+ FA++    GI
Sbjct: 664  DADVAVALGGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 125  TWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAA 184
             ++GP  + I  +G K  AR LAA A VP   GT G +++   A     E GYP+++K+ 
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKST 779

Query: 185  YXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 244
                           ++  AF++   + +  F +   F+E F+ + +H+EVQ++ D HG 
Sbjct: 780  AGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGR 839

Query: 245  VIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN 304
             + L ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D 
Sbjct: 840  TVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDE 899

Query: 305  Q-NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQDRITTRGFAIQ 363
            Q +  YF+E+N R+QVEH ITE +T                          +   G +++
Sbjct: 900  QKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSME 955

Query: 364  CRITTEDPAKNFQPDTGRIE--VYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSG 421
             R+  E+P K F P  G +   V+ S      R+D      G  ++  YD  L K    G
Sbjct: 956  ARVYVENPVKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHG 1010

Query: 422  STYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHM 478
               E    K++ AL E RI G  TN+ +L ++ +   F     +T  ++D   TP  F +
Sbjct: 1011 KDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 1065 ETGMRDVYFELNGEMRKIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGS 1124
            ++G R   F     + K+   D    V K ++P     D   + +  AG   +  V  G 
Sbjct: 1712 QSGERAAEF---ARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGD 1768

Query: 1125 LVKKGQPVAILSAMKMEMVVSSQADGQVKDVF 1156
             VK+G  + I+ AMK EMVVS+ ADG+V ++ 
Sbjct: 1769 KVKEGDKLVIIEAMKTEMVVSATADGEVINIL 1800

>Kwal_27.11951
          Length = 1869

 Score =  254 bits (648), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 247/471 (52%), Gaps = 34/471 (7%)

Query: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83
            + +LVANRGEI +RI +T  +L +++VA+YS  D+ S H   AD A  +  +G+ T    
Sbjct: 666  ETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAET 722

Query: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143
            YL ID+II  AK+ G + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SA
Sbjct: 723  YLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSA 782

Query: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGD 203
            R +A KA VP VPG+ G +KT +EA        YPV++K+                DI  
Sbjct: 783  REIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIER 841

Query: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263
             F+    + K  FG+   F+ERF++  +H+E+Q++ D  G  I + ERDCS+QRR+QKV+
Sbjct: 842  VFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVI 901

Query: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHT 322
            E  PA  L    R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 902  EETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHP 961

Query: 323  ITEEITXXXXXXXXXXXXXXXSLTELGLL----------QDRITTRGFAIQCRITTEDPA 372
            ITE +T                L E  LL            +IT  G +I+ R+  E+P 
Sbjct: 962  ITEMVT-------------GLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLYAENPV 1008

Query: 373  KNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKII 432
            K+F+P  G++     +     R+D   +  G  IS  YD  L K    G   +   +K+ 
Sbjct: 1009 KDFRPSPGQLT--DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLN 1065

Query: 433  RALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHMVS 480
            +AL E  I G  TNI +L ++ +  +F + +  T  +D     P  F + S
Sbjct: 1066 QALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 1063 NKETGMRDVYF-----ELNGEMRKIRVPDRSQKVEKVSKPKADNHDPFQIGAPMAGVIVE 1117
            NK+ G +   F     E N E+ K   PD    VE+     A+      + +  +G   +
Sbjct: 1761 NKQNGEKAEEFAKLIQESNAELEK--APDSQGAVEEEFPEDAE-----MVYSEYSGRFWK 1813

Query: 1118 VKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAE 1161
              V  G +VK G  + ++ AMK EM+VS+   G+V  V  K+ +
Sbjct: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGD 1857

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  184 bits (467), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 158/558 (28%), Positives = 245/558 (43%), Gaps = 101/558 (18%)

Query: 25  KILVANRGEIPIRIFRTAHELSMRT---------VAIYSHED-RLSTHRLKADEAYVIGE 74
           KIL+AN G   ++  R+  + +  T         V + + ED   +T  ++  + YV   
Sbjct: 61  KILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVP 120

Query: 75  EGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKV--QKAGITWIGPPPE 132
            G  T    Y  +D I+D+A++  VD +  G+G  SEN    +K+   K  + +IGPP  
Sbjct: 121 GG--TNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGS 178

Query: 133 VIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVE------------------------EA 168
            + S+GDK+S+  +A  AKVP +P +   +  VE                        + 
Sbjct: 179 AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDG 238

Query: 169 EAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLD 228
                + G+PV++KA+               D    +Q+A +E          F+ +   
Sbjct: 239 LNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE----IPGSPIFIMKLAG 294

Query: 229 KPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAK 288
           K +H+EVQLLAD +G  I LF RDCSVQRRHQK++E AP      D    +   AV+L K
Sbjct: 295 KARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGK 354

Query: 289 EAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSL-- 345
             GY +AGT E+L  + +++ YF+E+NPR+QVEH  TE +T                L  
Sbjct: 355 LVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHR 414

Query: 346 ---------------TELGL---------LQDRITTRGFAIQCRITTEDPAKNFQPDTGR 381
                          TE+            Q R   +G    CRIT+EDP + F+P  G 
Sbjct: 415 IRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGS 474

Query: 382 I---------EVYG--STGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRK 430
           +          V+G  S G NG    G ++++        DS        G   +  R+ 
Sbjct: 475 LHELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQASRKH 522

Query: 431 IIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKLL 489
           ++ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A+K  
Sbjct: 523 MVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKISAEKPD 576

Query: 490 HYLADLAVNGSSIKGQIG 507
             LA   + G++ K  I 
Sbjct: 577 PMLA--VICGATTKAHIA 592

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADG 1150
            +DP Q+  P  G +V   V  G  ++ GQP A +  MKM+M + +Q  G
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESG 746

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 154/542 (28%), Positives = 243/542 (44%), Gaps = 107/542 (19%)

Query: 25  KILVANRGEIPIRIFRTAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IGE 74
           K+L+AN G   ++  R+  + +  T         VA+ + ED      L+A+  Y+ + +
Sbjct: 61  KVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMAD 114

Query: 75  EGQYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKV--QKAGITWIG 128
           +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  I +IG
Sbjct: 115 QYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIG 174

Query: 129 PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTV--EEAEAFVA------------- 173
           PP   + S+GDK+S+  +A  AKVP +P +   + TV  +E    V+             
Sbjct: 175 PPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSS 234

Query: 174 ---------EYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVE 224
                    + G+PV+IKA+               D  + + +A +E          F+ 
Sbjct: 235 PEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFIM 290

Query: 225 RFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAV 284
           +   K +H+EVQLLAD +G  I LF RDCSVQRRHQK++E AP      +    +   AV
Sbjct: 291 KLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAV 350

Query: 285 KLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXX 343
           +L K  GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +T               
Sbjct: 351 RLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGI 410

Query: 344 SLTELGLL--------------------QDRITT------RGFAIQCRITTEDPAKNFQP 377
            +  +  +                    +D + T      +G    CRIT+EDP   F+P
Sbjct: 411 PMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKP 470

Query: 378 DTGRI---------EVYG--STGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426
             G +          V+G  S G NG    G ++++        DS        G   + 
Sbjct: 471 SGGTLNELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQA 518

Query: 427 VRRKIIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRA 485
            R+ ++ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S++  A
Sbjct: 519 SRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTA 572

Query: 486 QK 487
           +K
Sbjct: 573 KK 574

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +DP Q+  P  G +V+  V  G  +  GQ  A +  MKM+M + SQ +G V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKMQMPLLSQENGIVQ 749

>Scas_720.74
          Length = 2231

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 152/526 (28%), Positives = 235/526 (44%), Gaps = 101/526 (19%)

Query: 25  KILVANRGEIPIRIFRT---------AHELSMRTVAIYSHEDRLSTHRLKADEAYV-IGE 74
           KIL+AN G   ++  R+          +E +++ VA+ + ED      L+A+  Y+ + +
Sbjct: 61  KILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMAD 114

Query: 75  EGQYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKV--QKAGITWIG 128
           +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  + +IG
Sbjct: 115 QYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIG 174

Query: 129 PPPEVIESVGDKVSARNLAAKAKVPTVP--GT----------------------PGPIKT 164
           PP   + S+GDK+S+  +A  A VP +P  GT                       G   +
Sbjct: 175 PPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSS 234

Query: 165 VEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVE 224
            E+      + G+PV+IKA+               D    + +A +E          F+ 
Sbjct: 235 PEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIM 290

Query: 225 RFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAV 284
           +   K +H+EVQLLAD +GN I LF RDCSVQRRHQK++E AP      +    +   AV
Sbjct: 291 KLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAV 350

Query: 285 KLAKEAGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXX 343
           +L K  GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +T               
Sbjct: 351 RLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGI 410

Query: 344 SL-------------------------TELGL-LQDRITTRGFAIQCRITTEDPAKNFQP 377
            +                         TE  L  Q +   +G    CRIT+EDP + F+P
Sbjct: 411 PMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKP 470

Query: 378 DTGRI---------EVYG--STGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426
             G +          V+G  S G NG    G ++++        DS        G   + 
Sbjct: 471 SGGSLHELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQA 518

Query: 427 VRRKIIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGQYWTTFIDD 471
            R+ ++ AL E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 519 SRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +DP Q+  P  G +V+  V  G  +  GQP A +  MKM+M + +Q  G ++
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETGIIQ 749

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  181 bits (459), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 155/565 (27%), Positives = 249/565 (44%), Gaps = 109/565 (19%)

Query: 25  KILVANRGEIPIRIFRTAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IGE 74
           K+L+AN G   ++  R+  + +  T         VA+ + ED      L+A+  Y+ + +
Sbjct: 62  KVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMAD 115

Query: 75  EGQYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKA--GITWIG 128
           +    P G     Y  +D I+++A++  VD +  G+G  SEN    +++  +   I +IG
Sbjct: 116 QYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIG 175

Query: 129 PPPEVIESVGDKVSARNLAAKAKVPTVP--GT----------------------PGPIKT 164
           PP   + S+GDK+S+  +A  AKVP +P  GT                       G   +
Sbjct: 176 PPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSS 235

Query: 165 VEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVE 224
            E+      E G+P+++KA+               +    +Q+A +E          F+ 
Sbjct: 236 PEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFIM 291

Query: 225 RFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAV 284
           +   K +H+EVQLLAD +G  I LF RDCSVQRRHQK++E AP      D    +   AV
Sbjct: 292 KLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAV 351

Query: 285 KLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXX-- 341
           +L +  GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +T               
Sbjct: 352 RLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGI 411

Query: 342 ------------------------XXSLTELGLLQDRITTRGFAIQCRITTEDPAKNFQP 377
                                     S  E    Q + T +G    CRIT+EDP + F+P
Sbjct: 412 PMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKP 471

Query: 378 DTGRI---------EVYG--STGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426
             G +          V+G  S G NG    G ++++        DS        G   + 
Sbjct: 472 SGGALHELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQA 519

Query: 427 VRRKIIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRA 485
            R+ ++ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A
Sbjct: 520 SRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTA 573

Query: 486 QKLLHYLADLAVNGSSIKGQIGLPK 510
           +K    L+   + G++ K  I   K
Sbjct: 574 EKPDRTLS--VICGAATKAHIASQK 596

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +DP Q+  P  G +V+  V  G  V  GQP A +  MKM+M + SQ +G V+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVVQ 750

>Kwal_23.6157
          Length = 2230

 Score =  179 bits (454), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 229/511 (44%), Gaps = 71/511 (13%)

Query: 25  KILVANRGEIPIRIFRT---------AHELSMRTVAIYSHED-RLSTHRLKADEAYVIGE 74
           K+L+AN G   ++  R+          +E +++ VA+ + ED   +   L+  + YV   
Sbjct: 62  KVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVP 121

Query: 75  EGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKA--GITWIGPPPE 132
            G  T    Y  +D I+++A++  VD +  G+G  SEN    +++  +   + +IGPP  
Sbjct: 122 GG--TNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGN 179

Query: 133 VIESVGDKVSARNLAAKAKVPTVP--GT----------------------PGPIKTVEEA 168
            + S+GDK+S+  +A  AKVP +P  GT                       G   + E+ 
Sbjct: 180 AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDG 239

Query: 169 EAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLD 228
            A   + G+PV++KA+               D    +++A +E          F+ +   
Sbjct: 240 LAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFIMKLAG 295

Query: 229 KPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAK 288
             +H+EVQLLAD +G  I LF RDCSVQRRHQK++E AP      D    +   AV+L K
Sbjct: 296 NARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGK 355

Query: 289 EAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSL-- 345
             GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++                +  
Sbjct: 356 LVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHR 415

Query: 346 ---------------TELGL---------LQDRITTRGFAIQCRITTEDPAKNFQPDTGR 381
                          TE+           +Q R T +G    CRIT+EDP + F+P  G 
Sbjct: 416 IKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGS 475

Query: 382 IEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIR 441
           +        + V      + +G + S   DS        G   +  R+ ++ AL E  IR
Sbjct: 476 LHELNFRSSSNVWGYFSVSSSGGIHS-FSDSQFGHIFAFGENRQASRKHMVVALKELSIR 534

Query: 442 G-VKTNIPFLLTLLTHPVFISGQYWTTFIDD 471
           G  +T + +L+ LL    F      T ++DD
Sbjct: 535 GDFRTTVEYLIKLLETEDFEGNSITTGWLDD 565

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +DP Q+  P  G +V+     G  V  GQP A +  MKM+M + SQ  G ++
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESGIIQ 750

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  179 bits (453), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 148/526 (28%), Positives = 227/526 (43%), Gaps = 101/526 (19%)

Query: 25  KILVANRGEIPIRIFRTAHELSMRT---------VAIYSHEDRLSTHRLKADEAYV-IGE 74
           KIL+AN G   ++  R+  + +  T         VA+ + ED      L+A+  Y+ + +
Sbjct: 61  KILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMAD 114

Query: 75  EGQYTPVGA----YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQ--KAGITWIG 128
           +    P G     Y  +D I+DIA++  VD +  G+G  SEN    +K+   K  + +IG
Sbjct: 115 QYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIG 174

Query: 129 PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTV--EEAEAFVA------------- 173
           PP   + S+GDK+S+  +A  AKVP +P +   + TV  +E    V+             
Sbjct: 175 PPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTS 234

Query: 174 ---------EYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVE 224
                      G+PV+IKA+               D    + +A +E          F+ 
Sbjct: 235 PEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIM 290

Query: 225 RFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAV 284
           +   + +H+EVQLLAD +G  I LF RDCSVQRRHQK++E AP      +    +   AV
Sbjct: 291 KLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAV 350

Query: 285 KLAKEAGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXX 343
           +L K  GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++               
Sbjct: 351 RLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGI 410

Query: 344 SLTELGLL--------------------------QDRITTRGFAIQCRITTEDPAKNFQP 377
            +  +  +                          Q R   +G    CRIT+EDP   F+P
Sbjct: 411 PMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKP 470

Query: 378 DTGRI---------EVYG--STGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426
             G +          V+G  S G NG             I    DS        G   + 
Sbjct: 471 SGGTLHELNFRSSSNVWGYFSVGNNG------------NIHSFSDSQFGHIFAFGENRQA 518

Query: 427 VRRKIIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGQYWTTFIDD 471
            R+ ++ AL E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 519 SRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 1102 HDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +DP Q+  P  G +V+  V  G  + KGQP A +  MKM+M + SQ +G V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQ 749

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 132/445 (29%), Positives = 203/445 (45%), Gaps = 73/445 (16%)

Query: 84  YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKA--GITWIGPPPEVIESVGDKV 141
           Y  ID I+D+A++  VD +  G+G  SEN    + +  +   I +IGPP   + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 142 SARNLAAKAKVPTVPGTPGPIKTV------------------------EEAEAFVAEYGY 177
           S+  +A  AK+P +P +   I T+                        E+A       G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 178 PVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQL 237
           PV+IKA+               D    +++A +E   +      FV + +   +H+EVQL
Sbjct: 174 PVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGS----PMFVMKVVTDARHLEVQL 229

Query: 238 LADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGT 297
           LAD +G  I LF RDCS+QRRHQK++E AP      +    +   A++L +  GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 298 AEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLTELGLLQ---- 352
            E+L     ++ YF+E+NPR+QVEH  TE I+                +  +  ++    
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 353 --------------DRITTRGFAIQCRITTEDPAKNFQPDTGRI---------EVYG--S 387
                          R + +G  I CRIT+EDP + F+P TG+I          V+G  S
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 388 TGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRG-VKTN 446
            G NG             I    DS        G+  +  ++ ++ AL +F IRG  KT 
Sbjct: 410 VGNNG------------AIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTP 457

Query: 447 IPFLLTLLTHPVFISGQYWTTFIDD 471
           I +L+ LL    F S    T ++DD
Sbjct: 458 IEYLIELLETRDFESNNISTGWLDD 482

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 1103 DPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVK 1153
            +P Q+ +P  G +V+  V  G  V  GQ  A +  MKM+M + +++DG ++
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIE 668

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 131/332 (39%), Gaps = 52/332 (15%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 435 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 494

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 495 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTP 546

Query: 131 PEVIESVGDKVSARNLAAKA--KVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            + I +  D    R L A A  ++           +VEEA A V + G+PVI++AAY   
Sbjct: 547 IDTIITTED----RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAY--- 599

Query: 189 XXXXXXXXXXXDIGDAFQRATSE----AKTAFGNG-TCFVERFLDKPKHIEVQLLADNHG 243
                       +G  F     E       AF +     VER +   K +E +++ D   
Sbjct: 600 --------ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFD 651

Query: 244 NVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGT 297
           N I +    C+++            + VAP++TL  +  + + T AV + +  G      
Sbjct: 652 NCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECN 707

Query: 298 AEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
            ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 708 IQYALNPFSKEYCIIEVNARLSRSSALASKAT 739

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/282 (18%), Positives = 112/282 (39%), Gaps = 28/282 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT    +++T+ I  + + +ST   +AD  Y              + ++ ++DI +    
Sbjct: 1005 RTLRANNIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEAEAS 1053

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
            + +    G  + N+  A  + +  +  +G  P++I+S      A N    +++    G  
Sbjct: 1054 NGVVVSMGGQTSNN-IAMSLHRENVKILGTSPDMIDS------AENRYKFSRMLDQIGVD 1106

Query: 160  GP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTA 215
             P    + +++EAE F  + GYPV+++ +Y              D+     +A   ++  
Sbjct: 1107 QPAWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR-- 1164

Query: 216  FGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRD 274
              +    + ++++  K IE+  +A N   V+H+          H      + P + L  +
Sbjct: 1165 --DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPE 1222

Query: 275  VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
              D I+    K+ K          +F+  + N    IE N R
Sbjct: 1223 TVDRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1263

>Kwal_33.14061
          Length = 2221

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/330 (21%), Positives = 128/330 (38%), Gaps = 48/330 (14%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 497 -------FLPVNAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTP 548

Query: 131 PEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXX 190
            + + +  D+    N  A  ++           TVEEA   V E G+PVI +AAY     
Sbjct: 549 IDTVITTEDRELFSN--AMDEINEKCAKSKAAATVEEALEAVKEIGFPVICRAAY----- 601

Query: 191 XXXXXXXXXDIGDAFQRATSE----AKTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNV 245
                     +G  F     E       AF +     VER +   K +E +++ D   N 
Sbjct: 602 ------ALGGLGSGFANNEKELVDLCNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNC 655

Query: 246 IHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAE 299
           I +    C+++            + VAP++TL  +  + + T AV + +  G       +
Sbjct: 656 ITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQ 711

Query: 300 FLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           + ++  ++ Y  IE+N R+     +  + T
Sbjct: 712 YALNPFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 51/282 (18%), Positives = 109/282 (38%), Gaps = 28/282 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT  +  ++++ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1007 RTLRKEKIKSIMVNYNPETVSTDYDEADRLYF-----------ETICLERILDIYEIESS 1055

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  PE+I+S      A N    +++    G  
Sbjct: 1056 AGVVVSMGGQTSNN-IAMSLHRENVKILGTTPEMIDS------AENRYKFSRMLDQIGVD 1108

Query: 160  GP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTA 215
             P    + ++EEAE F     +PV+++ +Y              D+     +A   ++  
Sbjct: 1109 QPAWKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR-- 1166

Query: 216  FGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRD 274
              +    + ++++  K IE+  +A +   V+H+          H      + P + L  +
Sbjct: 1167 --DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPE 1224

Query: 275  VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
              + I+    K+ K          +F+  N N    IE N R
Sbjct: 1225 TVERIVVATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVR 1265

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 130/330 (39%), Gaps = 48/330 (14%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G P
Sbjct: 497 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTP 548

Query: 131 PEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXX 190
            + + +  D+    N  A  ++           TV+EA   V E G+PVI++AAY     
Sbjct: 549 IDTVITTEDRELFSN--AMDEINEKCAKSKAASTVKEALEAVKEIGFPVIVRAAY----- 601

Query: 191 XXXXXXXXXDIGDAFQRATSE----AKTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNV 245
                     +G  F    +E       AF +     VER +   K +E +++ D   N 
Sbjct: 602 ------ALGGLGSGFASNETELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNC 655

Query: 246 IHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAE 299
           I +    C+++            + VAP++TL  +  + + T AV + +  G       +
Sbjct: 656 ITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQ 711

Query: 300 FLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           + ++  ++ Y  IE+N R+     +  + T
Sbjct: 712 YALNPFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/282 (18%), Positives = 110/282 (39%), Gaps = 28/282 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT    +++T+ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1007 RTLRANNVKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERILDIYEAEAS 1055

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  PE+I+S      A N    +++    G  
Sbjct: 1056 AGVVISMGGQTSNN-IAMSLHREKVKILGTSPEMIDS------AENRYKFSRMLDQIGVD 1108

Query: 160  GP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTA 215
             P    + +++EAE F    GYPV+++ +Y              D+     +A   ++  
Sbjct: 1109 QPAWKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR-- 1166

Query: 216  FGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRD 274
              +    + ++++  K IE+  +A +   V+H+          H      + P + L  +
Sbjct: 1167 --DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPE 1224

Query: 275  VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
              + I+    K+ K          +F+  N N    IE N R
Sbjct: 1225 TVNRIVVATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVR 1265

>Scas_582.4*
          Length = 2193

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/282 (19%), Positives = 112/282 (39%), Gaps = 28/282 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT     ++T+ I  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 982  RTLRANKIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERILDIYEIENS 1030

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  PE+I+S      A N    +++    G  
Sbjct: 1031 SGVVVSMGGQTSNN-IAMSLHRENVKILGTSPEMIDS------AENRYKFSRMLDQIGVD 1083

Query: 160  GP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTA 215
             P    + +++EAE+F  + GYPV+++ +Y              D+     +A   ++  
Sbjct: 1084 QPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR-- 1141

Query: 216  FGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRD 274
              +    + ++++  K IE+  +A N   V+H+          H      + P + L ++
Sbjct: 1142 --DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKE 1199

Query: 275  VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
              D I+    K+ K          +F+  + N    IE N R
Sbjct: 1200 TVDRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1240

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 128/332 (38%), Gaps = 52/332 (15%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 432 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 491

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G  
Sbjct: 492 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTQ 543

Query: 131 PEVIESVGDKVSARNLAAKA--KVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            + I +  D    R L A A  ++           +VEEA   V + G+PVI++AAY   
Sbjct: 544 IDTIITTED----RELFANAIDEINEKCAKSHAANSVEEALTAVKDIGFPVIVRAAY--- 596

Query: 189 XXXXXXXXXXXDIGDAFQRATSE----AKTAFGNG-TCFVERFLDKPKHIEVQLLADNHG 243
                       +G  F     E       AF +     VER +   K IE +++ D   
Sbjct: 597 --------ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFD 648

Query: 244 NVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGT 297
           N + +    C+++            + VAP++TL  +  + +   AV + +  G      
Sbjct: 649 NCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECN 704

Query: 298 AEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
            ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 705 IQYALNPFSKEYCIIEVNARLSRSSALASKAT 736

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/325 (20%), Positives = 128/325 (39%), Gaps = 38/325 (11%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS      D+ +  G+  +G P
Sbjct: 497 -------FVPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTP 548

Query: 131 PEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXXXX 190
            + I +  D+    N  A  ++           +V+EA A V E G+PVI++AAY     
Sbjct: 549 IDTIITTEDRELFSN--AIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAAYALGGL 606

Query: 191 XXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFE 250
                    ++ D    A S +          VE+ +   K +E +++ D   N I +  
Sbjct: 607 GSGFANNEKELVDLCNVAFSSSP------QVLVEKSMKGWKEVEYEVVRDAFDNCITV-- 658

Query: 251 RDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN 304
             C+++            + VAP++TL  +  + + T AV + +  G       ++ ++ 
Sbjct: 659 --CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP 716

Query: 305 QNRHY-FIEINPRIQVEHTITEEIT 328
            ++ Y  IE+N R+     +  + T
Sbjct: 717 VSKDYCIIEVNARLSRSSALASKAT 741

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/282 (18%), Positives = 112/282 (39%), Gaps = 28/282 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT    +++T+ +  + + +ST   +AD  Y              + ++ ++DI +    
Sbjct: 1007 RTLRANNIKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEIENS 1055

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  P++I+S      A N    +++    G  
Sbjct: 1056 SGVVVSMGGQTSNN-IAMTLHRENVKILGTSPDMIDS------AENRYKFSRMLDQIGVD 1108

Query: 160  GP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTA 215
             P    + +++EAE+F  + GYPV+++ +Y              D+     +A   ++  
Sbjct: 1109 QPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR-- 1166

Query: 216  FGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRD 274
              +    + ++++  K IE+  +A N   V+H+          H      + P + L  +
Sbjct: 1167 --DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPE 1224

Query: 275  VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
              D I+    K+ K          +F+  + N    IE N R
Sbjct: 1225 TVDRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1265

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 95/222 (42%), Gaps = 23/222 (10%)

Query: 116 ADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKA-KVPTVP-GTPGPIKTVEEAEAFVA 173
           A  ++K G+T +G P  V+E+  D    R L A+A K   +P        TVE+A A   
Sbjct: 126 AVTLEKYGVTVLGTPISVLETTED----RELFARALKEINMPIAESVACSTVEDAVAAAN 181

Query: 174 EYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHI 233
           + GYPVI+++AY                 D  Q     A++   +    VE+ L   K I
Sbjct: 182 DIGYPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQSLALSPQVLVEKSLKGWKEI 235

Query: 234 EVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLA 287
           E +++ D  GN I +    C+++            + +AP++TL  +    + T A+++ 
Sbjct: 236 EYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEII 291

Query: 288 KEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           +  G       ++ +      +  IE+N R+     +  + T
Sbjct: 292 RHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKAT 333

>Kwal_55.19783
          Length = 1121

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 93/226 (41%), Gaps = 37/226 (16%)

Query: 119 VQKAGITWIGPPPEVIESVGDKVSARNLAAKA----KVPTVPGTPGPIKTVEEAEAFVAE 174
           +QK G+  +G P + +E+  D    R+L A+A     +PT        +TV+EA +  + 
Sbjct: 132 LQKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPTAESFA--CETVDEALSAASR 185

Query: 175 YGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC-----FVERFLDK 229
            GYPVI+++AY               +G  F    +E K              VE+ L  
Sbjct: 186 VGYPVIVRSAY-----------ALGGLGSGFAENEAEMKELAAQALSLSPQILVEKSLKG 234

Query: 230 PKHIEVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDA 283
            K +E +++ D   N I +    C+++            +  AP++TL  +    + T A
Sbjct: 235 WKEVEYEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAA 290

Query: 284 VKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           +K+ +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 291 IKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 105/275 (38%), Gaps = 31/275 (11%)

Query: 40  RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAK-KHG 98
           R   E   +T+ I  + + +ST   + D  Y   EE         L+ + ++DI + +H 
Sbjct: 609 RALREKGKKTIMINYNPETVSTDFDEVDRLYF--EE---------LSFERVMDIYELEHS 657

Query: 99  VDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGT 158
              +    G L +N   A K+ + G   +G  PE I+       A N    + +    G 
Sbjct: 658 EGAVISVGGQLPQN--IALKMLENGANILGTSPEDIDR------AENRHKFSSILDTIGV 709

Query: 159 PGP----IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKT 214
             P    + +V EA+ F    GYPV+I+ +Y                 D  +   + A  
Sbjct: 710 DQPEWSELSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSE----DELETKLTNASD 765

Query: 215 AFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPR 273
              +    + +F++  + I+V  +A N   ++H           H      + P ++L  
Sbjct: 766 VSPDHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSE 825

Query: 274 DVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308
            +++ +   A K+A    ++  G     +   +RH
Sbjct: 826 SIKERLYDIAKKVAH--AWKITGPFNMQIIKDDRH 858

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 129/332 (38%), Gaps = 52/332 (15%)

Query: 22  EKDKILVANRGEIPI-----------RIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAY 70
           E  K+LV   G + I           +  +   E  + T+ I  +   + T +  AD+ Y
Sbjct: 453 EPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 512

Query: 71  VIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPP 130
                  + PV A   + ++I   +   +     G   LS   E  D+ +  G+  +G  
Sbjct: 513 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTS 564

Query: 131 PEVIESVGDKVSARNLAAKA--KVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYXXX 188
            + I +  D    R L A A  ++           TV+EA   V + G+PVI++AAY   
Sbjct: 565 IDTIITTED----RELFANAMDEINEKCAKSKAASTVDEALEAVKDIGFPVIVRAAY--- 617

Query: 189 XXXXXXXXXXXDIGDAFQRATSE----AKTAFGNG-TCFVERFLDKPKHIEVQLLADNHG 243
                       +G  F     E       AF +     VER +   K +E +++ D   
Sbjct: 618 --------ALGGLGSGFASNEQELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFD 669

Query: 244 NVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGT 297
           N I +    C+++            + VAP++TL  +  + + T AV + +  G      
Sbjct: 670 NCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECN 725

Query: 298 AEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
            ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 726 IQYALNPFSKEYCIIEVNARLSRSSALASKAT 757

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 52/281 (18%), Positives = 110/281 (39%), Gaps = 26/281 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT  + +++T+ +  + + +ST   + D  Y              + ++ I+DI +    
Sbjct: 1023 RTLRQNNVKTIMVNYNPETVSTDYDEVDRLYF-----------ETINMERILDIYEVESS 1071

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  PE+I+S  ++     +  + +V      P
Sbjct: 1072 AGVVVSMGGQTSNN-IAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEV----DQP 1126

Query: 160  G--PIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFG 217
                + ++EEAE F  + GYPV+++ +Y              D+     +A   ++    
Sbjct: 1127 AWKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY-- 1184

Query: 218  NGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ--KVVEVAPAKTLPRDV 275
                 + ++++  K IE+  +A +   ++H+          H     + V P    P  V
Sbjct: 1185 --PVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1242

Query: 276  RDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
            R  I+    K+ +          +F+  N N    IE N R
Sbjct: 1243 R-RIVDATAKIGRALKITGPYNIQFIAKN-NEIKVIECNVR 1281

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 91/223 (40%), Gaps = 33/223 (14%)

Query: 120 QKAGITWIGPPPEVIESVGDKVSARNLAAKA-KVPTVP-GTPGPIKTVEEAEAFVAEYGY 177
           +K G+  +G P + +E+  D    R+L A+A K   +P       +T+++A    A+  Y
Sbjct: 133 EKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPIAESFACETIDQALEAAAKVKY 188

Query: 178 PVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNG-----TCFVERFLDKPKH 232
           PVI+++AY               +G  F     E K              VE+ L   K 
Sbjct: 189 PVIVRSAY-----------ALGGLGSGFANDEQEMKELASQSLSLAPQILVEKSLKGWKE 237

Query: 233 IEVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKL 286
           IE +++ D  GN I +    C+++            +  AP++TL  +    + + A+K+
Sbjct: 238 IEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKI 293

Query: 287 AKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
            +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 294 IRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 119/299 (39%), Gaps = 41/299 (13%)

Query: 44  ELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIH 103
           E  + T+ I  +   + T +  AD+ Y       + PV A   + ++I   +   +    
Sbjct: 468 EEGIYTILINPNIATIQTSKGLADKVY-------FLPVTAEF-VRKVILHERPDAIYVTF 519

Query: 104 PGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKA--KVPTVPGTPGP 161
            G   LS   E  D+ +  G+  +G P + + +  D    R L A A  ++         
Sbjct: 520 GGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTED----RELFANAMDEINEKCAKSAA 575

Query: 162 IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSE----AKTAFG 217
             TV EA   V + G+PVI++AAY               +G  F     E       AF 
Sbjct: 576 AATVAEALEAVKDIGFPVIVRAAY-----------ALGGLGSGFASNEKELVDLCNVAFA 624

Query: 218 NG-TCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKT 270
           +     VER +   K IE +++ D   N I +    C+++            + +AP++T
Sbjct: 625 SSPQVLVERSMKGWKEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQT 680

Query: 271 LPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           L  +  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 681 LSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKAT 739

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 51/281 (18%), Positives = 108/281 (38%), Gaps = 26/281 (9%)

Query: 40   RTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGV 99
            RT  + + +T+ +  + + +ST   +AD  Y              + ++ I+DI +    
Sbjct: 1005 RTLRKNNFKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERIMDIYELESS 1053

Query: 100  DFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTP 159
              +    G  + N+  A  + +  +  +G  PE+I+S  ++     +  +  V      P
Sbjct: 1054 AGVVVSMGGQTSNN-IAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDV----DQP 1108

Query: 160  G--PIKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFG 217
                + +++EAE F  +  YPV+++ +Y              D+     +A   ++    
Sbjct: 1109 AWKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY-- 1166

Query: 218  NGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ--KVVEVAPAKTLPRDV 275
                 + ++++  K IE+  +A +   ++H+          H     + V P    P  V
Sbjct: 1167 --PVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1224

Query: 276  RDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
            R  I+    K+ +          +F+  N N    IE N R
Sbjct: 1225 R-RIVEATAKIGRALQITGPYNIQFIAKN-NEIKVIECNVR 1263

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
            +   AGA ++DV++  +       S+  L+A +
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARM 257

>Scas_691.19
          Length = 1117

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 86/222 (38%), Gaps = 29/222 (13%)

Query: 119 VQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYP 178
           ++K  +  +G P + + +  D+    N   +  +P          TV+EA A      YP
Sbjct: 129 LKKYNVKVLGTPIKTLITSEDRDLFANALKEINIPIANSIA--CATVDEALAAANSIKYP 186

Query: 179 VIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAK-----TAFGNGTCFVERFLDKPKHI 233
           VII++AY               +G  F     E K     +   +    VER +   K +
Sbjct: 187 VIIRSAY-----------ALGGLGSGFANNDQELKQLSSQSLSLSPQILVERSMKGWKEV 235

Query: 234 EVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLA 287
           E +++ D  GN I +    C+++            +  AP++TL  +    + + A+K+ 
Sbjct: 236 EYEVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKII 291

Query: 288 KEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 292 RHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKAT 333

>Scas_701.35
          Length = 430

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   +  +G + +GI D  G   P     L+ ++R+      I  H H+  G A+A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 229 YTALEGGARLIDVSVLGIGERNGITPLGGLMARM 262

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DVA+  +        +  L+A +
Sbjct: 241 YTALEGGARLIDVAVLGIGERNGITPLGGLMARM 274

>Kwal_27.12090
          Length = 394

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   +  +G + +GI D  G   P     L+ +++       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
            +   AGA ++DV++  +        +  L+A +
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARM 257

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G   +GI D  G   P     L+ ++++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 781 AACAFAGADVVDVA---INSMSGMTSQASINA-LLASLDGEIDTGVNVKHARELDAYWAE 836
            +   AGA ++DV+   I   +G+TS   + A ++ S    + +   +   R+L+   AE
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPDYVKSKYKLHKLRDLETLVAE 283

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 37/229 (16%)

Query: 116 ADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKA----KVPTVPGTPGPIKTVEEAEAF 171
           A  + K  I  +G P + +E+  D    R+L A+A     +PT        +TV+ A   
Sbjct: 127 AGVLAKYNIKVLGTPIKTLETSED----RDLFAQALKEIDIPTAESIA--CETVDAALEA 180

Query: 172 VAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC-----FVERF 226
               G+PVI+++AY               +G  F     E K              VE+ 
Sbjct: 181 ADIVGFPVIVRSAY-----------ALGGLGSGFANNAQEMKQLASQSLSLAPQILVEKS 229

Query: 227 LDKPKHIEVQLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAIL 280
           L   K +E +++ D  GN I +    C+++            +  AP++TL  +    + 
Sbjct: 230 LKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLR 285

Query: 281 TDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
           + A+K+ +  G       ++ +   +  Y  IE+N R+     +  + T
Sbjct: 286 SAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKAT 334

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 55/128 (42%), Gaps = 5/128 (3%)

Query: 162 IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC 221
           + +VEEA+ F  + GYPV+I+ +Y              ++    +   + A     +   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHEL----EVKLTTASDVSPDHPV 769

Query: 222 FVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRDVRDAIL 280
            + +F++  + I+V  +A N   ++H           H      V P + L ++++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 281 TDAVKLAK 288
             A K+AK
Sbjct: 830 EIADKVAK 837

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 236 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARM 269

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     LI ++++      I  H H+  G A+A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 239 YTALEGGARLIDVSVLGIGERNGITPLGGLMARM 272

>Scas_704.3
          Length = 438

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 238 YTALEGGARLIDVSVLGIGERNGITPLGGLMARM 271

>Sklu_1841.2 YOR115C, Contig c1841 2744-3529
          Length = 261

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 10/70 (14%)

Query: 477 HMVSSQN-RAQKLLHYLADLAVNGSSIKGQIG--LPKLSTKPNIPHLHDEKGEIISVTKV 533
            + +SQN + Q++L+ L       SSI  QIG  L +L    N P+LH +K ++++V K 
Sbjct: 93  ELYTSQNDKRQQILNRL-------SSIGFQIGNKLTELLIFSNNPNLHFDKMDLLTVMKF 145

Query: 534 APPDGWRQVL 543
              D WRQ+ 
Sbjct: 146 ICRDVWRQLF 155

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      +  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA +VDV++  +        +  L+A +
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARM 274

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 61/156 (39%), Gaps = 5/156 (3%)

Query: 162 IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC 221
           + +VEEA+ F  +  YPV+I+ +Y              ++ D    A+  +     +   
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 222 FVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQ-KVVEVAPAKTLPRDVRDAIL 280
            + +F+   + I+V  +A N   ++H           H      + P + L  +V+  + 
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLK 829

Query: 281 TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
           T A K+AK          + +   +N    IE N R
Sbjct: 830 TIAKKVAKAWNITGPFNMQVIKAGENDLKVIECNIR 865

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 65/160 (40%), Gaps = 17/160 (10%)

Query: 176 GYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEV 235
           GYPVII++AY              ++ +   ++ S A          VE+ L   K +E 
Sbjct: 183 GYPVIIRSAYALGGLGSGFANNPEELKELASQSLSLAPQV------LVEKSLRGWKEVEY 236

Query: 236 QLLADNHGNVIHLFERDCSVQR------RHQKVVEVAPAKTLPRDVRDAILTDAVKLAKE 289
           +++ D   N I +    C+++            +  AP++TL  +    + + A+K+ + 
Sbjct: 237 EVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRH 292

Query: 290 AGYRNAGTAEF-LVDNQNRHYFIEINPRIQVEHTITEEIT 328
            G       ++ L  N   +  IE+N R+     +  + T
Sbjct: 293 LGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKAT 332

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 224 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARM 257

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   + ++G + +GI D  G   P     LI ++++      I  H H+  G A+A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DV++  +        +  L+A +
Sbjct: 225 YTALEGGARLIDVSVLGIGERNGITPLGGLMARM 258

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 69/178 (38%), Gaps = 27/178 (15%)

Query: 163 KTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC- 221
           +TV+EA        YPVI+++AY               +G  F    SE K         
Sbjct: 171 ETVDEALEAAERVKYPVIVRSAY-----------ALGGLGSGFANNASEMKELAAQSLSL 219

Query: 222 ----FVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEV------APAKTL 271
                VE+ L   K +E +++ D  GN I +    C+++      V        AP++TL
Sbjct: 220 APQILVEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTL 275

Query: 272 PRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 328
             +    + + A+K+ +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 276 SDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 333

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 63/156 (40%), Gaps = 5/156 (3%)

Query: 162 IKTVEEAEAFVAEYGYPVIIKAAYXXXXXXXXXXXXXXDIGDAFQRATSEAKTAFGNGTC 221
           + +VEEA+ F ++  YPV+I+ +Y              ++      A+  +     +   
Sbjct: 714 LTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP----DHPV 769

Query: 222 FVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVE-VAPAKTLPRDVRDAIL 280
            + +F++  + I+V  +A N   ++H           H      V P + L  DV+ A+ 
Sbjct: 770 VMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALK 829

Query: 281 TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 316
             A K+AK          + + D ++    IE N R
Sbjct: 830 DIADKVAKAWKITGPFNMQIIKDGEHTLKVIECNIR 865

>Kwal_56.24401
          Length = 441

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 721 LEVTDKIVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASM 780
           L +   +  +G + +GI D  G   P     L+ +++       +  H H+  G A+A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 781 AACAFAGADVVDVAINSMSGMTSQASINALLASL 814
                 GA ++DVA+  +        +  L+A +
Sbjct: 238 YTALEGGAKLIDVAVLGIGERNGITPLGGLMARM 271

>Scas_712.17
          Length = 793

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 88  DEIIDIAKKHGVDFIHPGYGFLSENSEFADKV----QKAGITWIGPPPEVIESVGDKVSA 143
           D + + A  H ++ + PG           D +     K GI   GP  +V +  G KV +
Sbjct: 61  DALREFALNHDINLVIPG-----PEQPLVDGITTIFNKVGIPVFGPSAKVAQLEGSKVFS 115

Query: 144 RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKA 183
           +    K  +PT           E+A+ ++AE  Y V++KA
Sbjct: 116 KRFMDKHGIPT--AKYASFTDFEKAKKYLAEVDYNVVLKA 153

>Kwal_23.4958
          Length = 649

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 52/122 (42%), Gaps = 19/122 (15%)

Query: 814 LDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADLKGPDPE---------------VYDH 858
           L  E+ +G   + ++ L +Y     LL S +  + K PD +               V +H
Sbjct: 423 LTYEVKSGFLERRSKFLKSYTKGFYLLTSSYLHEFKTPDRKRDLVPVMSLSLNDCTVAEH 482

Query: 859 EIPGGQLTNLLFQAQQLGL---GEKWIETKRAYKEANHLLGDIVKVTPTSKVVGDLAQFM 915
              G      +  A+Q G+   G  W+    +Y+   +   D+ K+T TS  + + A+F+
Sbjct: 483 SKKGSSDYKFILHAKQNGIIHRGHNWVFRAESYESMLNWFEDLKKLTSTSSPI-EKAKFV 541

Query: 916 VT 917
           ++
Sbjct: 542 LS 543

>YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochondrial
            GTPase involved in expression of COX1/OXI3 [1581 bp, 526
            aa]
          Length = 526

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 1015 QKMKELYGDLSVLPTKNFLAPPSI-GEDI-EVHLEQGKTLIIK-LQAVGDLNKETGMRDV 1071
            QK  ++  D S+L    F AP S  GED+ E+H+  GK ++   L+A+G L+  +  +D+
Sbjct: 99   QKESKILLDTSLLLY--FQAPYSFTGEDVLELHVHGGKAVVNSILKAIGSLHDRSSGKDI 156

Query: 1072 YFELNGEMRK 1081
             F L G+  +
Sbjct: 157  RFALPGDFSR 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,766,041
Number of extensions: 1446518
Number of successful extensions: 3778
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3787
Number of HSP's successfully gapped: 94
Length of query: 1162
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1049
Effective length of database: 12,684,275
Effective search space: 13305804475
Effective search space used: 13305804475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)