Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06919g25024612800.0
Scas_628.62522447671e-103
CAGL0F06897g2582447214e-96
YIR035C2542467127e-95
ACR171C2512467065e-94
YIR036C2632556772e-89
Scas_685.82522466674e-88
ABR247W2502424782e-59
ABR249W2502434591e-56
ABR246W2502454554e-56
ABR248W2612434401e-53
Sklu_2380.41601564276e-53
KLLA0E08063g1861443773e-45
KLLA0E08052g1171023662e-44
KLLA0E09834g2681921977e-18
AFR561W2671921942e-17
YMR226C2671931891e-16
KLLA0B08371g2681921741e-14
AER373C3002381723e-14
Scas_594.122671941704e-14
Kwal_55.195692881961626e-13
Kwal_26.91602671921591e-12
Kwal_34.160242921971573e-12
Sklu_1578.32681921503e-11
Kwal_14.24442881911477e-11
Sklu_2348.52891921442e-10
KLLA0E24046g2802091414e-10
Sklu_268.12441901395e-10
CAGL0J04774g3382441408e-10
KLLA0D15521g2561961371e-09
Scas_662.43072451362e-09
CAGL0M11242g2681921334e-09
Kwal_27.121552802521301e-08
KLLA0D18909g2901931292e-08
KLLA0D02596g3471931292e-08
Kwal_47.171022852231282e-08
Scas_666.17*2832491282e-08
AAL089W3282181273e-08
YNL202W (SPS19)2951901264e-08
YKL071W2562021254e-08
CAGL0G08690g2942401255e-08
KLLA0D06127g3302181256e-08
Kwal_14.15112772251247e-08
CAGL0H10450g3112061247e-08
Kwal_55.218222832231221e-07
KLLA0F04455g3052451221e-07
KLLA0E13860g8891911232e-07
CAGL0H08063g2901901175e-07
AER111W3271911176e-07
Sklu_2267.53501931186e-07
KLLA0E22495g2921991141e-06
AEL164C3071901132e-06
YLR426W3262251132e-06
YIL124W (AYR1)2971931122e-06
Scas_613.182862111105e-06
Sklu_2420.53262171096e-06
KLLA0C12694g2592391087e-06
ABL163W2921911061e-05
ADL292C3292251043e-05
Kwal_26.88383232141034e-05
Scas_655.192971981016e-05
AGL060W8912111027e-05
Sklu_2219.33632221001e-04
CAGL0K09152g327216963e-04
Scas_675.10312197954e-04
Scas_478.2920145964e-04
YOR246C330224938e-04
YDL114W308196928e-04
YKL055C (OAR1)278233920.001
Sklu_1570.1756210930.001
YBR265W (TSC10)320209910.001
YKR009C (FOX2)900203900.002
Scas_652.19d341222890.002
Scas_721.47344178880.003
Kwal_14.2598311206880.003
Kwal_26.7950897142870.005
KLLA0F01749g313204860.006
CAGL0L02167g901155850.009
Scas_650.8326219790.036
KLLA0A11352g31444780.055
KLLA0E17083g51477770.089
KLLA0B09812g346173750.13
Kwal_34.16139315222740.16
CAGL0H07513g35265720.29
Scas_652.19d1344151720.29
Scas_566.11346120710.38
CAGL0M11506g348115710.44
Kwal_26.8282298230690.72
Scas_641.31287131680.93
KLLA0F19756g346118681.0
YLR100W (ERG27)347250671.1
Kwal_56.2386334473671.3
KLLA0C19547g33345643.1
Kwal_14.165368890643.7
CAGL0J05852g34397625.4
YBR159W34789625.4
Scas_620.1337826609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06919g
         (246 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   497   0.0  
Scas_628.6                                                            300   e-103
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   282   4e-96
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   278   7e-95
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   276   5e-94
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   265   2e-89
Scas_685.8                                                            261   4e-88
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   188   2e-59
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   181   1e-56
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   179   4e-56
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   174   1e-53
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          169   6e-53
KLLA0E08063g complement(726232..726792) some similarities with s...   149   3e-45
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   145   2e-44
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    80   7e-18
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    79   2e-17
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    77   1e-16
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    72   1e-14
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    71   3e-14
Scas_594.12                                                            70   4e-14
Kwal_55.19569                                                          67   6e-13
Kwal_26.9160                                                           66   1e-12
Kwal_34.16024                                                          65   3e-12
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            62   3e-11
Kwal_14.2444                                                           61   7e-11
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       60   2e-10
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    59   4e-10
Sklu_268.1 , Contig c268 57-791 reverse complement                     58   5e-10
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    59   8e-10
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    57   1e-09
Scas_662.4                                                             57   2e-09
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    56   4e-09
Kwal_27.12155                                                          55   1e-08
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    54   2e-08
KLLA0D02596g join(complement(219682..219797),complement(218659.....    54   2e-08
Kwal_47.17102                                                          54   2e-08
Scas_666.17*                                                           54   2e-08
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    54   3e-08
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    53   4e-08
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    53   4e-08
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    53   5e-08
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    53   6e-08
Kwal_14.1511                                                           52   7e-08
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    52   7e-08
Kwal_55.21822                                                          52   1e-07
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    52   1e-07
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    52   2e-07
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    50   5e-07
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    50   6e-07
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            50   6e-07
KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candid...    49   1e-06
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    48   2e-06
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    48   2e-06
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    48   2e-06
Scas_613.18                                                            47   5e-06
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        47   6e-06
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    46   7e-06
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    45   1e-05
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    45   3e-05
Kwal_26.8838                                                           44   4e-05
Scas_655.19                                                            44   6e-05
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    44   7e-05
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         43   1e-04
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    42   3e-04
Scas_675.10                                                            41   4e-04
Scas_478.2                                                             42   4e-04
YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member...    40   8e-04
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    40   8e-04
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    40   0.001
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             40   0.001
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    40   0.001
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    39   0.002
Scas_652.19d                                                           39   0.002
Scas_721.47                                                            39   0.003
Kwal_14.2598                                                           39   0.003
Kwal_26.7950                                                           38   0.005
KLLA0F01749g complement(163821..164762) similar to sp|P38342 Sac...    38   0.006
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    37   0.009
Scas_650.8                                                             35   0.036
KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pic...    35   0.055
KLLA0E17083g 1512395..1513939 similar to sgd|S0002738 Saccharomy...    34   0.089
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    33   0.13 
Kwal_34.16139                                                          33   0.16 
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    32   0.29 
Scas_652.19d1                                                          32   0.29 
Scas_566.11                                                            32   0.38 
CAGL0M11506g 1134645..1135691 highly similar to sp|Q12452 Saccha...    32   0.44 
Kwal_26.8282                                                           31   0.72 
Scas_641.31                                                            31   0.93 
KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomy...    31   1.0  
YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol redu...    30   1.1  
Kwal_56.23863                                                          30   1.3  
KLLA0C19547g 1750548..1751549 some similarities with tr|Q55924 S...    29   3.1  
Kwal_14.1653                                                           29   3.7  
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    28   5.4  
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    28   5.4  
Scas_620.13                                                            28   9.8  

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  497 bits (1280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
           DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK
Sbjct: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120

Query: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180
           TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV
Sbjct: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180

Query: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240
           VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE
Sbjct: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240

Query: 241 YVRYND 246
           YVRYND
Sbjct: 241 YVRYND 246

>Scas_628.6
          Length = 252

 Score =  300 bits (767), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           KV++VTG SRGIG AIV  I+ L+SNAVV+GIAR    LK LK   G +F Y+ GD+T++
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
             + +++   + + GR+DS+VANAGVLEPVA+VG      WK+L+DINFFSI+ L+  TL
Sbjct: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVD 182
           P +E +  N +FVSSGAS K Y+GW AY +SKAA+N   MS+A E   +KTI+VAPGVVD
Sbjct: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183

Query: 183 TKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYV 242
           T+MQ DIR+K+G + MT ++LKRF DL KNGELLD+DVPG++YA+LAV+GIP ELNG+Y 
Sbjct: 184 TQMQVDIREKYG-NEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242

Query: 243 RYND 246
           RYND
Sbjct: 243 RYND 246

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  282 bits (721), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 183/244 (75%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61
           +KV+LVTG SRGIG++IV  + +LD N +VYGIAR+E  LK+LKDT G RF Y  GDIT+
Sbjct: 6   QKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITN 65

Query: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKT 121
           +D + + V   +   G+I+S++ANAGVLEPV  + +  V  WK+LY+INFFSI+ L++  
Sbjct: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIA 125

Query: 122 LPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
           LPHL+K+ G+A+FVSS AS   +  W AYGSSKAA+NH  M+LA E KA++ +AVAPG+V
Sbjct: 126 LPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185

Query: 182 DTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEY 241
           DT MQ +IR+  GP GM+ + L+ F DLKK+ +LL + +P  +Y++LA++GIP E+NG+Y
Sbjct: 186 DTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQY 245

Query: 242 VRYN 245
           + ++
Sbjct: 246 LSFD 249

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  278 bits (712), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 176/246 (71%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           M KV+LVTG SRGIG++IV  + +LD + VVYG+AR+E  LK LK+  G RF Y+ GDIT
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
           ++  + ++V   V   G+IDS+VANAGVLEPV  V    V  WKKLYDINFFSI+ L+  
Sbjct: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

Query: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180
            LP L+K+ GN +FVSS A    +  W AYGSSKAA+NH  M+LA E + +K IAVAPG+
Sbjct: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180

Query: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240
           VDT MQ +IR+  GPS M+A+ LK F  LK+N +LLD+ VP  +YA+LA+ GIP  +NG+
Sbjct: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240

Query: 241 YVRYND 246
           Y+ YND
Sbjct: 241 YLSYND 246

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  276 bits (706), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 132/246 (53%), Positives = 181/246 (73%), Gaps = 3/246 (1%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           M ++++VTG SRGIG ++V+ +     + VV G+AR+E AL+ L+ T G +F+Y+ GD+ 
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKV-CRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
            ED  + +V +     GRID++VANAGVLEPV  V    VA W++LY++NFFS++ L+ +
Sbjct: 60  SEDAQDALVARAT-AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118

Query: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180
            LP L+K+ G+ +FVSSGASTK Y  W AYGSSKAA+NH  M+LAAE  A++ +AVAPGV
Sbjct: 119 ALPLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGV 178

Query: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240
           VDT+MQ+DIRDKFG   M  +AL+RFT+LKKN ELLD  +P  I+A LA+ GIP   NG+
Sbjct: 179 VDTQMQNDIRDKFG-HRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGK 237

Query: 241 YVRYND 246
           Y+RYND
Sbjct: 238 YLRYND 243

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  265 bits (677), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 175/255 (68%), Gaps = 9/255 (3%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGA-RFQYLAGDI 59
           M KV+L+TGASRGIG  +VK ++  D   +VYG+AR E  L+SL+   GA +F Y   DI
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 60  TDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS----VAEWKKLYDINFFSII 115
           TD  ++  +VE++  + G++D IVANAG+LEPV  +  S+    + +W++L+D+NFFSI+
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 116 HLINKTLPHLEKSE--GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--I 171
            L+   LP L+ S   GN +FVSSGAS KPY GW AYG SKAA+NH  M +A+E  +  +
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

Query: 172 KTIAVAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVS 231
           + + +APGVVDT+MQ DIR+  GP GMT  AL+RFT L K   LLD  VP  + A+L + 
Sbjct: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240

Query: 232 GIPAELNGEYVRYND 246
           GIP  LNG+Y+RYND
Sbjct: 241 GIPDSLNGQYLRYND 255

>Scas_685.8
          Length = 252

 Score =  261 bits (667), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 125/246 (50%), Positives = 181/246 (73%), Gaps = 1/246 (0%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           M KV++VTG SRGIG++IV+ I  L S+A+VYGIAR+E  LK+LK+T G RF Y+ GDIT
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
           D+  + ++V+    EQG+IDS+VANAGVLEPV  V    +  WKKL+DINFFS++ L + 
Sbjct: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120

Query: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180
           TLP+L+K+ GN +FVSS AS   +  W AY +SKA +N   M++A E  A+K ++VAPG+
Sbjct: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180

Query: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240
           VDT MQ +IR+  G   MT++    F DLK++ +LLD++VP  +Y++LA++GIP ++NG+
Sbjct: 181 VDTSMQVNIRENVGKD-MTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGK 239

Query: 241 YVRYND 246
           Y+ ++D
Sbjct: 240 YLSFDD 245

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  188 bits (478), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 152/242 (62%), Gaps = 6/242 (2%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           +VV+VTGASRGIGEA V+  L   ++ VV G+AR E  L+ LK   G +F Y+ GD+TDE
Sbjct: 2   RVVIVTGASRGIGEATVEK-LCPTADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
             +  +++KV  E GR+D++VANAGV     ++ ++ + EW++L++IN FS+++L++K L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVD 182
           P L +S+G  I VSSG S   +    AY SSK A+NH  + LA E   I+TIA+ PG V 
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQ 179

Query: 183 TKM-QDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEY 241
           T M  + I      +G   +A++   +L K   +   + PG + A LA  GIP ELNG+Y
Sbjct: 180 TDMLAEGINAADEAAGSQDNAVR---ELLKQVRVATPEEPGAVLAALAARGIPEELNGKY 236

Query: 242 VR 243
           VR
Sbjct: 237 VR 238

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  181 bits (459), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 147/243 (60%), Gaps = 4/243 (1%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           KV++VTGASRGIG A V  + +   + VV G+AR E  L+ LK   G +F Y+ GD+TDE
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS-TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
             +  +++KV  E GR+D++VANAGV     ++  + + EW++L++IN FS+++L +K L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVD 182
           P L KS+G  I V+SG S   +    AY SSK A+NH  + LA E   I+++A+ PG+V 
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQ 179

Query: 183 TKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYV 242
           T M          +  T D   R  +L K   ++  + PG + A LA  GIP ELNG+YV
Sbjct: 180 TDMTAAALVAADKAAGTQDNSVR--ELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYV 237

Query: 243 RYN 245
            ++
Sbjct: 238 TFD 240

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  179 bits (455), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 150/245 (61%), Gaps = 5/245 (2%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           M +V++VTGASRGIGEA V+  L    + VV G+AR E  LK LK+  G++F Y+AGD+T
Sbjct: 1   MVRVIIVTGASRGIGEATVEK-LCTAPDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVT 59

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
           DE  +  +++KV  + GR+D+I+ANAGV     ++  + + +WK+ ++I   S + L++K
Sbjct: 60  DESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSK 117

Query: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180
            LP L KS+G  I V+SG S   Y    +  SSK A+NH    LAAE  A++ +AVAPGV
Sbjct: 118 ALPMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGV 177

Query: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240
           V T M  +  D    +    D    F  + K G ++  D PG + A LAV GIP ELNG 
Sbjct: 178 VRTDMTVEALDASEDAPGARDNF--FKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGR 235

Query: 241 YVRYN 245
           +V+++
Sbjct: 236 FVQFD 240

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  174 bits (440), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 143/243 (58%), Gaps = 4/243 (1%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           KV++VTGASRGIG A V  + +     VV G+AR E  L+ LK   G +F Y+ GD+TDE
Sbjct: 13  KVIIVTGASRGIGAATVDRLCS-TPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 71

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
             +  +++KV    GR+D++VANAGV     ++  + + EW++L++IN FS+++L +K L
Sbjct: 72  RVVQAVIDKVSSGYGRLDAVVANAGVAGH-ERIEDADIKEWRRLFEINLFSVVNLASKAL 130

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVD 182
           P L KS+G  + VSS  S         Y SSK A+NH  M LA E   I+TIA+ PGV  
Sbjct: 131 PLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDPGVAQ 190

Query: 183 TKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYV 242
           T M  D  +    +  T D   R  ++ ++  +   D PG + A LA  GIP ELNG++V
Sbjct: 191 TDMLTDGLNAADQAAGTQDNAAR--EMMRHVRVASPDEPGTVLAALAAKGIPEELNGKFV 248

Query: 243 RYN 245
            Y+
Sbjct: 249 VYD 251

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  169 bits (427), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 116/156 (74%), Gaps = 5/156 (3%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNA--VVYGIARNEDALKSLKDTVGARFQYLAGD 58
           M KVVLVTGASRGIG+AIV N L  D N+  VV GIAR+E  L ++K   G +F+Y+ GD
Sbjct: 1   MAKVVLVTGASRGIGQAIVNN-LCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGD 59

Query: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
           I+DE+ + + VE  + + GRID++VANAGVLEPV  V +  VA+WK+L+D+NFFSI+ L+
Sbjct: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLV 119

Query: 119 NKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSK 154
           + +LPHL+K  GN +FVSSGASTKPY   C  G S+
Sbjct: 120 SLSLPHLKKFNGNIVFVSSGASTKPYV--CIMGRSR 153

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  149 bits (377), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 102/144 (70%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60
           M KV LVTG SRGIG +IV+ + ++++  +V GIAR++D L+ LK     +F Y+ GD++
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120
           DE+ I E V  +  +  R+D IVANAGVL+PV  V +  +++WK+L+DINFFS++ L+  
Sbjct: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120

Query: 121 TLPHLEKSEGNAIFVSSGASTKPY 144
            LP L++S GN + VSSGASTK Y
Sbjct: 121 ALPLLKQSNGNIVLVSSGASTKSY 144

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  145 bits (366), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 80/102 (78%)

Query: 145 YGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADALK 204
           YGW AYG+SKAA+NH   ++AAE  A+K I+VAPGVV TKMQ+DIR+ FGPSGMT +AL+
Sbjct: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQ 67

Query: 205 RFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYVRYND 246
           RF DL  N +LL   VPG IYA LA  GIP+EL+G Y+RYND
Sbjct: 68  RFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYND 109

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 80.5 bits (197), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 16/192 (8%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGAR---FQYLAGD 58
           K+V+L+TGAS GIG +I + + +  +   V+G +R        K ++  +   F+ +  D
Sbjct: 3   KQVILITGASTGIGLSIAETLRS--AGYEVFGTSR--------KGSIPGKEYSFKMIKLD 52

Query: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
           ITDE+ +   V +V+ + GRID +V NAG+    A V   S    K +++ NFF +  + 
Sbjct: 53  ITDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMT 112

Query: 119 NKTLPHL-EKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENK--AIKTIA 175
              LPH+ E+  G  I +SS     P      Y SSK A+   T SL  E K   I    
Sbjct: 113 RAVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHVST 172

Query: 176 VAPGVVDTKMQD 187
           + P ++ T M +
Sbjct: 173 IDPHIIKTGMAN 184

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 79.3 bits (194), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 98/192 (51%), Gaps = 9/192 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNIL-ALDSNAVVYGIARNEDALKSLKDTV-----GARFQYLA 56
           K+VLVTGAS GIG A   N   A D    +  +AR  + L SLK  +      A+     
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 57  GDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
            D+T  D+I   +E +  E   ID ++ NAG      +VG  S+ + +++++ N   ++H
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 117 LINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173
           L  + LP ++ K+ G+ + V S A  + Y G   Y ++K AV   T ++  E  +  I+ 
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRV 193

Query: 174 IAVAPGVVDTKM 185
             +APG V+T+ 
Sbjct: 194 FEIAPGSVETEF 205

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 77.4 bits (189), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 99/193 (51%), Gaps = 9/193 (4%)

Query: 2   KKVVLVTGASRGIGEAIVKNIL-ALDSNAVVYGIARNEDALKSLKDTVGARFQ----YLA 56
           KK VL+TGAS GIG+A     L A + +  +   AR  + L+ LK T+   F     ++A
Sbjct: 13  KKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVA 72

Query: 57  G-DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSII 115
             DIT  +KI   +E +  E   ID +V NAG      +VG  +  + + ++D N  ++I
Sbjct: 73  QLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALI 132

Query: 116 HLINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIK 172
           ++    LP  + K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I+
Sbjct: 133 NITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIR 192

Query: 173 TIAVAPGVVDTKM 185
            I +APG+V+T+ 
Sbjct: 193 VILIAPGLVETEF 205

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 95/192 (49%), Gaps = 9/192 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNIL-ALDSNAVVYGIARNEDALKSLKDTVGARFQ----YLAG 57
           K + +TGAS GIG+A     L A + N  +   AR    L+ LK+ + A +     Y+  
Sbjct: 14  KTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIGQ 73

Query: 58  -DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
            D+T+ +KI   ++ +  E   ID ++ NAG       VG+ S  + K + D N  ++I+
Sbjct: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133

Query: 117 LINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173
           +    LP  + K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I+ 
Sbjct: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193

Query: 174 IAVAPGVVDTKM 185
           I +APG V+T+ 
Sbjct: 194 IEIAPGNVETEF 205

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 70.9 bits (172), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 13/238 (5%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGA-RFQYLAGDITD 61
           KVVLVTGAS GIG  + K +   +   VVY  AR+ + +++L+D  G  +   +  D+TD
Sbjct: 15  KVVLVTGASSGIGYELTKEL--ANRGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVTD 72

Query: 62  EDKINEIVEKVVLE--QGRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
           E+++ ++  ++  E   G++ ++  NAG     P   V    +   +K + +N F+ +++
Sbjct: 73  EEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAVDVTPEMI---EKCFRVNVFAPMNI 129

Query: 118 INKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIA 175
             +  P L ++ G  +F  S A   P+     Y ++KAAV+     L  E K   ++ I 
Sbjct: 130 TREFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGVRVIN 189

Query: 176 VAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGI 233
              G V T + D            A+    F + ++      + +P  +YAR  VS +
Sbjct: 190 AVTGGVATNIADTRPLPKSSVYNFAEGKAAFAERQRMAS-RSSPMPAPVYARKLVSDL 246

>Scas_594.12
          Length = 267

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 11/194 (5%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAV-VYGIARNEDALKSLKDTVGARFQ----YLA 56
           +K+V +TGAS GIG+A     +   +  V +  +AR  + L+ LK+ + A++     Y+ 
Sbjct: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72

Query: 57  G-DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSII 115
             D+T+ + I   ++ +  E   ID ++ NAG      +VG   + + K + D N   +I
Sbjct: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132

Query: 116 HLINKTLPHL--EKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAI 171
           ++    L H+  +K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I
Sbjct: 133 NVTQAVL-HIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191

Query: 172 KTIAVAPGVVDTKM 185
           + I +APG+V+T+ 
Sbjct: 192 RVILIAPGIVETEF 205

>Kwal_55.19569
          Length = 288

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 98/196 (50%), Gaps = 15/196 (7%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE--DALKSLKDTVGARFQYLAGDIT 60
           KV  ++GAS GIG A+        ++  V+  + ++     K L +T G R +     +T
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKCPVT 98

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLE---PVAKVGSSSVA--EWKKLYDINFFSII 115
           DE K+ E + +V  +  +ID  VANAGV     P+ +     VA  EW+K+++ +F   +
Sbjct: 99  DEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNTDFQG-V 157

Query: 116 HLINKTLPHLEKSEGNAIFVSSGASTK-----PYYGWCAYGSSKAAVNHLTMSLAAENKA 170
           +  +K +  + K +G    V + + +      P    C Y ++KA V HL+ SLA E   
Sbjct: 158 YYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQAC-YNAAKAGVIHLSRSLAVEWAG 216

Query: 171 IKTI-AVAPGVVDTKM 185
              + +++PG +DT +
Sbjct: 217 FARVNSISPGYIDTPI 232

>Kwal_26.9160
          Length = 267

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 93/192 (48%), Gaps = 9/192 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNIL-ALDSNAVVYGIARNEDALKSLKDTVGARFQ----YLAG 57
           K VL+TGAS GIG+A     L A + N  +   AR  + LK +K      F     Y+  
Sbjct: 14  KTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIGQ 73

Query: 58  -DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
            D+T  D+I   ++ +  E   ID ++ NAG       VG+   ++ + +   N  ++I+
Sbjct: 74  LDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALIN 133

Query: 117 LINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173
           +    LP  + K+ G+ + + S A  + Y     Y ++K AV   T SL  E  N  I+ 
Sbjct: 134 MTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRKELINTNIRV 193

Query: 174 IAVAPGVVDTKM 185
           I +APG V+T+ 
Sbjct: 194 IEIAPGNVETEF 205

>Kwal_34.16024
          Length = 292

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 18/197 (9%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           K+V+VTGA+  IG AI +   +  ++  V     + D    L    G   +    DIT++
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQVDITND 99

Query: 63  DKINEIVEKVV--LEQGRIDSIVANAGVLEPVAKV--GSSSVAEWKKLYDINFFSIIHLI 118
           + +   ++ V        ID+ +ANAGV      V   S++   W+++ D+N     H  
Sbjct: 100 EDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTFHCA 159

Query: 119 NKTLPHLEKSEGNAIFV-----SSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--- 170
            + + H+ K +G+   +     SS  +  P Y  C Y +SKAAV H+    A E      
Sbjct: 160 QE-VAHVFKRQGHGCLILTASMSSHIANVPNYQTC-YNASKAAVRHMARGFAVEFAHLTE 217

Query: 171 ----IKTIAVAPGVVDT 183
               I+  +V+PG  DT
Sbjct: 218 PAGRIRCNSVSPGYTDT 234

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 92/192 (47%), Gaps = 9/192 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGI-ARNEDALKSLKDTVGARFQ----YLAG 57
           K V +TGAS GIG+A         +  +   + AR  + L+ LKD +   +     Y+  
Sbjct: 14  KTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYIGV 73

Query: 58  -DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
            D+T+ +KI   ++ +  E   ID ++ NAG       VG+    + + + + N  ++I+
Sbjct: 74  LDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLALIN 133

Query: 117 LINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173
           +    LP  + K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I+ 
Sbjct: 134 ITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSLRKELVNTNIRV 193

Query: 174 IAVAPGVVDTKM 185
           I +APG V+T+ 
Sbjct: 194 IEIAPGNVETEF 205

>Kwal_14.2444
          Length = 288

 Score = 61.2 bits (147), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 91/191 (47%), Gaps = 11/191 (5%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           KV +VTGAS GIG  + + + +      VY  AR E  L++L          +  D+++ 
Sbjct: 5   KVAVVTGASSGIGYELTRQLAS--KGYKVYAAARREQRLETLAKEFPELVVPVKLDVSEP 62

Query: 63  DKINEIVEKVV--LEQGRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
           ++I  + E++   L   ++D +  NAG     P + V +  +   ++ + +N F  ++L 
Sbjct: 63  EQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTNDVL---EQAFKVNVFGPVNLC 119

Query: 119 NKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIAV 176
            + LP + K++G  +F  S A   P+     Y ++K A++     L  E K   ++ + V
Sbjct: 120 KELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGVRVLNV 179

Query: 177 APGVVDTKMQD 187
             G V T + D
Sbjct: 180 VTGGVKTDIAD 190

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 86/192 (44%), Gaps = 11/192 (5%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61
           KKV LVTGAS GIG  I K  L       VY  AR    +K L++    +   ++ D++D
Sbjct: 4   KKVALVTGASSGIGYEITK--LLASKGYTVYAAARRTTPIKPLEEEFPEKVIAVSLDVSD 61

Query: 62  EDKINEIVEKVV--LEQGRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
             +I ++  +    L   ++  +  NAG     P   VG+  +   ++ + +N F  ++L
Sbjct: 62  LQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGNDKI---EQCFKVNVFGPMNL 118

Query: 118 INKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIA 175
             +    +  + G  +F  S A   P+     Y S+KAA++     L  E K   +K I 
Sbjct: 119 CREMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKPFGVKVIN 178

Query: 176 VAPGVVDTKMQD 187
              G V T + D
Sbjct: 179 AITGGVATNIAD 190

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 21/209 (10%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVY---GIARNEDALKSLKDTVGARFQYLAGDI 59
           KV +VTGAS GIG A+ + +    ++  V+     A  E A++ L      +       +
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAVE-LSAKYNVKVVAYQCPV 89

Query: 60  TDEDKINEIVEKVVLEQGRIDSIVANAGV------LEPVAKVGSSSVAEWKKLYDINFFS 113
           T+E K+ + +E V+ E G+ID  +ANAGV      L   A+ G+ +  EW K+   +F  
Sbjct: 90  TEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDT-DEWNKVIHTDFNG 148

Query: 114 IIHLINKTLPHLEKSEGNAIFVSSGASTK----PYYGWCAYGSSKAAVNHLTMSLAAENK 169
           + +         ++    ++ +++  S      P    C Y ++KA V H   SLA E  
Sbjct: 149 VYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQAC-YNAAKAGVIHFAKSLAVEWA 207

Query: 170 AIKTI-AVAPGVVDTKMQ----DDIRDKF 193
               +  V+PG + T +     +D+++K+
Sbjct: 208 GFARVNTVSPGYIATPISNFVDEDLKNKW 236

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 88/190 (46%), Gaps = 9/190 (4%)

Query: 5   VLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTV--GARFQYLAGDITDE 62
           V+VTGA+ GIG+AIV     L   A V     NE AL  LK+++           D+   
Sbjct: 7   VIVTGAASGIGKAIVNQ--CLQEGASVIACDLNEQALLVLKESLNDSTVLDTYPMDVRKY 64

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAK-VGSSSVAEWKKLYDINFFSIIHLINKT 121
           +++      V  E   +D +V NAG+   +AK +      E  K+ DIN    I+     
Sbjct: 65  EEVAAFFAYVETEHSDVDGLVNNAGIY--LAKHILDYQEDEIDKVLDINVKGYIYFSQMF 122

Query: 122 LPHLEKSEGNAIFVS-SGASTKPYYGWCAYGSSKAAVNHLTMSLAAE-NKAIKTIAVAPG 179
              L  S+   + V+ S  S +       YGSSKAA+  LT S A   +  I+  AVAP 
Sbjct: 123 GKKLFHSQRKGVIVNLSSVSGQEGSSDAIYGSSKAAILGLTKSCAMNFSPYIRVNAVAPT 182

Query: 180 VVDTKMQDDI 189
           +V+T M D I
Sbjct: 183 MVNTSMMDSI 192

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 105/244 (43%), Gaps = 14/244 (5%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDED 63
           +VL+TG S G+G  I+  +L   +N  V  +  +            AR   +  D+ + D
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNNIKVINLDLDVQYWSE-----EARVINIECDLVNAD 125

Query: 64  KINEIVEKVVLE-QGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
            +   ++K+ LE + +I+ ++ NAGV         + + E +++ +IN +S   ++   +
Sbjct: 126 GLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQAII 185

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA-----IKTIAVA 177
           P   + +   + +SS           +Y +SKAA+  L  S+  +        I+T+ V 
Sbjct: 186 PRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTNDFLVRGIGNIRTLLVL 245

Query: 178 PGVVDTKMQDDI---RDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIP 234
           PG +DT+M D     R  + P    A   +   D  +NG       P   Y    + GIP
Sbjct: 246 PGQIDTQMFDGFPPPRKFWAPIVCPAALAEAIIDHCENGLRGTLRTPLYSYFPEFLMGIP 305

Query: 235 AELN 238
             L 
Sbjct: 306 YLLQ 309

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 93/196 (47%), Gaps = 14/196 (7%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLK---DTVGARFQYLAGDI 59
           K+ LVTGAS G+GE I + +    +  V+   +R+   ++      D  G+R      D+
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGATVVI--TSRHLSEVQETAGNIDPSGSRVIGKEVDV 66

Query: 60  TDEDKINEIVEKVVLEQGRIDSIVANAGVLEP-VAKVGSSSVAEWKKLYDINFFSIIHLI 118
           T    + ++++++  E G +  +V NAG+  P    +    +  W+++ D N     + +
Sbjct: 67  TVAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTFYTL 126

Query: 119 NKTLPHLEK-----SEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAI 171
              LP +E      SE   + +S+        G   Y ++K AV  +T S+A E   + +
Sbjct: 127 KYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYAERNV 186

Query: 172 KTIAVAPGVVDT-KMQ 186
           +  AVAPG V T K+Q
Sbjct: 187 RVNAVAPGYVSTPKIQ 202

>Scas_662.4
          Length = 307

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 110/245 (44%), Gaps = 33/245 (13%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIAR---------NEDALKSLKDTVGARF 52
           +K  +VTGAS GIG  I K +    +  +VY  AR         N+ A +   +   A  
Sbjct: 9   RKTAIVTGASSGIGYEITKELAR--NGFIVYACARRLGPIDDLINDLAPELTTELAKAVI 66

Query: 53  QYLAGDITDEDKINEIVEKVVLEQ----GRIDSIVANAG--VLEPVAKVGSSSVAEWKKL 106
           +    DI+ ED++ +   +V LE+    G++D +  NAG     P   V ++ V E  + 
Sbjct: 67  KPYQLDISKEDEVKQF--RVFLEKELPNGKLDLLYNNAGQSCTFPALDV-TNDVME--QC 121

Query: 107 YDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAA 166
           + +N F  +++  +   +L ++ G  +F  S A   P+     Y ++KAA++     L  
Sbjct: 122 FKVNVFGHVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHL 181

Query: 167 ENKA-------IKTIAVAPGVVDTK-MQDDIRDKFGPSGMTADALKRFTDLKKNGELLDA 218
           E K        + T  VA  + DT+ + DD    F P G  A   ++   + KN   + A
Sbjct: 182 EMKPFGVRVINVVTGGVATNIADTRPLPDDSVYNF-PEGRKAFEYRQ--SMAKNHHPMPA 238

Query: 219 DVPGK 223
           DV  K
Sbjct: 239 DVYAK 243

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 90/192 (46%), Gaps = 9/192 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAV--VYGIARNEDALKSLKDTVG----ARFQYLA 56
           K+  +TGAS GIG+A     L   + +V  V G  R E   +  K+ +     A+     
Sbjct: 14  KIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIHIGK 73

Query: 57  GDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
            D+TD + + + +  +  E   ID ++ NAG      KVG     +   + + N  ++I+
Sbjct: 74  LDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALIN 133

Query: 117 LINKTLPHL-EKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173
           L    LP   +K+ G+ + + S A    Y     Y ++K AV   T SL  E  N  I+ 
Sbjct: 134 LTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELINTDIRV 193

Query: 174 IAVAPGVVDTKM 185
           I +APG+V+T+ 
Sbjct: 194 IEIAPGMVETEF 205

>Kwal_27.12155
          Length = 280

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 108/252 (42%), Gaps = 38/252 (15%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE--DALKSLKDTVGARFQYLAGDIT 60
           KV  ++GAS GIG A+ +      ++  V+  +     +  + L +T   R       + 
Sbjct: 31  KVACISGASSGIGAAVAEAFAQAGADLAVWYNSHPALVETARDLANTYHVRVVAYKCPVD 90

Query: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLE---PVAKVGSSSVA--EWKKLYDINFFSII 115
           DE ++   + +V+ E GRID  VANAGV     P+      SVA  EW ++   +F  + 
Sbjct: 91  DEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQTDFQGVY 150

Query: 116 HLINKTLPHLEKSEGNAIFVSSGASTK----PYYGWCAYGSSKAAVNHLTMSLAAENKAI 171
           +         ++ +  ++ V++  S      P     AY ++KAAV HL+ SLA E    
Sbjct: 151 YCSKYVGEVFQRQQHGSLVVTASMSGHVVNVPQLQ-AAYNAAKAAVVHLSRSLAVEWAGF 209

Query: 172 KTI-AVAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAV 230
             + +V+PG + T                   + +F DLK     L+    G+       
Sbjct: 210 ARVNSVSPGYIATP------------------ISKFADLKTRQRWLELTPVGR------- 244

Query: 231 SGIPAELNGEYV 242
            G+P EL G Y+
Sbjct: 245 EGVPRELVGAYL 256

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 92/193 (47%), Gaps = 22/193 (11%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVG-------ARFQYL 55
           KVV VTG +  I     + ++ L   AV+ G  RN +  +     +G       +     
Sbjct: 23  KVVFVTGGAGTICRVQTEAMVLLGCKAVIVG--RNPEKTRKTAHEIGQLVHDPHSCLPIS 80

Query: 56  AGDITDEDKINEIVEKVVLEQGRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFS 113
           + D+ + D+++E V+  + + GR+D ++A A    L     + S++   +K +  I+   
Sbjct: 81  SVDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAGNFLADFTHLSSNA---FKSVVSIDLLG 137

Query: 114 IIHLINKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLAAENK- 169
             + +    P L K++G+ +FVS   ST  YYG       G++KA ++ L+ +LA E   
Sbjct: 138 SFNTVKACFPELVKTKGSVLFVS---STLHYYGVPFQSHVGAAKAGIDALSNALAVEMGP 194

Query: 170 -AIKTIAVAPGVV 181
             ++   VAPG +
Sbjct: 195 LGLRFNCVAPGAI 207

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 91/193 (47%), Gaps = 17/193 (8%)

Query: 4   VVLVTGASRGIGEAIVKNILA--LDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61
           V ++TG S G+G  +VK++++   D   V+  +   +  L   KD    R ++L  D++ 
Sbjct: 85  VCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITKD----RIEFLRCDLSS 140

Query: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKT 121
           ++++   ++ +  +  ++D ++ NA +    +++      E  K++  N  S I LI   
Sbjct: 141 DEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAF 200

Query: 122 LPHLEKSEGNAIF----VSSGASTKPYYGWCAYGSSKAAV----NHLTMSLAAENKA-IK 172
             H +KS  N  +    ++S            Y +SKAA+       T  L  +N   ++
Sbjct: 201 --HPKKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAMNVR 258

Query: 173 TIAVAPGVVDTKM 185
           T+ V PG +DT+M
Sbjct: 259 TLLVLPGQMDTQM 271

>Kwal_47.17102
          Length = 285

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 96/223 (43%), Gaps = 18/223 (8%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDED 63
           V +VTG S G+G AIV+  L    N  +  +      ++  K +    + Y   D+++  
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLISL-----DIEPPKKSFPNVYHYTC-DLSNSS 87

Query: 64  KINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTLP 123
            +++ ++ V    G +  ++ NAG+          S     K++ +N F+ + L+ +  P
Sbjct: 88  DVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELSP 147

Query: 124 HL-EKSEGNAIFVSSGAS-TKPYYGWCAYGSSKAAVNHLTMSLAA---ENKAIKTIAVAP 178
              +  +  A+ V+S      P  G C YG+SKAA      + A    E   I+T+ V P
Sbjct: 148 KAGDLRQFYAVTVASALGVCAPARGSC-YGASKAAAIAFHEAWAQELDETSRIRTLLVTP 206

Query: 179 GVVDTKMQDDI---RDKFGP---SGMTADALKRFTDLKKNGEL 215
           G +DT M       R  F P     M A+ +     +   GEL
Sbjct: 207 GQLDTTMFGGFHPPRQFFAPLVNPSMLAEKIVENCRIGMRGEL 249

>Scas_666.17*
          Length = 283

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 113/249 (45%), Gaps = 31/249 (12%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDED 63
            V++TG S G+G AIV   L    N V      N D + S +D    R   +  D++++ 
Sbjct: 27  CVVITGGSHGLGHAIVVRFL----NKVPKITIINVDKISSPQD--DPRMVTIQCDLSNQV 80

Query: 64  KINEIVEKVVLEQG-RIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
           ++ + +  +  + G RI  I+ NAG+             E  +++ +N F+ +  +   +
Sbjct: 81  EMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQSLV 140

Query: 123 PHLEKSEGNAIFVSSGAST----KPYYGWCAYGSSKAAV--NHLTMSLAAENKA---IKT 173
           P  E S     ++ + AST     P      YG+SK+A+   H + S+  + +    I+T
Sbjct: 141 PE-ENSNDRQCYIVNVASTLGTLTP-AKVAGYGASKSALIAFHQSYSMELQTRRVSNIRT 198

Query: 174 IAVAPGVVDTKMQDDI---RDKFGPS---GMTADALKRFTDLKKNGELLDADVPGKIYAR 227
           + V PG ++T M       R  F P    G  AD + +  ++ + GEL   +VP   Y+ 
Sbjct: 199 LLVVPGQLNTAMFSGFEAPRQFFAPVVEIGTLADQIVQKCEMGERGEL---NVP--FYSN 253

Query: 228 LA--VSGIP 234
            A  + G+P
Sbjct: 254 FAHLLMGMP 262

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 90/218 (41%), Gaps = 43/218 (19%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARN----EDALKSLKDTVGARFQ---- 53
           +KV LVTG + GIG   V ++       +VY   RN      A+K +K     R +    
Sbjct: 19  RKVALVTGGNSGIGWYTVLHLYM--HGFIVYVGGRNSSRVHKAIKEIKQEAENRLETARQ 76

Query: 54  --------------YLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS 99
                         YL  D+TD   + +  +K   ++  +D ++ NAGV+    ++    
Sbjct: 77  DPHDELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYELTHDG 136

Query: 100 VAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSS--------------GASTKP-- 143
              ++     N+ S   L  + LP++++S G  + +SS                  +P  
Sbjct: 137 ---FEVQMQTNYVSHFLLTMRLLPYVKRSGGRVVTLSSIGHKIQFTYCPLDCHFDYRPNI 193

Query: 144 YYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
           ++ W  Y  +K A    T  LA ++  +  IAV PG+V
Sbjct: 194 FFTWLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYG--IARNEDALKSLKDTVGARFQYLA---G 57
           KV  VTG +  I     + ++ L   A + G    R E A K +      +   LA    
Sbjct: 28  KVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANV 87

Query: 58  DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
           D+ + +++   V+K V + G+ID ++A A     V    + S   +K + DI+     + 
Sbjct: 88  DVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFNT 146

Query: 118 INKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLAAE--NKAIK 172
               L  L+KS+G+ +FVS   +T  YYG       G++KA ++ L  +LA E     I+
Sbjct: 147 AKACLKELKKSKGSILFVS---ATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIR 203

Query: 173 TIAVAPGVVD 182
           +  +APG +D
Sbjct: 204 SNCIAPGAID 213

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 88/202 (43%), Gaps = 16/202 (7%)

Query: 6   LVTGASRGIGEAIVKNILALDSNAVVYGIARNEDAL---KSLKDTVGAR--FQYLAGDIT 60
            + G SRGIG  +VK + A   N V+  I R   +L   K ++D    R     +  D+T
Sbjct: 10  FIIGGSRGIGFNLVKILSASTGNTVITSI-RGSPSLPKNKQVEDLAKIRKNIHIVQLDLT 68

Query: 61  DEDKINEI---VEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
            ++ I  I   ++K     G ID  +A + V +   KV  +  + W   Y  N    I  
Sbjct: 69  KDESIGNIADEIKKTPFFLG-IDIFIACSAVSDSYYKVLETPKSVWLNHYSTNALGPILA 127

Query: 118 INKTLP-HLEKSEGNAIFVSSGASTKPYY---GWCAYGSSKAAVNHLTMSLAAENK--AI 171
           + K  P  L K      F+SS A +   +      AYG SKAA+N+   +L+ E K    
Sbjct: 128 LQKVYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLSFELKPEGF 187

Query: 172 KTIAVAPGVVDTKMQDDIRDKF 193
             +A  PG+V T M     D F
Sbjct: 188 TVVAFHPGMVSTDMGQYGLDHF 209

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 112/240 (46%), Gaps = 31/240 (12%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARF---QYLAGD 58
           +KV +VTGAS GIG  + K +        V+  AR    ++ L ++ G       +L  D
Sbjct: 7   RKVAVVTGASSGIGYEVTKEL--ARKGFKVFACARRTAPIEPLVNSFGKELIVPHHL--D 62

Query: 59  ITDEDKINEIVEKVV--LEQGRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFSI 114
           I++ D++ +  E +   L + ++D +  NAG     P   V S+ V E  + + +N F  
Sbjct: 63  ISELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDV-SNDVME--QCFKVNVFGH 119

Query: 115 IHLINKTLPHLEKSEGNAIFVSS--GASTKPYYGWCAYGSSKAAVNHLTMSLAAENK--A 170
           I++  +   +L  ++G  IF  S  G ST P+     Y ++KAA++    +L  E K   
Sbjct: 120 INMTRELAQYLINAKGTVIFTGSIAGFSTLPF--GSIYAATKAAIHEYARTLHLELKPFG 177

Query: 171 IKTIAVAPGVVDTKMQDDIRD-------KFGPSGMTADALKRFTDLKKNGELLDADVPGK 223
           ++ I    G V T + D  RD       KF P G+  DA +    + K+   + ADV  K
Sbjct: 178 VRVINAITGGVLTDIADK-RDLPEGSIYKF-PQGI--DAFRTRQTMAKDNHPMPADVYAK 233

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 90/218 (41%), Gaps = 43/218 (19%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYG---IARNEDALKSLKDTVGARF------- 52
           KV LVTG + GIG   V + L L    V  G    +R   A+K +K     R        
Sbjct: 20  KVALVTGGNSGIGYYTVLH-LYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEK 78

Query: 53  -------------QYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS 99
                        +YL  D+TD + + +   K  +++  +D ++ NAGV+    ++   +
Sbjct: 79  PHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKDN 138

Query: 100 VAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSS------------GAS----TKP 143
              ++     N+ S   L  + LP ++  +G  I VSS            GA        
Sbjct: 139 ---FEIQMQTNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNPGAQFNYWPSM 195

Query: 144 YYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
           ++ WC Y  +K A    T  LA +N  I  +++ PG+V
Sbjct: 196 FFMWCRYALAKTASIQFTKMLAIKNPDILCMSLHPGLV 233

>Kwal_14.1511
          Length = 277

 Score = 52.4 bits (124), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 98/225 (43%), Gaps = 39/225 (17%)

Query: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIA------RNEDA------LKSLKDTV 48
           M K +L+TGA++GIG+AI     A+D     Y +A      +NE A      +K L+  V
Sbjct: 1   MPKTILITGAAQGIGKAI-----AVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGV 55

Query: 49  GARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYD 108
            A   +L  D+++++ +  +V+KV    G  D ++ NAG+   VAK+  ++  E  ++  
Sbjct: 56  KAPI-FLPIDVSNKESVFGVVDKVASHFGAFDVMINNAGI-AMVAKILEATPEELDRIMK 113

Query: 109 INFFSIIHLINKTLPHL------------------EKSEGNAIFVSSGASTKPYYGWCAY 150
           IN   +++                           +K  G  I   S A  +       Y
Sbjct: 114 INVGGVLYGTQAATRKFVELNRAGDYTPATVKTASKKLTGKIINCCSIAGNEAIGSLGLY 173

Query: 151 GSSKAAVNHLTMSLAAE--NKAIKTIAVAPGVVDTKMQDDIRDKF 193
            SSK AV  LT + A E     I   A APG+V T M D I  K 
Sbjct: 174 CSSKFAVKCLTQASAKELAPLGITVNAYAPGIVLTPMWDLIDSKL 218

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 52.4 bits (124), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 95/206 (46%), Gaps = 32/206 (15%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQ---------Y 54
           V L+TG S G+G  I    +AL        + R +  + ++ D V  + Q         +
Sbjct: 46  VALITGGSGGLGLEIA---IAL--------VQRYKSVIVAIVDVVPPKKQLVKQYPNIIH 94

Query: 55  LAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSI 114
              DITD  ++  + +KV+L+ G+++ +V NA +   + ++   + AE +++ ++N  + 
Sbjct: 95  YRCDITDSFQVAHMKKKVLLDFGKVNILVNNAAI-TIIKQLTDMTEAEIQRVINVNLIAS 153

Query: 115 IHLINKTLPH-LEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAV----NHLTMSLAAEN- 168
            HL++  +P  L    G  I ++S            YG++K  +    N+L   + A N 
Sbjct: 154 YHLVSMFVPEMLYTKNGCIINIASVLGELTPSRLIVYGATKGGLIELHNYLNQQINAHNS 213

Query: 169 -----KAIKTIAVAPGVVDTKMQDDI 189
                + +K I V PG + T M  D+
Sbjct: 214 YAYNRRGLKAILVCPGKISTTMFKDV 239

>Kwal_55.21822
          Length = 283

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 104/223 (46%), Gaps = 21/223 (9%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE--DALKSLKDTVGARFQYLAGDIT 60
           KV  VTGAS GIG  +        ++  ++  +     + +  + +  G + +     +T
Sbjct: 31  KVAAVTGASSGIGYDVAVAFAQAGADVAMWYNSNPHITELVGEISEKYGVKVKAYKCSVT 90

Query: 61  DEDKINEIVEKVVLE-QGRIDSIVANAGV-------LEPVAKVGSSSVAEWKKLYDINFF 112
               +   ++++  +  G+ID +V NAGV       ++ V K      AEW K+ D++  
Sbjct: 91  SSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKVIDVDLN 150

Query: 113 SIIHLINKTLPHLEKSEGNAIFV----SSGASTKPYYGWCAYGSSKAAVNHLTMSLAAEN 168
            I + + K +  + K +G+  F+     SG          AY ++KA V H++ SLA E 
Sbjct: 151 GI-YRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSKSLAVEW 209

Query: 169 KAIKTI-AVAPGVVDTKM----QDDIRDKFGP-SGMTADALKR 205
                +  V+PG + T++    +D+++DK+   + M  +AL R
Sbjct: 210 AGFARVNTVSPGYIATEITNFAEDELKDKWHKLTPMGREALPR 252

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 105/245 (42%), Gaps = 28/245 (11%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           K  LVTGAS GIG  + K +  L     VY  AR    ++ L+   G R      D++++
Sbjct: 5   KYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDVSNQ 62

Query: 63  DKINEIVEKVVLEQ----GRIDSIVANAG--VLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
           + I ++  K+ LEQ     ++  +  NAG     P   V    +      + +N +  I+
Sbjct: 63  NDITQL--KLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEII---DNTFRVNVYGPIN 117

Query: 117 LINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKTI 174
              +  P +  ++G  +F  S A   P+     Y +SKAA++     L  E     ++ I
Sbjct: 118 SCREFAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGPLGVRVI 177

Query: 175 AVAPGVVDTKMQDDIRDKFG-----PSGMTA-DALKRFTDLKKNGELLDADVPGKIYARL 228
            +  G V T + D      G     P G+ A +  K+ ++  KN  +  AD     YAR 
Sbjct: 178 NMITGGVATDIADKKTLPEGSIFNFPEGIKAVETRKKMSE--KNQPMSPAD-----YARE 230

Query: 229 AVSGI 233
            V+ I
Sbjct: 231 TVNDI 235

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 90/191 (47%), Gaps = 29/191 (15%)

Query: 3   KVVLVTGASRGIGEA------------IVKNILALDSNAVVYGIARNEDALKSLKDTVGA 50
           KVV++TG+  G+G++            ++ +I   D +AVV  I +   +  ++ DT   
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIR--DPSAVVDEINKKYGSGSAVADT--- 368

Query: 51  RFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDIN 110
                  DI  E +  ++V+  V + GR+D +V NAG+L   +     +  EW  + +++
Sbjct: 369 ------HDIVKEAQ--QVVQTAVDKFGRVDILVNNAGILRDRS-FAKMTEDEWNAVINVH 419

Query: 111 FFSIIHLINKTLP-HLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE-- 167
            FS   L     P  L++  G  I  +S +     +G C Y ++KAA+   + +LA E  
Sbjct: 420 LFSTFALSKAVWPIFLKQKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALEGT 479

Query: 168 NKAIKTIAVAP 178
            + I    +AP
Sbjct: 480 KRGITVNVIAP 490

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGD---I 59
           +VV++TGA  G+G              VV  + R      S  D+V    + L G+   +
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGR------SAADSVVQEIKKLGGEGDAV 61

Query: 60  TDEDKINE----IVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSII 115
            + D +++    IVE  +   GR+D ++ NAG+L   +     S  +++++ D++     
Sbjct: 62  ANYDSVSDNGAAIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNGAF 120

Query: 116 HLINKTLPHLEKSE-GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE 167
            L     PH+ K + G  I   S A     +G   Y ++K  +     SLA E
Sbjct: 121 KLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKE 173

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 83/190 (43%), Gaps = 14/190 (7%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYG-----IARNEDALKSLKDTVGARFQYLAG 57
           KV  VTG +  I    V+ ++ L     + G       R    + SL D   A       
Sbjct: 23  KVGFVTGGAGTICRVQVEALVLLGCKVAIIGRDHEKTERVAKEISSLVDNPDAVLPISKV 82

Query: 58  DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
           D+ +  ++   V++ V   GRID ++A A     +      S   +K +  I+     + 
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 118 INKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLAAENK--AIK 172
              T+P L KS G+ +FVS   +T  YYG       G++KA ++ L+ +LA E     ++
Sbjct: 142 AKATMPELIKSRGSILFVS---ATFHYYGVPFQSHVGAAKAGIDALSNALAVEMGPFGVR 198

Query: 173 TIAVAPGVVD 182
           +  +APG + 
Sbjct: 199 SNCIAPGAIQ 208

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 83/191 (43%), Gaps = 12/191 (6%)

Query: 5   VLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDEDK 64
            ++TG ++G+G  I++N+LA       +          +    V  R ++L  D++    
Sbjct: 74  CVLTGGAQGLGACILRNLLA------QFPRLTVVVVDVADPAVVHRRVRFLRADLSKPAD 127

Query: 65  INEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTLPH 124
           +  ++E+V  E  R+D ++  AG+      + + +  E  K + +N F+    I K  P 
Sbjct: 128 VERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVNVFAPQRFIQKLAPR 187

Query: 125 LEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAV----NHLTMSLAAENKA-IKTIAVAPG 179
            +  +   + V S           AY ++KAA     +  T  L +  +  ++T+ V  G
Sbjct: 188 -DDRQFYLVTVGSTLGILAPARLSAYAATKAATIAYHDSWTFELLSSGRQRVRTLLVVLG 246

Query: 180 VVDTKMQDDIR 190
            +DT+M    R
Sbjct: 247 QMDTRMFQGFR 257

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 89/193 (46%), Gaps = 23/193 (11%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAG----- 57
           KV+ VTG +  I     + ++ L   A + G     D  K++K   G   Q   G     
Sbjct: 84  KVLFVTGGAGTICRVQTEAMVLLGCKAAIVG----RDKEKTIK-VAGEISQLGHGTSVLP 138

Query: 58  ----DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFS 113
               D+ D  ++ + V + V E GRID ++A A     ++   + S   +K +  I+   
Sbjct: 139 VYGVDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSVVSIDLLG 197

Query: 114 IIHLINKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLAAENK- 169
             + +    P L+K++G  IFVS   +T  YYG       G++KA ++ L+ +LA E   
Sbjct: 198 SFNTVKACFPQLKKNKGAIIFVS---ATFHYYGVPFQSHVGAAKAGIDALSNALAVELGV 254

Query: 170 -AIKTIAVAPGVV 181
             I++  +APG +
Sbjct: 255 LGIRSNCIAPGAI 267

>KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candida
           albicans putative sorbitol utilization protein (by
           homology), start by similarity
          Length = 292

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 92/199 (46%), Gaps = 18/199 (9%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           K+ ++TG +  IG A+ +   +  S+ ++       +    L  T G   +    DIT+ 
Sbjct: 40  KLTVITGGAGAIGGALCEGFASCGSDVIILDRTFQPELSVHLSKTYGIESKSYQVDITNA 99

Query: 63  DKINEIVEKVVLE-QGR-IDSIVANAGVLEPVAKV--GSSSVAEWKKLYDINFFSIIHLI 118
           D +  + E+++ +  GR I++ +ANAG+      +    S+   W+++ D+N     H  
Sbjct: 100 DDVKFVFERILEDFPGRAINTFIANAGIAWTNGSILNDGSTPEMWRRVMDVNVQGTYHC- 158

Query: 119 NKTLPHLEKSEGNAIFV-----SSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--- 170
           ++    + K++G+   +     SS  S  P Y  C Y +SKAAV H+    A E      
Sbjct: 159 SRYAAEVFKNQGHGNLILTASMSSYISNVPNYQTC-YNASKAAVRHMAKGFAVEFSGLTS 217

Query: 171 ----IKTIAVAPGVVDTKM 185
               I+  +V+PG  DT +
Sbjct: 218 PAGKIRCNSVSPGYTDTLL 236

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
           (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 88/190 (46%), Gaps = 20/190 (10%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQ--------- 53
           +VVL++G S+G+G A  +  +  +S++ V  ++R+E+ L    + +    +         
Sbjct: 8   QVVLISGGSQGLGRAFAQKYIE-ESDSTVVIVSRSEEKLTRAGEAICGGARRLGAGGAGR 66

Query: 54  --YLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEP--VAKVGSSSVAEWKKLYDI 109
             Y A ++ D   +  +   +     ++  ++  AG   P   A++ S+ +A      ++
Sbjct: 67  LLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGAVPGLFAELSSAQLA---AGVEM 123

Query: 110 NFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENK 169
           N+ + +HL +  + H  +   + +F SS A+  P+ G+  Y   KAA+  L   L  E  
Sbjct: 124 NYGTALHLAHGAVRHGAR---HLVFFSSAAAVYPFIGYSQYAPLKAALRALVAVLRQECD 180

Query: 170 AIKTIAVAPG 179
            ++   V PG
Sbjct: 181 GVRVSCVYPG 190

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 100/225 (44%), Gaps = 19/225 (8%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDED 63
           +VL+TG S+G+G AIV  +L   SN  +  +   +    S+++T   R + L  D++D++
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNV---DICPSSVRNT---RVKDLICDLSDDE 125

Query: 64  KINEIVEKVVLE-QGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
           ++  ++  +  + +  I  IV NAGV                K++ IN F+ +  I +  
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQELA 185

Query: 123 PHLEKSEGNAIF-VSS--GASTKPYYGWCAYGSSKAAVNHLTMSLAAEN---KAIKTIAV 176
           P    +    I  ++S  G  T       A   +     H + S   +N   + I+T+ V
Sbjct: 186 PSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNIRTLLV 245

Query: 177 APGVVDTKMQDDI---RDKFGPS---GMTADALKRFTDLKKNGEL 215
            PG ++T+M       R  F P       A  + R+ +L + G+L
Sbjct: 246 TPGQLNTEMFAGFKPPRQFFAPVIDITTLAAKIVRYCELGQRGQL 290

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 84/193 (43%), Gaps = 12/193 (6%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61
           KK+ +VTGAS GIG  + K +    +  +VY  AR  + +  L    G     +     D
Sbjct: 9   KKIAVVTGASGGIGYEVTKEL--ARNGYLVYACARRLEPMAQLAIQFGN--DSIKPYKLD 64

Query: 62  EDKINEIVE-----KVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116
             K  EIV      +  L  G++D +  NAG       + ++  A  ++ + +N F  I+
Sbjct: 65  ISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAA-VEQCFKVNVFGHIN 123

Query: 117 LINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTI 174
           +  +    L K++G  +F  S A    +     Y +SKAA++     L  E K   ++ I
Sbjct: 124 MCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVI 183

Query: 175 AVAPGVVDTKMQD 187
               G V T + D
Sbjct: 184 NAITGGVATDIAD 196

>Scas_613.18
          Length = 286

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 94/211 (44%), Gaps = 26/211 (12%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDED 63
           V LVTG S G+G  IVK +L+     ++  I        +++        Y   D+  ++
Sbjct: 37  VALVTGGSSGLGLEIVKQLLSKRCTVIILDIYP-----PNIQFGADKALTYYKCDVGSQE 91

Query: 64  KINEIVEKVVLEQGRIDSIVANAGV--LEPVAKVGSSSVAEWKKLYDINFFSIIHLINKT 121
           +I +  +++  +   I  ++ NAG+  L+P+ +    S  E  K+ ++N+     L+   
Sbjct: 92  EIEKTYKRISKDHASIHILINNAGITCLKPITEF---SKEEVNKVINVNYLGACKLM--- 145

Query: 122 LPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAV--NHLTMSLAAENKA---IKT 173
             HL  S  N  F+ + AS           AYG+SK  +   H +++L  + +    IK 
Sbjct: 146 --HLWLSANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTNKIKM 203

Query: 174 IAVAPGVVDTKMQDDIRDKFGPSGMTADALK 204
           + V  G + TKM   +     PS + A  +K
Sbjct: 204 LLVCTGKIRTKMFQSVD---SPSTLFAPDIK 231

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 89/217 (41%), Gaps = 42/217 (19%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE----DALKSLKDTVGAR------ 51
           +KV LVTG + GIG   V ++       +VY   RN      A+K++++   +R      
Sbjct: 18  RKVALVTGGNSGIGWYTVLHLYM--HGFIVYVGGRNSSRVNQAIKAIQNEAKSRQRKSTF 75

Query: 52  -----------FQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSV 100
                        +L+ D++D   +++   K    +  +D ++ NAGV+    ++     
Sbjct: 76  KGLKLERNFGKLHFLSLDLSDLRSVDKAAAKFKGLELSLDVLINNAGVMALPYEITKDG- 134

Query: 101 AEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPY---------------- 144
             ++     N+ S   L  + LP +++  G  I VSS      +                
Sbjct: 135 --FEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSIGHNLEFTYFNLNRDFNYMPNII 192

Query: 145 YGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
           + W  Y  +K A+   T  LA ++  +  I+V PG+V
Sbjct: 193 FTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV 229

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 103/239 (43%), Gaps = 48/239 (20%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVY------------------------GIARNED 39
           V +V+GA+RGIG  I ++ L L   +V+Y                        GI+ N  
Sbjct: 6   VSIVSGATRGIGSKI-RDELLLSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFK 64

Query: 40  ALKSLKDTVGARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS 99
              +  DT  ++F    G I  + + N+++     +Q R+D +V  AG+ +  A + +++
Sbjct: 65  GWPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAIKANT 124

Query: 100 VAEWKKLYDINFFSIIHLINKTLPH------LEKSEGNAIFVSS----GASTKPYYGWCA 149
             E   + ++NF S + L    L        L    G  + ++S     +S     G   
Sbjct: 125 -NEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNIIVPGTAM 183

Query: 150 YGSSKAAVNHLTMSLAAENK--AIKTIAVAPGVV---------DTKMQDDIRDKFGPSG 197
           Y +SKAA+      L+ E K  +I    ++PG+V         D ++Q  +R+K  P+G
Sbjct: 184 YSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDMIKTLDPEIQQKLREKL-PNG 241

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALK-------SLKDTVGARFQYL 55
           KVV VTG +  I     + ++ L + A + G  RN +  K        L D+        
Sbjct: 23  KVVFVTGGAGTICRVQAEAMVLLGAKAAIIG--RNVEKTKKAAAEIAELGDSADCVLGIG 80

Query: 56  AGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSII 115
             D+ +   +   VE+ V   GRID ++A A     +A + + S   +K + DI+     
Sbjct: 81  GVDVREVADMKRAVEQTVAAFGRIDYVIAGAAG-NFLADMTNLSSRAFKTVLDIDLVGSY 139

Query: 116 HLINKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLAAE--NKA 170
           + +  TL  L K++G  +FVS   +T  Y G        ++KA V+ L+  LA E     
Sbjct: 140 NTVKATLSELAKNKGAVLFVS---ATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLG 196

Query: 171 IKTIAVAPGVV 181
           I+   +APG++
Sbjct: 197 IRCNCIAPGLI 207

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 93/225 (41%), Gaps = 35/225 (15%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61
           + + LVTG + G+G+ IV+ +       V+  +    D    L+   G  F   A DI+ 
Sbjct: 60  RDIALVTGGAGGLGKEIVRELRRRQIVTVILDVVPPPD----LESLTGVHFY--ACDISL 113

Query: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLE--PVAKVGSSSVAEWKKLYDINFFSIIHLIN 119
             +I  I E ++ + G +  ++ NA +    P+ +V +  +   +++  +N      LI 
Sbjct: 114 PGRIRVIHENIIRDVGHVTILINNAAITSDLPLDRVDNDKI---EQIIRVNLLGPYTLIR 170

Query: 120 KTLPHL-EKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE----------- 167
           + LP +     G  + ++S           AYG+SK  +  L  SL  E           
Sbjct: 171 EFLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDELEQYTWKDSSN 230

Query: 168 ---------NKAIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADAL 203
                       I+++ V PG + TKM D+ R    PS + A  L
Sbjct: 231 PGYVPLLKSRGVIRSLLVCPGKLTTKMFDNAR---SPSKIIAPDL 272

>Kwal_26.8838
          Length = 323

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 39/214 (18%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNED----ALKSLKDTVGARFQ---- 53
           +KV LVTG + GIG   V + L L   AV Y   RN      A+K +K     R +    
Sbjct: 18  RKVALVTGGNSGIGWYTVLH-LYLHGFAV-YVAGRNSSRVNRAIKDIKKEARTRIKKEDP 75

Query: 54  ----------YLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEW 103
                     +L+ D+T+   +++  ++    + R+D ++ NAGV+     V        
Sbjct: 76  ESRHPVGELYFLSLDLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTEDGF--- 132

Query: 104 KKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSS--------------GASTKP--YYGW 147
           +     N+ +   L  + LP +++  G  I VSS                + KP   + W
Sbjct: 133 EIQLQTNYIAHFLLTMRLLPSVKRCRGRIITVSSIGHNLEFSYFSLAQSFNYKPNMLFTW 192

Query: 148 CAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
             Y  +K A       LA ++  +  ++V PG+V
Sbjct: 193 MRYAMAKTASIQFAKMLAIKHPDVLCMSVHPGLV 226

>Scas_655.19
          Length = 297

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 25/198 (12%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE----DALKSLKDTVGARFQYLAGD 58
           KVV VTG +  I    V+ ++ L   A + G  R E    DA K ++  V +  +    D
Sbjct: 23  KVVFVTGGAGTICRVQVEAMVLLGCKAAILG--REEKKTIDAAKEIESLVRSPTENDDAD 80

Query: 59  ----------ITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYD 108
                     + + D++   V+K V   G ID ++A A     +    + S   +K + D
Sbjct: 81  PIVLPLGNIDVRNFDQLKNAVKKTVDTFGHIDYLIAGAAG-NFICDFMNLSPNAFKSVID 139

Query: 109 INFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYG---WCAYGSSKAAVNHLTMSLA 165
           I+     + +      L K++G+ +FVS   +T  YYG       G++KA ++ L+ +LA
Sbjct: 140 IDLLGSFNTVKACASQLIKNKGSVLFVS---ATFHYYGVPFQLHVGAAKAGIDALSNNLA 196

Query: 166 AE--NKAIKTIAVAPGVV 181
            E     +++  +APG +
Sbjct: 197 VELGPLGVRSNCIAPGAI 214

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 90/211 (42%), Gaps = 22/211 (10%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGD-ITD 61
           KVV++TGA  G+G +         +  VV  +   +  +  +        QY  G  + D
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINS------QYGEGRAVAD 373

Query: 62  EDKI----NEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHL 117
              I      +VE  +    R+D +V NAG+L   + V  +   EW  +  ++  S+  L
Sbjct: 374 SHNIVTDAAAVVETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFAL 432

Query: 118 INKTLP-HLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKTI 174
                P  +++  G  +  +S +     +G   Y ++KAAV   + SLA E   + I+  
Sbjct: 433 SKAVWPIFMQQRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVY 492

Query: 175 AVAPGVVDTKM------QDDIRDKFGPSGMT 199
            +AP    T M      + +I+  F PS ++
Sbjct: 493 VIAPHAF-TNMTKTIFGETEIKSSFEPSQVS 522

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 8/134 (5%)

Query: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
           +TD DKI   V+  +   GR+D IV NAG+L         +   +  + D++      L 
Sbjct: 74  VTDGDKI---VKTAIDAFGRVDVIVNNAGILRD-GSFAKMTEKNFSAVVDVHLNGSYKLC 129

Query: 119 NKTLPHLEKSE-GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIA 175
               P++ + + G  +  +S A     +G   Y ++K  +  L+ +LA E     IK   
Sbjct: 130 KAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETLAKEGHKYNIKVNV 189

Query: 176 VAPGVVDTKMQDDI 189
           +AP +  ++M + +
Sbjct: 190 IAP-IARSRMTEGL 202

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 92/222 (41%), Gaps = 26/222 (11%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNED-ALKSLKDTVGARFQYLAGDITDE 62
           + L+TG S G+G  IV+    L+    +  I         + +        Y   DI++ 
Sbjct: 85  MALITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPCDISNP 144

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
            +I E+ +K+ L+ G +  ++ NAG+     ++   S    +K   +N+ S  + I + L
Sbjct: 145 KEIAELHKKIKLQHGNVTILINNAGITSGY-RLQELSDKVIEKTIQVNYVSAFYTIQEFL 203

Query: 123 PHL-EKSEGNAIFVSSGASTKPYYGWCAYGSSK--------AAVNHLTM----------- 162
           P +   S G  + V+S           AYG+SK        A VN L             
Sbjct: 204 PDMVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIKRTRPQDSLH 263

Query: 163 SLAAENK-AIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADAL 203
           +L+  +K  IK + V PG + T +   I+    PS + A  L
Sbjct: 264 NLSPRSKIPIKALLVCPGKIKTPLFQAIQT---PSSVMAPDL 302

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 84/216 (38%), Gaps = 40/216 (18%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYG-----------------IARNEDALKSLK 45
           +V +VTG + GIG   V ++        V G                 + R+   LK L 
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLH 77

Query: 46  DTVGARF----QYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVA 101
           D    R+    QYL  D+TD   ++    K++  +  +D +V NAGV+    ++      
Sbjct: 78  DQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVMAVPYEITKDGF- 136

Query: 102 EWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGAS-----------TKPY-----Y 145
             +     N+ +   L  + LP L  S G  + +SS              T  Y     +
Sbjct: 137 --EIQMQTNYIAHFLLTMRLLPLLRCSHGRVVTLSSLGHHIIFKYSKLDETWNYFPNFVF 194

Query: 146 GWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
            W  Y  +K A    T  LA +N  I  ++V PG+V
Sbjct: 195 TWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>Scas_675.10
          Length = 312

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 82/197 (41%), Gaps = 23/197 (11%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKD-----TVG-------- 49
           ++VL+TG S+G+G           +N+ +  ++R+E  L    D     TVG        
Sbjct: 8   QIVLITGGSQGLGREFAHKYYHEGNNSKIIVVSRSEKKLIKAVDAISGKTVGTNLSPEET 67

Query: 50  ------ARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEW 103
                 A+  Y   D++D + ++ + +++   +     +   AG    + K+      E 
Sbjct: 68  GKLNKNAKLYYYPCDLSDHEAVSTMFDRLCELEMLPTQVYCCAG--GSIPKLFKDLTGEE 125

Query: 104 KKL-YDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTM 162
             +   +N+ + +H+ +K +  LE S  + I  SS  +  P+ G+  Y   K ++  L  
Sbjct: 126 LDMGIKMNYSTTLHIAHK-VAQLELSNCHLILFSSVTAFFPFIGYSQYAPLKVSLKALVG 184

Query: 163 SLAAENKAIKTIAVAPG 179
            L  E    +   V PG
Sbjct: 185 ILRQEMLQNRISCVYPG 201

>Scas_478.2
          Length = 920

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 6/145 (4%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYL-AGDITD 61
           KVV++TGA+ G+G++         +  ++  I   E  +  +    GA   +  + +I  
Sbjct: 326 KVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNIIT 385

Query: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKT 121
           E ++  +V+  +   G +D +V NAG+L   + +  +   EW  +  ++  +   +    
Sbjct: 386 ESEL--VVKTAIDHFGHVDILVNNAGILRDKSFLKMTE-KEWYPVLQVHLQATFAMCKAV 442

Query: 122 LPHLEKSEGNAIFVSSGASTKPYYG 146
            PH  K   N+ F+ +  ST   YG
Sbjct: 443 WPHFSKQ--NSGFIINTTSTSGIYG 465

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 33  GIARNEDALKSLKDTVGARFQYLAGDITDEDKINE----IVEKVVLEQGRIDSIVANAGV 88
           G  +N  A   + D + +++   A  + + D +NE    I++  +   G+ID ++ NAG+
Sbjct: 48  GSGQNSKAADVVVDEIKSKYNGTA--VANYDSVNENGANIIKTAIDNFGKIDILINNAGI 105

Query: 89  LEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSE-GNAIFVSSGASTKPYYGW 147
           L  V+     S  E++ + D++      L +   P+++  + G  I  +S A     +G 
Sbjct: 106 LRDVS-FNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKAQKFGRIINTASPAGLFGNFGQ 164

Query: 148 CAYGSSKAAVNHLTMSLAAE 167
             Y ++K  +  L  +LA E
Sbjct: 165 ANYSAAKLGLVGLAETLAKE 184

>YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member of
           the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases, has low
           similarity to a region of WW domain-containing
           oxidoreductase (mouse Wwox), which is an apoptosis
           activator [993 bp, 330 aa]
          Length = 330

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 84/224 (37%), Gaps = 50/224 (22%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDAL-KSLKDTVG----------- 49
           +K+ +VTG + GIG   V ++       VVY   RN   + K++++ +            
Sbjct: 16  RKIAVVTGGNTGIGWYTVLHLYL--HGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDD 73

Query: 50  ---------------ARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLE-PVA 93
                              Y+  D+TD   +     K++  +  ID +V NAG++  P+ 
Sbjct: 74  GSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLE 133

Query: 94  KVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSS--------------GA 139
                   + +  Y  +F   + L    LP L    G  I +SS                
Sbjct: 134 MTKDGFEVQLQTNYISHFIFTMRL----LPLLRHCRGRIISLSSIGHHLEFMYWKLSKTW 189

Query: 140 STKP--YYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
             KP   + W  Y  SK A+   T  LA +   +  ++V PG+V
Sbjct: 190 DYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLV 233

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 85/196 (43%), Gaps = 19/196 (9%)

Query: 6   LVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDEDKI 65
           L+TG S G+G  + K +    +  +V  I     +  +          Y   DIT  D+I
Sbjct: 42  LITGGSSGLGFELAKELSRRINKVIVADI----QSFPTFAQVEYNNIFYYQCDITSLDEI 97

Query: 66  NEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINF---FSIIHLINKTL 122
             + + +  + G I+ I+ NAGV   + K+   +  E ++L DIN    + II    + +
Sbjct: 98  KNLKKAIERDHGNINIIINNAGVAH-IKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDM 156

Query: 123 PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAV--------NHL-TMSLAAENKAIKT 173
             ++  EG  I ++S           +YG+SK A+         H  ++S       IKT
Sbjct: 157 --IDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKT 214

Query: 174 IAVAPGVVDTKMQDDI 189
           + V PG + T M  D+
Sbjct: 215 LLVCPGKIKTNMFIDV 230

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 97/233 (41%), Gaps = 62/233 (26%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAG------ 57
           V +VTGA+RGIG+AI + +     + ++ G  +     +S++ T   R Q  +G      
Sbjct: 6   VAIVTGATRGIGKAICQKLFQKGLSCIILGSTK-----ESIERTAIDRGQLQSGLSYQRQ 60

Query: 58  --------------DITDEDKINEIVEKVVLEQGR------------------IDSIVAN 85
                         D    D I    ++  L+Q                    ++ ++  
Sbjct: 61  CAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINC 120

Query: 86  AGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYY 145
           AG+ +    V +++ ++ + + ++NF S + + N  + ++ KS+     +S G S +P  
Sbjct: 121 AGLTQESLSVRTTA-SQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELS-GQSARPTI 178

Query: 146 ---------------GWCAYGSSKAAVNHLTMSLAA--ENKAIKTIAVAPGVV 181
                          G   Y +SKAA++  T  LAA  E + I+   ++PG+V
Sbjct: 179 VNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLV 231

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 92/210 (43%), Gaps = 20/210 (9%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           K+V+VTGA  G+G +         +  VV  I   E  +  +    G         I D+
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGG-----GSAIPDK 239

Query: 63  DKI----NEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
             +     EIV+  +   GR+D +V NAG+L   + +  +   EW  +  ++ FS   L 
Sbjct: 240 HDVVTQPTEIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTYGLS 298

Query: 119 NKTLP-HLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKTIA 175
               P  L++  G  I  +S +     +G   Y ++KAA+  L+ +LA E     IK   
Sbjct: 299 KAVWPVFLKQRSGYIINTTSTSGIYGNFGQANYAAAKAAILGLSKTLALEGSKHGIKVNI 358

Query: 176 VAPGVVDTKM------QDDIRDKFGPSGMT 199
           +AP   +T M      Q ++ + F PS ++
Sbjct: 359 IAPH-AETAMTKTIFSQTELSNHFDPSQVS 387

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 86/209 (41%), Gaps = 29/209 (13%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           +VVL+TG S+G+G+   K       N  +  ++R+E  L    + +     +L  + TDE
Sbjct: 8   QVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIE-AHLRRETTDE 66

Query: 63  DKI-NEIVEKVVLEQGRIDSIVANAGVLEPV--------------AKVGSSSVAEWKKLY 107
            ++ +++   + LEQ R+     +    E V               +    +     KL+
Sbjct: 67  GQVQHKLAAPLDLEQ-RLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGAVPKLF 125

Query: 108 ------------DINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKA 155
                       DIN+ + +++ ++     +  E + I  SS  +  P+ G+  Y  +KA
Sbjct: 126 RGLSGHELNLGMDINYKTTLNVAHQIALAEQTKEHHLIIFSSATALYPFVGYSQYAPAKA 185

Query: 156 AVNHLTMSLAAENKAIKTIAVAPGVVDTK 184
           A+  L   L  E    +   V PG  +++
Sbjct: 186 AIKSLVAILRQELTNFRISCVYPGNFESE 214

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 89/203 (43%), Gaps = 23/203 (11%)

Query: 3   KVVLVTGASRGIGEAIV-------KNILALDSNAVVYGIARNEDALKSLKDTVGARFQYL 55
           +VV++TGA  G+G+            ++  D    + G   N  A   + D +       
Sbjct: 10  RVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVDEIKK----- 64

Query: 56  AGDIT--DEDKINE----IVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDI 109
           AG I   + D +NE    I+E  + E GR+D ++ NAG+L  V+     +  E+  + D+
Sbjct: 65  AGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDVS-FAKMTEREFASVVDV 123

Query: 110 NFFSIIHLINKTLPHLEKSE-GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAEN 168
           +      L     P++   + G  I  +S A     +G   Y ++K  +  L  +LA E 
Sbjct: 124 HLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEG 183

Query: 169 KA--IKTIAVAPGVVDTKMQDDI 189
               I   ++AP +  ++M +++
Sbjct: 184 AKYNINVNSIAP-LARSRMTENV 205

>Scas_652.19d
          Length = 341

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 91/222 (40%), Gaps = 40/222 (18%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSN--AVVY----GIARNEDALKSLKDTVGARFQYLA 56
           K  L+TG + GIG  ++K + + + N  AVV     G A  ++A++   ++ G+      
Sbjct: 42  KTALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVVGG 101

Query: 57  GDITDEDKINEIVE--KVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFS- 113
            D  D   +    E  K+VL    ++ I+ NAG++ PV    S    E   ++  N    
Sbjct: 102 NDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPVNTGTSKQGLE--AMFSTNVLGP 159

Query: 114 --IIHLINKTLPHLEKSEGNAIFVSSGASTK-----------PYYGWCA----------Y 150
             + H ++      +      ++VSSGA              P Y  C           Y
Sbjct: 160 QLLQHFLDPLFLKKDDDLKRIVWVSSGAHANACFDYGIHWDDPTYEKCTIAERPSPYELY 219

Query: 151 GSSKAAVNHLTMSLAAENKAI------KTIAVAPGVVDTKMQ 186
           G SKAA  +   + A +NK I       +++  PG + T +Q
Sbjct: 220 GQSKAANIYQAKAWATKNKEIVDEIGCVSVSCYPGNLKTDLQ 261

>Scas_721.47
          Length = 344

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 79/178 (44%), Gaps = 16/178 (8%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTV----GARFQYLAGD 58
           K  +VTGAS GIG+     + A   N V+  I+R    L++LK+      G + + LA D
Sbjct: 63  KYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEFEKKYGIKVEILAID 120

Query: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAGVLE--PVAKVGSSSVAEWKKLYDINFFS--- 113
           I+ + + N    K + +   I  ++ N G     PV  + +    E + +  IN  +   
Sbjct: 121 ISSDSQDNYEFIKGLCKDLPITVLINNVGQSHSIPVPFLETEE-EELRNIITINNTATLL 179

Query: 114 ----IIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE 167
               I  +I+KT+   +KS G  + + S     P      Y  SKA +   + SLA E
Sbjct: 180 ITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWSTSLAGE 237

>Kwal_14.2598
          Length = 311

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 80/206 (38%), Gaps = 43/206 (20%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKS--------------LKDTV 48
           +VVL+ G S+G+G+A         SN  V  ++R+   L++              L DT 
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSGLKTAPELLPDTE 68

Query: 49  ----GARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKV---GSSSVA 101
               G    Y   D+ +  ++ ++ E +             A  LEP   +   G S+  
Sbjct: 69  IPKNGNHIWYSPCDLAEYAQVEKLYESL------------KACSLEPTQVLLCAGGSTPG 116

Query: 102 EWKKLY--------DINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSS 153
            +K L          +N+ + ++L +  + H   S  + +F SS  +  P+ G+  Y   
Sbjct: 117 LFKDLQGPELELGVRVNYMTCVNLAHIAVCHWPTS--HLVFFSSEVAFFPFIGYSQYAPL 174

Query: 154 KAAVNHLTMSLAAENKAIKTIAVAPG 179
           K ++  L   L  E    +   V PG
Sbjct: 175 KQSIKSLVAILRQECPQQRISCVYPG 200

>Kwal_26.7950
          Length = 897

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 57/142 (40%), Gaps = 10/142 (7%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITDE 62
           KVV++TGA  G+G +         +  VV  I      +  ++   G         + D+
Sbjct: 325 KVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRN-----SAVADK 379

Query: 63  DKI----NEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118
             +     EIV+      GR+D +V NAGVL   +     S  EW+ +  ++ FS   L 
Sbjct: 380 HDVVKDPGEIVKSAFQTFGRVDILVNNAGVLRDRS-FAKMSDEEWEIVLKVHLFSTFGLC 438

Query: 119 NKTLPHLEKSEGNAIFVSSGAS 140
               P   K +   I  ++  S
Sbjct: 439 KAVWPIFVKQKSGYIINTTSTS 460

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 75/177 (42%), Gaps = 15/177 (8%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVY-------GIARNEDALKSLKDTVGARFQYL 55
           +VV++TGA  G+G+          +  VV        G   N  A   +   +  +++  
Sbjct: 11  RVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKYKTQ 70

Query: 56  AGDITDEDKINE----IVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINF 111
           A    + D + E    IV+  V   GR+D I+ NAG+L   +   + S + +  + D++ 
Sbjct: 71  AA--ANYDSVTENAAAIVQTAVDNFGRVDIIINNAGILRD-SSFANMSDSAFASVVDVHL 127

Query: 112 FSIIHLINKTLPHLEKSE-GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE 167
               +L     PH++  + G  +   S A     +G   Y ++K  +   + +LA E
Sbjct: 128 TGAYNLTRAAWPHMKNQKFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETLAQE 184

>KLLA0F01749g complement(163821..164762) similar to sp|P38342
           Saccharomyces cerevisiae YBR265w TSC10 3-ketosphinganine
           reductase singleton, start by similarity
          Length = 313

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 85/204 (41%), Gaps = 36/204 (17%)

Query: 3   KVVLVTGASRGIGEAIVKNILALD------SNAVVYGIARNEDALKSLKDTVG------- 49
           +V+L++G S+G+GE+  K  +  D      +N V+  ++R++  L    + +G       
Sbjct: 9   QVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVII-VSRSQSKLVKACERIGVDGVSLD 67

Query: 50  ----------ARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS 99
                      +  Y + D +  DK+  + + +V  +     +   AG   P   +  + 
Sbjct: 68  RYVNDTNRNETKLIYHSCDTSSYDKVALMFKLLVKSELVPSQVYMCAGGSIPKLFLDLTP 127

Query: 100 VAEWKKLYDINFFSIIHLINKTL----PHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKA 155
             E +     N+ + ++L + +L    PHL       +F SS  +  P+ G+  Y   K 
Sbjct: 128 -EELQNGITTNYSTAVNLAHVSLKHDVPHL-------LFFSSEVAFFPFIGYAQYAPLKQ 179

Query: 156 AVNHLTMSLAAENKAIKTIAVAPG 179
           ++  L   L  E+ + +   V PG
Sbjct: 180 SIRSLVAILRQEHSSTRITCVYPG 203

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 3   KVVLVTGASRGIGEA-----------IVKNILALDSNAVVYGIARNEDALKSLKDTVGAR 51
           KVV++TGA  G+G++           +V N +  D N VV  I       +++ DT    
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIK-DPNTVVNEINSKYGEGRAIPDT---- 378

Query: 52  FQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINF 111
                 ++  E   N+++E  +   GR+D +V NAG+L   + +  +   EW  +  ++ 
Sbjct: 379 -----HNVVTE--ANQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWFAVVQVHL 430

Query: 112 FSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYG 146
           +S   L     P   K +G  I  ++  ST   YG
Sbjct: 431 YSTFLLSKAVWPIFLKQKGGHIINTT--STSGIYG 463

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 5/130 (3%)

Query: 63  DKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
           D   +IVE  +   GRID ++ NAG+L  V+     +  E+  + D++      L     
Sbjct: 78  DNGEQIVETAIKAFGRIDILINNAGILRDVS-FAKMTEKEFSAVLDVHLTGAYRLTKAAW 136

Query: 123 PHLEKSE-GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIAVAPG 179
           P++ + + G  I  +S A     +G   Y ++K  +     +LA E     I   ++AP 
Sbjct: 137 PYMRQQKFGRIINTASPAGLFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAP- 195

Query: 180 VVDTKMQDDI 189
           +  ++M +++
Sbjct: 196 LARSRMTENV 205

>Scas_650.8
          Length = 326

 Score = 35.0 bits (79), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 81/219 (36%), Gaps = 44/219 (20%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSL----------------- 44
           +KV ++TG + GIG   V ++        VY   R    +K                   
Sbjct: 16  RKVAVITGGNSGIGWYTVLHLYM--HGFTVYLCGRTSHKIKKAINEITIEAEARLGLLEK 73

Query: 45  ------KDTVGARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSS 98
                 KD      +Y+  D+TD   + +  +K++  + +ID ++ NA +L    ++   
Sbjct: 74  EVDDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTKD 133

Query: 99  SVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGAST--------------KP- 143
                +     N+ +   L  + LP ++K  G  I + S                  KP 
Sbjct: 134 GF---EIQLQTNYIAHFLLTMRLLPAIKKCHGRIITLGSLGHRLEVTYWNLNKKWDYKPN 190

Query: 144 -YYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181
             + W  Y  +K A    T  L+ +   +  +++ PG+V
Sbjct: 191 MIFTWFRYAVAKTASIQYTKMLSIKYPEVLCLSLHPGLV 229

>KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pichia
           stipitis D-arabinitol 2-dehydrogenase [ribulose forming]
           (EC 1.1.1.250) (ARDH), start by similarity
          Length = 314

 Score = 34.7 bits (78), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 148 CAYGSSKAAVNHLTMSLAAE--NKAIKTIAVAPGVVDTKMQDDI 189
           CAY  SKA V HL  SLAAE     I+  A++PG + T +   +
Sbjct: 212 CAYNMSKAGVIHLVKSLAAEWAKFGIRVNAISPGYIATALTKKV 255

>KLLA0E17083g 1512395..1513939 similar to sgd|S0002738 Saccharomyces
           cerevisiae YDR330w, start by similarity
          Length = 514

 Score = 34.3 bits (77), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 32  YGIARNEDA--LKSLKDTVGARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVL 89
           YG    ED   +  L    G R ++ + ++   +   + +E + LE+  +D    N  V 
Sbjct: 300 YGFNDKEDCPHIAILDPITGERLKFWSREVPTVENFRQELE-IFLEEFSLDPTTTNPPVK 358

Query: 90  EPVAKVGSSSVAEWKKL 106
           EP  K+  S+++E K+L
Sbjct: 359 EPTPKIDPSTLSEEKQL 375

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 13/173 (7%)

Query: 6   LVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGAR----FQYLAGDITD 61
           +VTGAS GIG+   K +     N ++  I+R E  L  LK  +        + LA D++ 
Sbjct: 69  VVTGASDGIGKEYAKQLAKRGFNLIL--ISRTESKLVELKKEIETECKIDVKILAIDVSS 126

Query: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLEPV-AKVGSSSVAEWKKLYDINFFSIIHLINK 120
           + K N  + + V     +  ++ N G    +      +  +E + +  IN  + + +   
Sbjct: 127 DSKENYTLIREVASGLPVTVLINNVGKSHSIPVPFDQTEESELRDIITINNTATLMITQT 186

Query: 121 TLPHLE------KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE 167
            LP L+      K  G  + + S     P      Y  SKA +   + +LA E
Sbjct: 187 LLPQLKASVKTLKCRGLILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAGE 239

>Kwal_34.16139
          Length = 315

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 81/222 (36%), Gaps = 37/222 (16%)

Query: 4   VVLVTGASRGIGEAIVKNILALDSNAVVY--GIARNEDALKSL------KDTVGARFQYL 55
           V +VTG S G+   + + +LA  S   +    + R E   + L       +   A     
Sbjct: 36  VTIVTGGSGGLAHTLTQALLAQGSEVALLDLNVERLEYTKRELLEFAKANNLSKANVSAW 95

Query: 56  AGDITDEDKINEIVEKVVLEQGRI--DSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFS 113
             DI D D ++E+V  + L+   I  D ++  AG  + V  +      + + +  +N   
Sbjct: 96  PCDIGDPDIVDEVVRAIPLKHNGIVPDKLIHTAGYCQNVPAL-EYDARQAEAVVRVNLMG 154

Query: 114 IIHLIN------------------------KTLPHLEKSEGNAIFVSSGASTKPYYGWCA 149
            +++                          + LP    +    I   SG          A
Sbjct: 155 SLYICQSMSRQLLQKVQRRKSVSSASGEAGEALPQFPHASYVLIGSMSGCIVNNPQPQVA 214

Query: 150 YGSSKAAVNHLTMSLAAE--NKAIKTIAVAPGVVDTKMQDDI 189
           Y  SKA V H+  SLA E     I+  +++PG + T +   +
Sbjct: 215 YNMSKAGVIHMVRSLACEWARYGIRVNSISPGYIATALTKKV 256

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 6/65 (9%)

Query: 6   LVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARF----QYLAGDITD 61
           +VTGAS GIG+     + +   N V+  I+R E  L +LKD +  +F    + LA DI+ 
Sbjct: 66  VVTGASDGIGKEFASQLASKGFNLVL--ISRTESKLVALKDELEGKFNIKAKILAIDISA 123

Query: 62  EDKIN 66
           + K N
Sbjct: 124 DSKDN 128

>Scas_652.19d1
          Length = 344

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 18/151 (11%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT-- 60
           K  +VTG + GIG+ +V+  L    N  V G+ R +   +  K  + A      G+IT  
Sbjct: 42  KTAVVTGCNTGIGKHVVE--LLYQKNCNVIGVVRTDAKGEEAKKEIIANNPKSKGNITII 99

Query: 61  ------DEDKINEIVEKV--VLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFF 112
                 D +K+  +  K+   L    ++ I+ NAG++ P  K   +SV  ++ ++  N  
Sbjct: 100 GGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAGLMAPDNK--GTSVQGYEAMFQTNVL 157

Query: 113 S---IIHLINKT-LPHLEKSEGNAIFVSSGA 139
               + H ++   L   + S    ++VSSGA
Sbjct: 158 GSQLLQHFLDPLFLKEDDISLKRIVWVSSGA 188

>Scas_566.11
          Length = 346

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 49/120 (40%), Gaps = 16/120 (13%)

Query: 77  GRIDSIVANA--GVLEP---VAKVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGN 131
           G +  +++N    V  P   + ++G  S      ++  N F   +LI K LP L+   G 
Sbjct: 114 GAVKEVISNPLEAVTNPTYKIQRIGVKSKDGMGLVFQANVFGPYYLIQKLLPLLKAGNGT 173

Query: 132 AIFVSSGASTKPYYGW---------CAYGSSKAAVNHLTMSLAAENK--AIKTIAVAPGV 180
            +++SS  S   Y             +Y  SK  V+ L ++   E K   I    V PG+
Sbjct: 174 IVWISSVMSAPKYLSLQDIELLKTDASYEGSKRLVDLLHLATYEERKKLGIHQYVVQPGI 233

>CAGL0M11506g 1134645..1135691 highly similar to sp|Q12452
           Saccharomyces cerevisiae YLR100w ERG27 3-keto sterol
           reductase, hypothetical start
          Length = 348

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 44/115 (38%), Gaps = 11/115 (9%)

Query: 95  VGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGW------- 147
           VG  S  E   ++  N F   +LI K LP L K +   +++SS  +   +          
Sbjct: 139 VGVKSKDEMGLVFQANVFGPYYLIQKILPQLSKGKATVVWISSIMADPKHLSLQDIEMIK 198

Query: 148 --CAYGSSKAAVN--HLTMSLAAENKAIKTIAVAPGVVDTKMQDDIRDKFGPSGM 198
               Y  SK  V+  HL      +++ I    V PG+  +       + F   GM
Sbjct: 199 SDVTYEGSKRVVDLLHLATYKQMKSQGIHQYVVQPGIFTSYSFAKYLNFFTTFGM 253

>Kwal_26.8282
          Length = 298

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 92/230 (40%), Gaps = 45/230 (19%)

Query: 4   VVLVTGASRGIGEAIVKNI-------LALDSNAVVYGIARNEDA--------LKSLKDTV 48
           V LVTGA+RGIG AIV  +       L + S    +   R             ++L   +
Sbjct: 37  VALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRALAIDL 96

Query: 49  GARFQYLAGDITDEDKIN-EIVEKVVLEQGR------------IDSIVANAGVLE--PVA 93
           G   Q+   D+      N  + E++  ++              I  +V  AG+ +  P  
Sbjct: 97  GKWPQWTEQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQASPAL 156

Query: 94  KVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNA------IFVSS---GASTKPY 144
           +     +    ++ +IN+ S + L + +   + +S  +       I VSS      T P 
Sbjct: 157 RCSPEDIL---RITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPKTPPL 213

Query: 145 YGWCAYGSSKAAVNHLTMSLAAE--NKAIKTIAVAPGVV-DTKMQDDIRD 191
            G   Y +SKAA+   +  L+ E     I+  +++P +V DT M   + D
Sbjct: 214 PGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDMIRTLED 263

>Scas_641.31
          Length = 287

 Score = 30.8 bits (68), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 25/131 (19%)

Query: 79  IDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEG-------- 130
           ++ +V  AG+ +    + +S+  E  ++ +INF S + L N     + +S+         
Sbjct: 120 VNLLVNCAGITQDSLSLRTST-DEISQIMNINFLSCVSLSNFVCKKMIRSQNLFKRGEMA 178

Query: 131 -----------NAIFVSS--GASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--IKTIA 175
                        I +SS  G  T    G   Y +SKAA+   T +L+ E +   I+ ++
Sbjct: 179 LDHELPKPPPPCIINISSILGEGTIQVPGTSIYSASKAALIQYTRTLSQETETWGIRALS 238

Query: 176 VAPGVV-DTKM 185
           +APG+V DT M
Sbjct: 239 MAPGLVTDTDM 249

>KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomyces
           cerevisiae YLR100w ERG27 3-keto sterol reductase,
           hypothetical start
          Length = 346

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 46/118 (38%), Gaps = 11/118 (9%)

Query: 92  VAKVGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGW---- 147
           + +VG  S      ++  N F   +LI K LP L+  +G  ++VSS  S   Y       
Sbjct: 134 IQRVGVKSKDGMGLVFQANVFGPYYLIQKLLPLLQAGQGTVVWVSSIMSAPKYLSLQDIQ 193

Query: 148 -----CAYGSSKAAVNHLTMSLAAENK--AIKTIAVAPGVVDTKMQDDIRDKFGPSGM 198
                 +Y  SK  V+ L  +   E K   I+     PG+  +       + F   GM
Sbjct: 194 LLESDVSYEGSKRLVDLLHSATYKEMKKLGIRQYLTHPGIFTSLSFFQYLNVFTYYGM 251

>YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol
           reductase, required for ergosterol biosynthesis [1044
           bp, 347 aa]
          Length = 347

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 87/250 (34%), Gaps = 53/250 (21%)

Query: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIA-------RNEDALKSLKDTVGAR--- 51
           +KV +VTG +  +G  IV  ++  +   V   I        R ++ +  +KD        
Sbjct: 3   RKVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKSGRV 62

Query: 52  ------FQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAG------------------ 87
                 F YL  D T+   +      +  +   I+ +  NA                   
Sbjct: 63  EDLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAAQGIFDGIDWIGAVKEVFT 122

Query: 88  -----VLEPVAK---VGSSSVAEWKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGA 139
                V  P  K   VG  S  +   ++  N F   + I+K LP L + +   +++SS  
Sbjct: 123 NPLEAVTNPTYKIQLVGVKSKDDMGLIFQANVFGPYYFISKILPQLTRGKAYIVWISSIM 182

Query: 140 STKPYYGW---------CAYGSSKAAVNHLTMSLAAENK--AIKTIAVAPGVVDTKMQDD 188
           S   Y             +Y  SK  V+ L ++   + K   I    V PG+  +    +
Sbjct: 183 SDPKYLSLNDIELLKTNASYEGSKRLVDLLHLATYKDLKKLGINQYVVQPGIFTSHSFSE 242

Query: 189 IRDKFGPSGM 198
             + F   GM
Sbjct: 243 YLNFFTYFGM 252

>Kwal_56.23863
          Length = 344

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1  MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIAR-NEDALKSLKDTVGARFQY-LAGD 58
          M + VL+TGA+  + + I+ N+L  +SN  V G  R NE A+K  ++    R +  +  D
Sbjct: 3  MAETVLITGANNYVAQHII-NVLLKNSNYNVIGTVRSNEKAVKLSENFNSDRLKCEVVSD 61

Query: 59 ITDEDKINEIVEK 71
          +  ++  +E+  K
Sbjct: 62 MGSQNAFDEVFSK 74

>KLLA0C19547g 1750548..1751549 some similarities with tr|Q55924
          Synechocystis sp PCC 6803 Hypothetical protein slr0317,
          hypothetical start
          Length = 333

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 2  KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKD 46
          KK +LV GA+  IG  + K++  L ++  V  + R+E+  KS K+
Sbjct: 9  KKAILVVGATSTIGSGVAKSLSKLGASTTV--LVRSEEKGKSFKE 51

>Kwal_14.1653
          Length = 688

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 37  NEDALKSLKDTVGARFQYLAGDITDEDKINEI---VEKVVLEQGR-IDSIVANAGVLEPV 92
           +E+++K LK     R     G    + +IN++   VE VV   GR ID +  N+G L   
Sbjct: 199 HEESMKFLKGNTRLRSICCTGGSELKQQINDLKKGVEIVVATPGRFIDLLTLNSGKLINT 258

Query: 93  AKVGSSSVAEWKKLYDINFFSIIHLINKTL 122
            ++    + E  +L+D+ F   I  I KT+
Sbjct: 259 ERITFVVMDEADRLFDLGFEPQITEIMKTV 288

>CAGL0J05852g complement(554403..555434) weakly similar to sp|P40580
           Saccharomyces cerevisiae YIR036, hypothetical start
          Length = 343

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNE----DALKSLKDTVG---ARFQYL 55
           K  +VTG + G+G+   K  L    N  V G+ R E    +A +S+K  +G        +
Sbjct: 42  KTAVVTGCNTGVGKEAAK--LLYQKNCNVIGVCRTESKGLEAAESIKQEIGNSKGSISVV 99

Query: 56  AG-DITDEDKINEIVEKV--VLEQGRIDSIVANAGVL 89
           +G D  D   + +  +++  +L    ++ I+ NAG++
Sbjct: 100 SGCDFLDFTTVPQAGKRIQEILAGKPLNIIIHNAGLM 136

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 3   KVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDAL----KSLKDTVGARFQYLAGD 58
           K   +TGAS GIG+   + +     N V+  I+R +  L    K L+D      + LA D
Sbjct: 63  KYCAITGASDGIGKEFARQMAKRGFNLVL--ISRTQSKLEALQKELEDQHHVVVKILAID 120

Query: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAG 87
           I ++ + N    K +  Q  I  +V N G
Sbjct: 121 IAEDKESNYESIKELCAQLPITVLVNNVG 149

>Scas_620.13
          Length = 378

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 214 ELLDADVPGKIYARLAVSGIPAELNG 239
           E L  D+  KI +RL +S IP +LNG
Sbjct: 256 EKLMHDILTKIRSRLKLSAIPTKLNG 281

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,567,271
Number of extensions: 311154
Number of successful extensions: 1034
Number of sequences better than 10.0: 114
Number of HSP's gapped: 945
Number of HSP's successfully gapped: 122
Length of query: 246
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 147
Effective length of database: 13,168,927
Effective search space: 1935832269
Effective search space used: 1935832269
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 60 (27.7 bits)