Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06897g25825413360.0
YIR035C25424710271e-142
Scas_685.82522489161e-125
CAGL0F06919g2502497205e-96
ACR171C2512477154e-95
Scas_628.62522477014e-93
YIR036C2632566452e-84
ABR249W2502474948e-62
ABR248W2612514783e-59
ABR247W2502474591e-56
ABR246W2502474425e-54
Sklu_2380.41601404338e-54
KLLA0E08063g1861383593e-42
KLLA0E08052g1171043254e-38
KLLA0E09834g2681891854e-16
AER373C3001931831e-15
Kwal_47.171022851991601e-12
Kwal_14.24442881921574e-12
AFR561W2672001547e-12
CAGL0G08690g2942451521e-11
KLLA0D15521g2562101484e-11
Scas_594.122671961469e-11
Kwal_26.91602671941432e-10
Sklu_2348.52892321414e-10
KLLA0E24046g2802581407e-10
KLLA0F04455g3051931381e-09
Scas_662.43072471372e-09
KLLA0B08371g2681961334e-09
YMR226C2671951301e-08
Sklu_1578.32681971301e-08
YNL202W (SPS19)2951871282e-08
YIL124W (AYR1)2972421273e-08
CAGL0M11242g2681991273e-08
CAGL0J04774g3381951273e-08
KLLA0E13860g8891821241e-07
Scas_666.17*2831901184e-07
Kwal_34.160242921991177e-07
KLLA0D18909g2901381169e-07
Kwal_55.195692882531151e-06
CAGL0H10450g3111931151e-06
AGL060W8911831124e-06
CAGL0H08063g2901911105e-06
KLLA0D02596g3472031098e-06
Scas_613.182861891071e-05
YKL055C (OAR1)2782381071e-05
Scas_655.192971311071e-05
Sklu_268.12442071052e-05
Kwal_23.45723001341043e-05
Sklu_2267.53501931043e-05
KLLA0C12694g2592381034e-05
Scas_641.312871511017e-05
Sklu_2420.53262291009e-05
AAL089W328219963e-04
YDL114W308196963e-04
Scas_478.2920142973e-04
Kwal_14.2598311197954e-04
YKL071W256265945e-04
Kwal_26.7950897186956e-04
Kwal_26.8838323225937e-04
CAGL0L02167g901190930.001
Sklu_1570.1756147910.002
Kwal_14.1511277209870.004
KLLA0E22495g292200860.005
ADL292C329211850.009
YBR265W (TSC10)320214840.011
Scas_650.8326286840.011
Kwal_26.8282298226830.013
Sklu_1624.3316209810.021
YLR426W326200780.061
Sklu_2219.3363202770.082
Scas_721.47344183750.12
Scas_652.19d341100750.14
Scas_652.19d134437740.20
CAGL0H07513g35247730.23
CAGL0K09152g327222730.26
Sklu_1575.1722104700.73
KLLA0B05016g886128681.1
YKR009C (FOX2)900140681.3
Scas_709.36670111671.4
KLLA0D06127g330223652.1
CAGL0J05852g34337652.1
ADR059C35187652.5
YDR430C (CYM1)98990652.5
Kwal_55.21822283205642.9
CAGL0I09328g36356634.0
KLLA0F01749g313207624.7
YBR275C (RIF1)191676634.8
Kwal_27.12155280253625.3
YHR071W (PCL5)22923615.5
AEL164C30760625.8
Scas_692.1247653626.9
KLLA0B09812g346177617.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06897g
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   519   0.0  
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   400   e-142
Scas_685.8                                                            357   e-125
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   281   5e-96
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   280   4e-95
Scas_628.6                                                            274   4e-93
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   253   2e-84
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   194   8e-62
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   188   3e-59
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   181   1e-56
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   174   5e-54
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          171   8e-54
KLLA0E08063g complement(726232..726792) some similarities with s...   142   3e-42
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   129   4e-38
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    76   4e-16
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    75   1e-15
Kwal_47.17102                                                          66   1e-12
Kwal_14.2444                                                           65   4e-12
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    64   7e-12
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    63   1e-11
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    62   4e-11
Scas_594.12                                                            61   9e-11
Kwal_26.9160                                                           60   2e-10
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       59   4e-10
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    59   7e-10
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    58   1e-09
Scas_662.4                                                             57   2e-09
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    56   4e-09
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    55   1e-08
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            55   1e-08
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    54   2e-08
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    54   3e-08
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    54   3e-08
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    54   3e-08
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    52   1e-07
Scas_666.17*                                                           50   4e-07
Kwal_34.16024                                                          50   7e-07
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    49   9e-07
Kwal_55.19569                                                          49   1e-06
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    49   1e-06
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    48   4e-06
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    47   5e-06
KLLA0D02596g join(complement(219682..219797),complement(218659.....    47   8e-06
Scas_613.18                                                            46   1e-05
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    46   1e-05
Scas_655.19                                                            46   1e-05
Sklu_268.1 , Contig c268 57-791 reverse complement                     45   2e-05
Kwal_23.4572                                                           45   3e-05
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            45   3e-05
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    44   4e-05
Scas_641.31                                                            44   7e-05
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        43   9e-05
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    42   3e-04
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    42   3e-04
Scas_478.2                                                             42   3e-04
Kwal_14.2598                                                           41   4e-04
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    41   5e-04
Kwal_26.7950                                                           41   6e-04
Kwal_26.8838                                                           40   7e-04
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    40   0.001
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             40   0.002
Kwal_14.1511                                                           38   0.004
KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candid...    38   0.005
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    37   0.009
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    37   0.011
Scas_650.8                                                             37   0.011
Kwal_26.8282                                                           37   0.013
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            36   0.021
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    35   0.061
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         34   0.082
Scas_721.47                                                            33   0.12 
Scas_652.19d                                                           33   0.14 
Scas_652.19d1                                                          33   0.20 
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    33   0.23 
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    33   0.26 
Sklu_1575.1 YGR198W, Contig c1575 138-2306 reverse complement          32   0.73 
KLLA0B05016g 454717..457377 gi|1709486|sp|P54788|ORC1_KLULA Kluy...    31   1.1  
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    31   1.3  
Scas_709.36                                                            30   1.4  
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    30   2.1  
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    30   2.1  
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    30   2.5  
YDR430C (CYM1) [1253] chr4 complement(1325489..1328458) Putative...    30   2.5  
Kwal_55.21822                                                          29   2.9  
CAGL0I09328g 898234..899325 similar to sp|P38342 Saccharomyces c...    29   4.0  
KLLA0F01749g complement(163821..164762) similar to sp|P38342 Sac...    28   4.7  
YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein inv...    29   4.8  
Kwal_27.12155                                                          28   5.3  
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    28   5.5  
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    28   5.8  
Scas_692.12                                                            28   6.9  
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    28   7.7  

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60
           MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV
Sbjct: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60

Query: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120
           GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS
Sbjct: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120

Query: 121 LVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAV 180
           LVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAV
Sbjct: 121 LVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAV 180

Query: 181 APGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEE 240
           APGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEE
Sbjct: 181 APGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEE 240

Query: 241 INGQYLSFDAEVLK 254
           INGQYLSFDAEVLK
Sbjct: 241 INGQYLSFDAEVLK 254

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  400 bits (1027), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/247 (76%), Positives = 221/247 (89%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KVILVTGVSRGIGKSIVD LFSLDK+ +VYG+ARSEAPLK LK+ YGDRFFY VGDIT D
Sbjct: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             LK+ VN+A++GHGKI+SL+ANAGVLEPVQN+N IDVNAWK+LY+INFFSIVSLV IAL
Sbjct: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P LKKT+G+ +FVSSDA + YFSSWGAYGSSKAALNHFAMTLANEE+ V+A+AVAPGIVD
Sbjct: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           TDMQVNIREN+GP  MS E L+MFR LK++N+LL SS+PATVY+KLAL+GIP+ +NGQYL
Sbjct: 183 TDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242

Query: 247 SFDAEVL 253
           S++   L
Sbjct: 243 SYNDPAL 249

>Scas_685.8
          Length = 252

 Score =  357 bits (916), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/248 (68%), Positives = 211/248 (85%), Gaps = 1/248 (0%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KVI+VTGVSRGIGKSIV+ +F L  + IVYGIARSEAPLKALK+TYGDRFFY  GDIT+ 
Sbjct: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             L+K V+ A +  GKI+S++ANAGVLEPVQ++N+ID++AWK+L++INFFS+VSL  I L
Sbjct: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P+LKKT+G+ +FVSSDASD +FSSWGAY +SKA LN FAMT+ANEE AV+ L+VAPGIVD
Sbjct: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           T MQVNIREN+G    S++H  MF+DLK+ NKLL S++PATVYSKLALNGIP ++NG+YL
Sbjct: 183 TSMQVNIRENVGKDMTSEDH-AMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYL 241

Query: 247 SFDAEVLK 254
           SFD  +LK
Sbjct: 242 SFDDPILK 249

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  281 bits (720), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 185/249 (74%)

Query: 6   QKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITN 65
           +KV+LVTG SRGIG++IV  + +LD N +VYGIAR+E  LK+LKDT G RF Y  GDIT+
Sbjct: 2   KKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDITD 61

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIA 125
           +D + + V   +   G+I+S++ANAGVLEPV  + +  V  WK+LY+INFFSI+ L++  
Sbjct: 62  EDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINKT 121

Query: 126 LPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185
           LPHL+K+ G+A+FVSS AS   +  W AYGSSKAA+NH  M+LA E KA++ +AVAPG+V
Sbjct: 122 LPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVV 181

Query: 186 DTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQY 245
           DT MQ +IR+  GP GM+ + L+ F DLKK+ +LL + +P  +Y++LA++GIP E+NG+Y
Sbjct: 182 DTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEY 241

Query: 246 LSFDAEVLK 254
           + ++   L+
Sbjct: 242 VRYNDSRLQ 250

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  280 bits (715), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 188/247 (76%), Gaps = 3/247 (1%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           ++I+VTGVSRGIG+S+V+ +     + +V G+ARSEA L+ L+ TYG++F Y VGD+ ++
Sbjct: 3   RLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASE 61

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
           D     V  A   +G+I++++ANAGVLEPVQ++N+IDV AW++LY +NFFS+V LV  AL
Sbjct: 62  DAQDALVARAT-AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P LKK  GS +FVSS AS   +S+WGAYGSSKAALNHFAMTLA EE AVRA+AVAPG+VD
Sbjct: 121 PLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGVVD 180

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           T MQ +IR+  G + M+ E L  F +LKK+++LL   IPAT+++ LAL GIP+  NG+YL
Sbjct: 181 TQMQNDIRDKFGHR-MAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYL 239

Query: 247 SFDAEVL 253
            ++ ++L
Sbjct: 240 RYNDDIL 246

>Scas_628.6
          Length = 252

 Score =  274 bits (701), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 186/247 (75%), Gaps = 1/247 (0%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KVI+VTGVSRGIG++IV+ +  L+ N +V+GIAR+ APLK LK  +G++FFY VGD+TN 
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             +KK + +AI+  G+++S++ANAGVLEPV  +  +D  AWK+L++INFFSIVSLV   L
Sbjct: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P ++ T+ + +FVSS AS   +  W AY +SKAALN FAM++ANE+  V+ ++VAPG+VD
Sbjct: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           T MQV+IRE  G + M+ E L+ F DL K+ +LL S +P  VY+KLA+NGIP+E+NG+Y 
Sbjct: 184 TQMQVDIREKYGNE-MTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242

Query: 247 SFDAEVL 253
            ++ + L
Sbjct: 243 RYNDDRL 249

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  253 bits (645), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 178/256 (69%), Gaps = 9/256 (3%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG-DRFFYTVGDITN 65
           KVIL+TG SRGIG  +V T+   D   IVYG+AR+EA L++L+  YG D+F Y V DIT+
Sbjct: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNI----DVNAWKQLYNINFFSIVSL 121
              ++  V    + HGK++ ++ANAG+LEPV++I+      D+  W++L+++NFFSIVSL
Sbjct: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122

Query: 122 VDIALPHLKKTH--GSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKA--VRA 177
           V + LP LK +   G+ +FVSS AS   ++ W AYG SKAALNHFAM +A+EE +  VRA
Sbjct: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182

Query: 178 LAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGI 237
           + +APG+VDT MQ +IRE LGPQGM+ + LE F  L K + LL   +PA V ++L L GI
Sbjct: 183 VCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGI 242

Query: 238 PEEINGQYLSFDAEVL 253
           P+ +NGQYL ++ E L
Sbjct: 243 PDSLNGQYLRYNDERL 258

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  194 bits (494), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 155/247 (62%), Gaps = 4/247 (1%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KVI+VTG SRGIG + VD L S   +V+V G+AR+E  L+ LK  +G +F Y VGD+T++
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS-TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             ++  ++     +G++++++ANAGV    Q I   D+  W++L+ IN FS+V+L   AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P L+K+ G+ + V+S  S     +  AY SSK ALNHFA+ LA EE  +R+LA+ PG+V 
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQ 179

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           TDM             +Q++    R+L K  +++    P TV + LA  GIPEE+NG+Y+
Sbjct: 180 TDMTAAALVAADKAAGTQDN--SVRELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYV 237

Query: 247 SFDAEVL 253
           +FD+E L
Sbjct: 238 TFDSEKL 244

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  188 bits (478), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 154/251 (61%), Gaps = 4/251 (1%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGD 62
           Q   KVI+VTG SRGIG + VD L S  + V+V G+AR+E  L+ LK  +G +F Y VGD
Sbjct: 9   QARMKVIIVTGASRGIGAATVDRLCSTPE-VVVVGVARAETKLQELKARHGKKFDYVVGD 67

Query: 63  ITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLV 122
           +T++  ++  ++    G+G++++++ANAGV    + I + D+  W++L+ IN FS+V+L 
Sbjct: 68  VTDERVVQAVIDKVSSGYGRLDAVVANAGVAGH-ERIEDADIKEWRRLFEINLFSVVNLA 126

Query: 123 DIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAP 182
             ALP L+K+ G+ L VSS  S     +   Y SSK ALNHFAM LA EE  +R +A+ P
Sbjct: 127 SKALPLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDP 186

Query: 183 GIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEIN 242
           G+  TDM  +          +Q++    R++ +  ++     P TV + LA  GIPEE+N
Sbjct: 187 GVAQTDMLTDGLNAADQAAGTQDNAA--REMMRHVRVASPDEPGTVLAALAAKGIPEELN 244

Query: 243 GQYLSFDAEVL 253
           G+++ +D+E L
Sbjct: 245 GKFVVYDSEEL 255

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  181 bits (459), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 150/247 (60%), Gaps = 4/247 (1%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           +V++VTG SRGIG++ V+ L     +V+V G+AR+E  L+ LK  +G +F Y VGD+T++
Sbjct: 2   RVVIVTGASRGIGEATVEKLCP-TADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             ++  ++     +G++++++ANAGV    + I   D+  W++L+ IN FS+V+LV  AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P L+++ G+ + VSS  S     +  AY SSK ALNHFA+ LA EE  +R +A+ PG V 
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQ 179

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           TDM             SQ++    R+L K  ++     P  V + LA  GIPEE+NG+Y+
Sbjct: 180 TDMLAEGINAADEAAGSQDN--AVRELLKQVRVATPEEPGAVLAALAARGIPEELNGKYV 237

Query: 247 SFDAEVL 253
             D+E L
Sbjct: 238 RADSEKL 244

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  174 bits (442), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 154/247 (62%), Gaps = 5/247 (2%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           +VI+VTG SRGIG++ V+ L +   +V+V G+AR+E  LK LK+ YG +F Y  GD+T++
Sbjct: 3   RVIIVTGASRGIGEATVEKLCTA-PDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVTDE 61

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
             ++  ++     +G+++++IANAGV    + I   D+  WK+ + I   S VSLV  AL
Sbjct: 62  SVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSKAL 119

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186
           P L+K+ G+ + V+S  S   + +  +  SSK ALNHF   LA EE A+RA+AVAPG+V 
Sbjct: 120 PMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGVVR 179

Query: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246
           TDM V   +       ++++   F+ + K  +++    P  V + LA+ GIP+E+NG+++
Sbjct: 180 TDMTVEALDASEDAPGARDNF--FKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGRFV 237

Query: 247 SFDAEVL 253
            FD+E L
Sbjct: 238 QFDSEKL 244

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  171 bits (433), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 115/140 (82%), Gaps = 3/140 (2%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKN--VIVYGIARSEAPLKALKDTYGDRFFYTVGDIT 64
           KV+LVTG SRGIG++IV+ L + D N  V+V GIARSE PL A+K  +GD+F Y +GDI+
Sbjct: 3   KVVLVTGASRGIGQAIVNNLCN-DGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDIS 61

Query: 65  NDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDI 124
           +++ LKKYV  AI+  G+I++++ANAGVLEPVQ++NNIDV  WK+L+++NFFSIVSLV +
Sbjct: 62  DEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVSL 121

Query: 125 ALPHLKKTHGSALFVSSDAS 144
           +LPHLKK +G+ +FVSS AS
Sbjct: 122 SLPHLKKFNGNIVFVSSGAS 141

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  142 bits (359), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 103/138 (74%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KV LVTGVSRGIG SIV+ L S++   IV GIARS+  L+ LK  Y  +F Y  GD++++
Sbjct: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62

Query: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
           +T+ + VN     + +++ ++ANAGVL+PV+++NNI ++ WKQL++INFFS+VSLV  AL
Sbjct: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122

Query: 127 PHLKKTHGSALFVSSDAS 144
           P LK+++G+ + VSS AS
Sbjct: 123 PLLKQSNGNIVLVSSGAS 140

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  129 bits (325), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 79/104 (75%)

Query: 151 WGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMF 210
           WGAYG+SKAALNHFA T+A EE AV+A++VAPG+V T MQ +IRE  GP GM++E L+ F
Sbjct: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69

Query: 211 RDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYLSFDAEVLK 254
            DL  +++LL  S+P T+Y+ LA  GIP E++G YL ++ E L+
Sbjct: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLR 113

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 75.9 bits (185), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 91/189 (48%), Gaps = 12/189 (6%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEA-PLKALKDTYGDRFFYTVGDI 63
           +++VIL+TG S GIG SI +TL S    V  +G +R  + P K         F     DI
Sbjct: 2   KKQVILITGASTGIGLSIAETLRSAGYEV--FGTSRKGSIPGKEYS------FKMIKLDI 53

Query: 64  TNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVD 123
           T+++++K  VN  IE  G+I+ L+ NAG+      +     +  K ++  NFF +  +  
Sbjct: 54  TDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTR 113

Query: 124 IALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEK--AVRALAV 180
             LPH++ + HG  + +SS            Y SSK AL  +  +L  E K   +    +
Sbjct: 114 AVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHVSTI 173

Query: 181 APGIVDTDM 189
            P I+ T M
Sbjct: 174 DPHIIKTGM 182

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 99/193 (51%), Gaps = 14/193 (7%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVG-DI 63
           E KV+LVTG S GIG  +   L   ++  +VY  ARS  P++AL+D  G      V  D+
Sbjct: 13  EAKVVLVTGASSGIGYELTKEL--ANRGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDV 70

Query: 64  TNDDT---LKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNA--WKQLYNINFFSI 118
           T+++    L++ ++  I G GK+++L  NAG       +  +DV     ++ + +N F+ 
Sbjct: 71  TDEEQVTKLRRRMSKEIPG-GKLHALFNNAGQ---SCTMPAVDVTPEMIEKCFRVNVFAP 126

Query: 119 VSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEK--AVR 176
           +++     P L + HG+ +F  S A    F     Y ++KAA++ +A  L  E K   VR
Sbjct: 127 MNITREFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGVR 186

Query: 177 ALAVAPGIVDTDM 189
            +    G V T++
Sbjct: 187 VINAVTGGVATNI 199

>Kwal_47.17102
          Length = 285

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 91/199 (45%), Gaps = 22/199 (11%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60
           +S+ +  V +VTG S G+G++IV        NV +  +   E P K+  + Y     YT 
Sbjct: 27  LSKIDNAVCVVTGGSNGLGRAIVQEFLLKLPNVTLISL-DIEPPKKSFPNVY----HYTC 81

Query: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120
            D++N   + + +      HG +  LI NAG+    QN   +      +++ +N F+ + 
Sbjct: 82  -DLSNSSDVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMR 140

Query: 121 LVDIALPH---LKK----THGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLA---N 170
           LV    P    L++    T  SAL V + A  +       YG+SKAA   F    A   +
Sbjct: 141 LVQELSPKAGDLRQFYAVTVASALGVCAPARGS------CYGASKAAAIAFHEAWAQELD 194

Query: 171 EEKAVRALAVAPGIVDTDM 189
           E   +R L V PG +DT M
Sbjct: 195 ETSRIRTLLVTPGQLDTTM 213

>Kwal_14.2444
          Length = 288

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 87/192 (45%), Gaps = 13/192 (6%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDIT 64
           E KV +VTG S GIG  +   L S  K   VY  AR E  L+ L   + +       D++
Sbjct: 3   ELKVAVVTGASSGIGYELTRQLAS--KGYKVYAAARREQRLETLAKEFPELVVPVKLDVS 60

Query: 65  NDDT---LKKYVNSAIEGHGKINSLIANAG--VLEPVQNINNIDVNAWKQLYNINFFSIV 119
             +    L++ +   +    K++ L  NAG     P  ++ N   +  +Q + +N F  V
Sbjct: 61  EPEQIIHLRERLAKELPSQ-KLDVLYNNAGQSCTFPASDVTN---DVLEQAFKVNVFGPV 116

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEK--AVRA 177
           +L    LP + K  G+ LF  S A    F     Y ++K A++ +A  L  E K   VR 
Sbjct: 117 NLCKELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGVRV 176

Query: 178 LAVAPGIVDTDM 189
           L V  G V TD+
Sbjct: 177 LNVVTGGVKTDI 188

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 94/200 (47%), Gaps = 10/200 (5%)

Query: 7   KVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYT---VG- 61
           K++LVTG S GIG++  ++   + D  + +  +AR    L +LK     ++      VG 
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 62  -DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120
            D+T  D ++ ++    E    I+ LI NAG     + +  I ++  ++++N N   +V 
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 121 LVDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVRA 177
           L    LP +K K  G  + V S A    +     Y ++K A+  F   +  E     +R 
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRV 193

Query: 178 LAVAPGIVDTDMQ-VNIREN 196
             +APG V+T+   V +R N
Sbjct: 194 FEIAPGSVETEFSMVRMRGN 213

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 26/245 (10%)

Query: 1   MSQTEQ-KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYT 59
           MSQT++ KV +VTG S GIG  +   L    K   V+  AR  AP++ L +++G      
Sbjct: 1   MSQTQRRKVAVVTGASSGIGYEVTKEL--ARKGFKVFACARRTAPIEPLVNSFGKELIVP 58

Query: 60  VG-DITNDD---TLKKYVNSAIEGHGKINSLIANAG--VLEPVQNINNIDVNAWKQLYNI 113
              DI+  D     K+++ S +    K++ L  NAG     P  +++N   +  +Q + +
Sbjct: 59  HHLDISELDEVLKFKEFLASELPEQ-KLDILYNNAGQSCTFPALDVSN---DVMEQCFKV 114

Query: 114 NFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEK 173
           N F  +++      +L    G+ +F  S A  +       Y ++KAA++ +A TL  E K
Sbjct: 115 NVFGHINMTRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTLHLELK 174

Query: 174 --AVRALAVAPGIVDTDMQVNIRENLG-----PQGMSQEHLEMFRDLKKDNKLLHSSIPA 226
              VR +    G V TD+        G     PQG+  +     + + KDN      +PA
Sbjct: 175 PFGVRVINAITGGVLTDIADKRDLPEGSIYKFPQGI--DAFRTRQTMAKDN----HPMPA 228

Query: 227 TVYSK 231
            VY+K
Sbjct: 229 DVYAK 233

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 96/210 (45%), Gaps = 12/210 (5%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALK-DTYGDRFFYTVGDITN 65
           K+ LVTG S G+G+ I   LF     V++     SE    A   D  G R      D+T 
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGATVVITSRHLSEVQETAGNIDPSGSRVIGKEVDVTV 68

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQN-INNIDVNAWKQLYNINFFSIVSLVDI 124
              ++  +    E  G ++ L+ NAG+  P Q  I + D+++W+Q+ + N       +  
Sbjct: 69  AKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTFYTLKY 128

Query: 125 ALPHLKKTH---GSALFVSSDASDTYFSSWG--AYGSSKAALNHFAMTLANE--EKAVRA 177
           ALP ++ +      A  V+  A +      G   Y ++K A+     ++A E  E+ VR 
Sbjct: 129 ALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYAERNVRV 188

Query: 178 LAVAPGIVDT-DMQVNIRENLGPQGMSQEH 206
            AVAPG V T  +Q   +E    Q MS +H
Sbjct: 189 NAVAPGYVSTPKIQALPKETQ--QWMSSQH 216

>Scas_594.12
          Length = 267

 Score = 60.8 bits (146), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 100/196 (51%), Gaps = 11/196 (5%)

Query: 6   QKVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYT---VG 61
           +K++ +TG S GIG++  ++ + + +  V +  +AR    L+ LK+    ++  +   +G
Sbjct: 13  EKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIG 72

Query: 62  --DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119
             D+T  +T++ ++++  E    I+ LI NAG       + +ID+   K + + N   ++
Sbjct: 73  KLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLI 132

Query: 120 SLVDIALPHL--KKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAV 175
           ++    L H+  KK  G  + + S A    + +   Y +SK A+  F  +L  E     +
Sbjct: 133 NVTQAVL-HIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKI 191

Query: 176 RALAVAPGIVDTDMQV 191
           R + +APGIV+T+  V
Sbjct: 192 RVILIAPGIVETEFSV 207

>Kwal_26.9160
          Length = 267

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 93/194 (47%), Gaps = 9/194 (4%)

Query: 7   KVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRF-----FYTV 60
           K +L+TG S GIG++  ++ L + + N+ +   AR    LK +K  +   F     +   
Sbjct: 14  KTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIGQ 73

Query: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120
            D+T+ D +K ++++  E    I+ LI NAG       +  ID +  + +   N  ++++
Sbjct: 74  LDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALIN 133

Query: 121 LVDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVRA 177
           +    LP  K K  G  + + S A    + +   Y ++K A+  F  +L  E     +R 
Sbjct: 134 MTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRKELINTNIRV 193

Query: 178 LAVAPGIVDTDMQV 191
           + +APG V+T+  +
Sbjct: 194 IEIAPGNVETEFSL 207

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 102/232 (43%), Gaps = 20/232 (8%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYT---VG 61
           E+KV LVTG S GIG  I   L S  K   VY  AR   P+K L++ + ++       V 
Sbjct: 3   EKKVALVTGASSGIGYEITKLLAS--KGYTVYAAARRTTPIKPLEEEFPEKVIAVSLDVS 60

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAG--VLEPVQNINNIDVNAWKQLYNINFFSIV 119
           D+     LK   +  +    K++ L  NAG     P  ++ N  +   +Q + +N F  +
Sbjct: 61  DLQQIQDLKARFSRDLP-DSKLHILYNNAGQSCTFPAVDVGNDKI---EQCFKVNVFGPM 116

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEK--AVRA 177
           +L       +    G+ +F  S A    F     Y S+KAA++ +A  L  E K   V+ 
Sbjct: 117 NLCREMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKPFGVKV 176

Query: 178 L-----AVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSI 224
           +      VA  I DT   +       P+G  +   E  +++ K+NK +  ++
Sbjct: 177 INAITGGVATNIADTRPLLEDSVFNTPEG--RHAFETRQNMAKNNKPMSPAV 226

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 110/258 (42%), Gaps = 40/258 (15%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKA--LKDTYGDRFFYTVGDIT 64
           KV +VTG S GIG ++ + L     ++ V+  + +    +A  L   Y  +       +T
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAVELSAKYNVKVVAYQCPVT 90

Query: 65  NDDTLKKYVNSAIEGHGKINSLIANAGV-------LEPVQNINNIDVNAWKQLYNINFFS 117
            +  +KK +   I+  GKI+  IANAGV       +E  +  +  D + W ++ + +F  
Sbjct: 91  EEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAE--SGTDTDEWNKVIHTDFNG 148

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDASDTYFSS---WGAYGSSKAALNHFAMTLANEEKA 174
           +           K+    ++ +++  S    +       Y ++KA + HFA +LA E   
Sbjct: 149 VYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIHFAKSLAVEWAG 208

Query: 175 -VRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLA 233
             R   V+PG + T +   + E+L                   NK  HS IP      + 
Sbjct: 209 FARVNTVSPGYIATPISNFVDEDL------------------KNK-WHSLIP------MG 243

Query: 234 LNGIPEEINGQYLSFDAE 251
             G+P+E+ G YL F ++
Sbjct: 244 REGLPQELVGAYLYFASD 261

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 86/193 (44%), Gaps = 13/193 (6%)

Query: 4   TEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDI 63
           +E K  LVTG S GIG  +   L  L +   VY  AR   P++ L+  +GDR      D+
Sbjct: 2   SETKYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDV 59

Query: 64  TNDD---TLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNA--WKQLYNINFFSI 118
           +N +    LK  +   +    K++ L  NAG      ++  IDV+       + +N +  
Sbjct: 60  SNQNDITQLKLKLEQELPDQ-KLHLLYNNAGQ---SCSLPAIDVSEEIIDNTFRVNVYGP 115

Query: 119 VSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVR 176
           ++      P +    G+ +F  S A    F     Y +SKAA++ +A  L  E     VR
Sbjct: 116 INSCREFAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGPLGVR 175

Query: 177 ALAVAPGIVDTDM 189
            + +  G V TD+
Sbjct: 176 VINMITGGVATDI 188

>Scas_662.4
          Length = 307

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 107/247 (43%), Gaps = 33/247 (13%)

Query: 6   QKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVG---- 61
           +K  +VTG S GIG  I   L       IVY  AR   P+  L +         +     
Sbjct: 9   RKTAIVTGASSGIGYEITKEL--ARNGFIVYACARRLGPIDDLINDLAPELTTELAKAVI 66

Query: 62  -----DITNDDTLKKYVNSAIE---GHGKINSLIANAG--VLEPVQNINNIDVNAWKQLY 111
                DI+ +D +K++    +E    +GK++ L  NAG     P  ++ N   +  +Q +
Sbjct: 67  KPYQLDISKEDEVKQF-RVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN---DVMEQCF 122

Query: 112 NINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE 171
            +N F  V++      +L +  G+ +F  S A  T F     Y ++KAA++ +A  L  E
Sbjct: 123 KVNVFGHVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHLE 182

Query: 172 EK--AVRALAVAPG-----IVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSI 224
            K   VR + V  G     I DT    +      P+G  ++  E  + + K+    H  +
Sbjct: 183 MKPFGVRVINVVTGGVATNIADTRPLPDDSVYNFPEG--RKAFEYRQSMAKN----HHPM 236

Query: 225 PATVYSK 231
           PA VY+K
Sbjct: 237 PADVYAK 243

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 92/196 (46%), Gaps = 9/196 (4%)

Query: 5   EQKVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRF-----FY 58
           + K I +TG S GIG++  ++ L + + NV +   AR  A L+ LK+     +     + 
Sbjct: 12  QNKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYI 71

Query: 59  TVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSI 118
              D+T  + ++ ++++  E    I+ LI NAG       +  I     K + + N  ++
Sbjct: 72  GQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVAL 131

Query: 119 VSLVDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAV 175
           +++    LP  K K  G  + + S A    + +   Y +SK A+  F  +L  E     +
Sbjct: 132 INVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGI 191

Query: 176 RALAVAPGIVDTDMQV 191
           R + +APG V+T+  +
Sbjct: 192 RVIEIAPGNVETEFSL 207

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 92/195 (47%), Gaps = 9/195 (4%)

Query: 6   QKVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRF-----FYT 59
           +K +L+TG S GIGK+  ++ L + + ++ +   AR    L+ LK T    F        
Sbjct: 13  KKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVA 72

Query: 60  VGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119
             DIT  + +K ++ +  +    I+ L+ NAG       +  I     + +++ N  +++
Sbjct: 73  QLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALI 132

Query: 120 SLVDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVR 176
           ++    LP  + K  G  + + S A    + +   Y +SK A+  F  +L  E     +R
Sbjct: 133 NITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIR 192

Query: 177 ALAVAPGIVDTDMQV 191
            + +APG+V+T+  +
Sbjct: 193 VILIAPGLVETEFSL 207

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 91/197 (46%), Gaps = 15/197 (7%)

Query: 7   KVILVTGVSRGIGKSI-VDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRF-----FYTV 60
           K + +TG S GIG++  ++   + +  + +   AR    L+ LKD     +     +  V
Sbjct: 14  KTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYIGV 73

Query: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVL---EPVQNINNIDVNAWKQLYNINFFS 117
            D+T  + +K +++   E    I+ LI NAG     +PV  I   D+     + N N  +
Sbjct: 74  LDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEG---MINTNVLA 130

Query: 118 IVSLVDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKA 174
           ++++    LP  K K  G  + + S A    + +   Y +SK A+  F  +L  E     
Sbjct: 131 LINITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSLRKELVNTN 190

Query: 175 VRALAVAPGIVDTDMQV 191
           +R + +APG V+T+  +
Sbjct: 191 IRVIEIAPGNVETEFSL 207

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 83/187 (44%), Gaps = 8/187 (4%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGI--ARSEAPLKALKDTYGDR---FFYTVG 61
           KV  VTG +  I +   + L  L     + G    R+E   K +     D+         
Sbjct: 28  KVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANV 87

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121
           D+ N + ++  V   +E  GKI+ +IA A     V +  N+  NA+K + +I+     + 
Sbjct: 88  DVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFNT 146

Query: 122 VDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVRALA 179
               L  LKK+ GS LFVS+          G  G++KA ++  A  LA E     +R+  
Sbjct: 147 AKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNC 206

Query: 180 VAPGIVD 186
           +APG +D
Sbjct: 207 IAPGAID 213

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 105/242 (43%), Gaps = 21/242 (8%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG-DRFFYT 59
           +    +K+ +VTG S GIG  +   L       +VY  AR   P+  L   +G D     
Sbjct: 4   LQSQPKKIAVVTGASGGIGYEVTKEL--ARNGYLVYACARRLEPMAQLAIQFGNDSIKPY 61

Query: 60  VGDITNDD---TLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFF 116
             DI+  +   T   ++ + +   GK++ L  NAG       ++  D  A +Q + +N F
Sbjct: 62  KLDISKPEEIVTFSGFLRANLP-DGKLDLLYNNAGQSCTFPALDATDA-AVEQCFKVNVF 119

Query: 117 SIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKA-- 174
             +++       L K  G+ +F  S A    F     Y +SKAA++ +A  L  E K   
Sbjct: 120 GHINMCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFN 179

Query: 175 VRALAVAPGIVDTDM--QVNIRENL---GPQGMSQEHLEMFRDLKKDNKLLHSSIPATVY 229
           VR +    G V TD+  +  + E      P+G  +E     + + KDNK     +PA  Y
Sbjct: 180 VRVINAITGGVATDIADKRPLPETSIYNFPEG--REAFNSRKTMAKDNK----PMPADAY 233

Query: 230 SK 231
           +K
Sbjct: 234 AK 235

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 98/199 (49%), Gaps = 11/199 (5%)

Query: 3   QTEQKVILVTGVSRGIGKSI-VDTLFSLDKNV-IVYGIAR---SEAPLKALKDTYGDRFF 57
           + + K+  +TG S GIGK+  ++ L + + +V +V G  R    E   K L   Y D   
Sbjct: 10  RLQGKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKI 69

Query: 58  YTVG--DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINF 115
           + +G  D+T+ + +K+++    E    I+ LI NAG       + +ID      + N N 
Sbjct: 70  H-IGKLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNV 128

Query: 116 FSIVSLVDIALPHLKKTH-GSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--E 172
            ++++L  + LP  KK + G  + + S A    + +   Y ++K A+  F  +L  E   
Sbjct: 129 LALINLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELIN 188

Query: 173 KAVRALAVAPGIVDTDMQV 191
             +R + +APG+V+T+  V
Sbjct: 189 TDIRVIEIAPGMVETEFSV 207

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 86/195 (44%), Gaps = 11/195 (5%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60
           +++    ++L+TG S G+G+ I+  L     N+ V  +      L     +   R     
Sbjct: 64  LNELHDPIVLITGGSNGLGRCIIHKLLRSYNNIKVINLD-----LDVQYWSEEARVINIE 118

Query: 61  GDITNDDTLKKYVNS-AIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119
            D+ N D L+  +    +E   KIN LI NAGV        +  ++  +++ NIN +S  
Sbjct: 119 CDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTA 178

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALN--HFAMT---LANEEKA 174
            ++   +P   +     + +SS       S   +Y +SKAA+   H +MT   L      
Sbjct: 179 RILQAIIPRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTNDFLVRGIGN 238

Query: 175 VRALAVAPGIVDTDM 189
           +R L V PG +DT M
Sbjct: 239 IRTLLVLPGQIDTQM 253

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 88/182 (48%), Gaps = 11/182 (6%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KV+++TG   G+GKS           V++  I    A +  +   YG      V D T+D
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSG--SAVAD-THD 370

Query: 67  --DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDI 124
                ++ V +A++  G+++ L+ NAG+L   ++   +  + W  + N++ FS  +L   
Sbjct: 371 IVKEAQQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLFSTFALSKA 429

Query: 125 ALPHLKKTHGSALFVSSDASDTYFSSWGA--YGSSKAALNHFAMTLANE--EKAVRALAV 180
             P   K   S   +++ ++   + ++G   Y ++KAA+  F+ TLA E  ++ +    +
Sbjct: 430 VWPIFLK-QKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALEGTKRGITVNVI 488

Query: 181 AP 182
           AP
Sbjct: 489 AP 490

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 97/213 (45%), Gaps = 21/213 (9%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAP--LKALKDTYGDRFFYTVGD 62
           + +V+++TG   G+G+            V+V  + RS A   ++ +K   G+      GD
Sbjct: 6   KDRVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGE------GD 59

Query: 63  -ITNDDTLK----KYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFS 117
            + N D++       V +AI   G+++ LI NAG+L    +   +    ++Q+ +++   
Sbjct: 60  AVANYDSVSDNGAAIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNG 118

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGA-YGSSKAALNHFAMTLANE--EKA 174
              L   A PH++K     +  +   +  Y +   A Y ++K  L  F  +LA E  +  
Sbjct: 119 AFKLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYN 178

Query: 175 VRALAVAP----GIVDTDMQVNIRENLGPQGMS 203
           +   ++AP     + +  +  NI + LGP+ ++
Sbjct: 179 INVNSIAPLARSAMTENVIPANILKELGPEKIA 211

>Scas_666.17*
          Length = 283

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 85/190 (44%), Gaps = 14/190 (7%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDD 67
            +++TG S G+G +IV    +    + +  + +  +P    +D    R      D++N  
Sbjct: 27  CVVITGGSHGLGHAIVVRFLNKVPKITIINVDKISSP----QD--DPRMVTIQCDLSNQV 80

Query: 68  TLKKYVNSAIEGHG-KINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126
            ++K ++     +G +I  +I NAG+    QN  ++D N   +++ +N F+ V  +   +
Sbjct: 81  EMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQSLV 140

Query: 127 PHLKKTHGSALF--VSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKA-----VRALA 179
           P             V+S       +    YG+SK+AL  F  + + E +      +R L 
Sbjct: 141 PEENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALIAFHQSYSMELQTRRVSNIRTLL 200

Query: 180 VAPGIVDTDM 189
           V PG ++T M
Sbjct: 201 VVPGQLNTAM 210

>Kwal_34.16024
          Length = 292

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 91/199 (45%), Gaps = 22/199 (11%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG-DRFFYTVGDITN 65
           K+++VTG +  IG++I +   S   +V V            L   YG +   Y V DITN
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQV-DITN 98

Query: 66  DDTLKKYVNSAIEGHGK--INSLIANAGVLEPVQNINNIDVN--AWKQLYNINFFSIVSL 121
           D+ ++  + +  +      I++ IANAGV     ++ N      AW+++ ++N       
Sbjct: 99  DEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTFHC 158

Query: 122 V-DIALPHLKKTHGSALFVSSDAS-----DTYFSSWGAYGSSKAALNHFAMTLANE---- 171
             ++A    ++ HG  +  +S +S       Y +    Y +SKAA+ H A   A E    
Sbjct: 159 AQEVAHVFKRQGHGCLILTASMSSHIANVPNYQT---CYNASKAAVRHMARGFAVEFAHL 215

Query: 172 -EKA--VRALAVAPGIVDT 187
            E A  +R  +V+PG  DT
Sbjct: 216 TEPAGRIRCNSVSPGYTDT 234

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121
           D+ N D L + V  AI+  G+++ +IA A     + +  ++  NA+K + +I+     + 
Sbjct: 83  DVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGSFNT 141

Query: 122 VDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVRALA 179
           V    P L KT GS LFVSS             G++KA ++  +  LA E     +R   
Sbjct: 142 VKACFPELVKTKGSVLFVSSTLHYYGVPFQSHVGAAKAGIDALSNALAVEMGPLGLRFNC 201

Query: 180 VAPG-IVDTDMQVNIREN 196
           VAPG I +T+    + +N
Sbjct: 202 VAPGAIANTEGLARLTKN 219

>Kwal_55.19569
          Length = 288

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 103/253 (40%), Gaps = 40/253 (15%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSE--APLKALKDTYGDRFFYTVGDIT 64
           KV  ++G S GIG ++         ++ V+  +  +     K L +TYG R       +T
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKCPVT 98

Query: 65  NDDTLKKYVNSAIEGHGKINSLIANAGV-------LEPVQNINNIDVNAWKQLYNINFFS 117
           ++  +K+ +    +   KI+  +ANAGV       +E  +    +    W++++N +F  
Sbjct: 99  DEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEER--GVATKEWEKVFNTDFQG 156

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDASDTYFSS---WGAYGSSKAALNHFAMTLANEEKA 174
           +     +     KK    +L +++  S    +       Y ++KA + H + +LA E   
Sbjct: 157 VYYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQACYNAAKAGVIHLSRSLAVEWAG 216

Query: 175 -VRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLA 233
             R  +++PG +DT                   +  F + K   +  H   P      L 
Sbjct: 217 FARVNSISPGYIDTP------------------IATFAEAKMKQRW-HELTP------LG 251

Query: 234 LNGIPEEINGQYL 246
             G+PEE+ G YL
Sbjct: 252 REGLPEELVGAYL 264

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 14/193 (7%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDD 67
           V L+TG S G+G  I   L    K+VIV  I     P K L   Y +   Y   DIT+  
Sbjct: 46  VALITGGSGGLGLEIAIALVQRYKSVIV-AIVDVVPPKKQLVKQYPNIIHYRC-DITDSF 103

Query: 68  TLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALP 127
            +       +   GK+N L+ NA +   ++ + ++     +++ N+N  +   LV + +P
Sbjct: 104 QVAHMKKKVLLDFGKVNILVNNAAI-TIIKQLTDMTEAEIQRVINVNLIASYHLVSMFVP 162

Query: 128 HLKKT-HGSALFVSSDASDTYFSSWGAYGSSKAAL----NHFAMTL------ANEEKAVR 176
            +  T +G  + ++S   +   S    YG++K  L    N+    +      A   + ++
Sbjct: 163 EMLYTKNGCIINIASVLGELTPSRLIVYGATKGGLIELHNYLNQQINAHNSYAYNRRGLK 222

Query: 177 ALAVAPGIVDTDM 189
           A+ V PG + T M
Sbjct: 223 AILVCPGKISTTM 235

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 87/183 (47%), Gaps = 9/183 (4%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGD-RFFYTVGDI 63
           + KV+++TG   G+G+S           V+V  +  ++  +  +   YG+ R      +I
Sbjct: 318 KDKVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNI 377

Query: 64  TNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVD 123
             D      V +A++   +++ L+ NAG+L     +   D + W  +  ++  S+ +L  
Sbjct: 378 VTDAA--AVVETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFALSK 434

Query: 124 IALPHLKKTHGSALFVSSDASDTYFSSWGA--YGSSKAALNHFAMTLANE--EKAVRALA 179
              P   +   S + V++ ++   + ++G   Y ++KAA+  F+ +LA E  ++ +R   
Sbjct: 435 AVWPIFMQQR-SGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYV 493

Query: 180 VAP 182
           +AP
Sbjct: 494 IAP 496

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 18/191 (9%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYG-----IARSEAPLKALKDTYGDRFFYTVG 61
           KV  VTG +  I +  V+ L  L   V + G       R    + +L D        +  
Sbjct: 23  KVGFVTGGAGTICRVQVEALVLLGCKVAIIGRDHEKTERVAKEISSLVDNPDAVLPISKV 82

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121
           D+     L+  V   ++ +G+I+ +IA A     + + N++  NA+K + +I+     + 
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 122 VDIALPHLKKTHGSALFVSSDASDTYFSSWGA-----YGSSKAALNHFAMTLANEEK--A 174
               +P L K+ GS LFVS+      F  +G       G++KA ++  +  LA E     
Sbjct: 142 AKATMPELIKSRGSILFVSAT-----FHYYGVPFQSHVGAAKAGIDALSNALAVEMGPFG 196

Query: 175 VRALAVAPGIV 185
           VR+  +APG +
Sbjct: 197 VRSNCIAPGAI 207

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 4   TEQKVILVTGVSRGIGKSIVDTLFS--LDKNVIVYGIARSEAPLKALKDTYGDRFFYTVG 61
           T   V ++TG S G+G  +V +L S   D  +++  +   +  L   K    DR  +   
Sbjct: 81  TADPVCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITK----DRIEFLRC 136

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121
           D+++D+ ++  + +      K++ LI NA +      + ++      ++++ N  S + L
Sbjct: 137 DLSSDEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRL 196

Query: 122 VDIALPHLKKTH----------GSALFVSSDASDTYFSSWGAYGSSKAAL----NHFAMT 167
           +     H KK+            SAL + S A  +       Y +SKAAL      +   
Sbjct: 197 IQAF--HPKKSANNDFYYVVNIASALGIMSPARAS------TYAASKAALISYHESWTYE 248

Query: 168 LANEEKA-VRALAVAPGIVDTDM 189
           L N+    VR L V PG +DT M
Sbjct: 249 LLNDNAMNVRTLLVLPGQMDTQM 271

>Scas_613.18
          Length = 286

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 79/189 (41%), Gaps = 17/189 (8%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDD 67
           V LVTG S G+G  IV  L S    VI+  I        A K        Y   D+ + +
Sbjct: 37  VALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNIQFGADKA-----LTYYKCDVGSQE 91

Query: 68  TLKKYVNSAIEGHGKINSLIANAGV--LEPVQNINNIDVNAWKQLYNINFFSIVSLVDIA 125
            ++K      + H  I+ LI NAG+  L+P+   +  +VN   ++ N+N+     L+ + 
Sbjct: 92  EIEKTYKRISKDHASIHILINNAGITCLKPITEFSKEEVN---KVINVNYLGACKLMHLW 148

Query: 126 LPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTL-----ANEEKAVRALAV 180
           L       G  + ++S       +   AYG+SK  L  F  +L           ++ L V
Sbjct: 149 LS--ANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTNKIKMLLV 206

Query: 181 APGIVDTDM 189
             G + T M
Sbjct: 207 CTGKIRTKM 215

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 93/238 (39%), Gaps = 55/238 (23%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALK------------------ 49
           V +VTG +RGIGK+I   LF    + I+ G  +      A+                   
Sbjct: 6   VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAI 65

Query: 50  -----------DTY-GDRFFYTVGDITND-----DTLKKYVNSAIEGHGKINSLIANAGV 92
                      ++Y G  +F     +        D   K+ N+  E    +N LI  AG+
Sbjct: 66  DFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNN--ERRYYVNLLINCAGL 123

Query: 93  LEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYF---- 148
            +   ++     +  + + N+NF S V++ +I + ++ K+      +S  ++        
Sbjct: 124 TQESLSVRT-TASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNIS 182

Query: 149 ----------SSWGAYGSSKAALNHFAMTLAN--EEKAVRALAVAPGIVD-TDMQVNI 193
                          Y +SKAAL+ F   LA   E + +R   ++PG+V  TDM  N+
Sbjct: 183 SILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNL 240

>Scas_655.19
          Length = 297

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 13/131 (9%)

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121
           D+ N D LK  V   ++  G I+ LIA A     + +  N+  NA+K + +I+     + 
Sbjct: 90  DVRNFDQLKNAVKKTVDTFGHIDYLIAGAAG-NFICDFMNLSPNAFKSVIDIDLLGSFNT 148

Query: 122 VDIALPHLKKTHGSALFVSSDASDTYFSSWGA-----YGSSKAALNHFAMTLANE--EKA 174
           V      L K  GS LFVS+      F  +G       G++KA ++  +  LA E     
Sbjct: 149 VKACASQLIKNKGSVLFVSAT-----FHYYGVPFQLHVGAAKAGIDALSNNLAVELGPLG 203

Query: 175 VRALAVAPGIV 185
           VR+  +APG +
Sbjct: 204 VRSNCIAPGAI 214

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 97/207 (46%), Gaps = 20/207 (9%)

Query: 9   ILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDDT 68
           ++VTG + GIGK+IV+       +VI   +  +E  L  LK++  D    TV D    D 
Sbjct: 7   VIVTGAASGIGKAIVNQCLQEGASVIACDL--NEQALLVLKESLNDS---TVLDTYPMD- 60

Query: 69  LKKYVNSA-----IEG-HGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLV 122
           ++KY   A     +E  H  ++ L+ NAG+    ++I +   +   ++ +IN    +   
Sbjct: 61  VRKYEEVAAFFAYVETEHSDVDGLVNNAGIY-LAKHILDYQEDEIDKVLDINVKGYIYFS 119

Query: 123 DIALPHLKKTHGSALFVS-SDASDTYFSSWGAYGSSKAALNHFAMTLA-NEEKAVRALAV 180
            +    L  +    + V+ S  S    SS   YGSSKAA+     + A N    +R  AV
Sbjct: 120 QMFGKKLFHSQRKGVIVNLSSVSGQEGSSDAIYGSSKAAILGLTKSCAMNFSPYIRVNAV 179

Query: 181 APGIVDTDMQVNIRENLGPQGMSQEHL 207
           AP +V+T M  +I     P+   +E+L
Sbjct: 180 APTMVNTSMMDSI-----PEWRKKEYL 201

>Kwal_23.4572
          Length = 300

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 17/134 (12%)

Query: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAG--VLEPVQNINNIDVNAWKQLYNINFFSIV 119
           D+   + L++ V   +E  G+I+ +IA A    + P    + +  NA+K + +I+     
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAP---FSKLSANAFKSVVSIDLLGSF 149

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGA-----YGSSKAALNHFAMTLANE--E 172
           +     L  L++T GS LFVS+      F  +G       G++KA ++  +  LA E   
Sbjct: 150 NTAKACLAELQRTKGSILFVSAT-----FHYYGVPYQSHVGAAKAGVDALSNALAVELGV 204

Query: 173 KAVRALAVAPGIVD 186
             VR+  +APG ++
Sbjct: 205 SGVRSNCIAPGAIE 218

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 86/193 (44%), Gaps = 19/193 (9%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDT----YGDRFFYTV 60
           E KV+ VTG +  I +   + +  L     + G  + E  +K   +     +G       
Sbjct: 82  EGKVLFVTGGAGTICRVQTEAMVLLGCKAAIVGRDK-EKTIKVAGEISQLGHGTSVLPVY 140

Query: 61  G-DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119
           G D+ +   L+  V+  +   G+I+ +IA A     + +  N+  NA+K + +I+     
Sbjct: 141 GVDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSVVSIDLLGSF 199

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGA-----YGSSKAALNHFAMTLANEEK- 173
           + V    P LKK  G+ +FVS+      F  +G       G++KA ++  +  LA E   
Sbjct: 200 NTVKACFPQLKKNKGAIIFVSAT-----FHYYGVPFQSHVGAAKAGIDALSNALAVELGV 254

Query: 174 -AVRALAVAPGIV 185
             +R+  +APG +
Sbjct: 255 LGIRSNCIAPGAI 267

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 95/238 (39%), Gaps = 46/238 (19%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYG-----IARSEAPLK---------------- 46
           V +V+G +RGIG  I D L     +VI  G     + +++  +K                
Sbjct: 6   VSIVSGATRGIGSKIRDELLLSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFKG 65

Query: 47  --ALKDTYGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDV 104
                DT   +F    G I         +    +   +++ L+  AG+ +    I   + 
Sbjct: 66  WPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAI-KANT 124

Query: 105 NAWKQLYNINFFSIVSLVDIALPHL---KKTHGS-------ALFVSSDASDTYFSSWGAY 154
           N    + N+NF S VSL  +AL  +    K HG        A  +   +S+        Y
Sbjct: 125 NEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNIIVPGTAMY 184

Query: 155 GSSKAALNHFAMTLANEEK--AVRALAVAPGIVD-TDM--------QVNIRENLGPQG 201
            +SKAA+  +   L+ E K  ++    ++PG+V+ TDM        Q  +RE L P G
Sbjct: 185 SASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDMIKTLDPEIQQKLREKL-PNG 241

>Scas_641.31
          Length = 287

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 72/151 (47%), Gaps = 29/151 (19%)

Query: 83  INSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLV-----------------DIA 125
           +N L+  AG+ +   ++     +   Q+ NINF S VSL                  ++A
Sbjct: 120 VNLLVNCAGITQDSLSLRT-STDEISQIMNINFLSCVSLSNFVCKKMIRSQNLFKRGEMA 178

Query: 126 LPH-LKKTHGSALF-VSSDASDTYFSSWGA--YGSSKAALNHFAMTLANEEK--AVRALA 179
           L H L K     +  +SS   +      G   Y +SKAAL  +  TL+ E +   +RAL+
Sbjct: 179 LDHELPKPPPPCIINISSILGEGTIQVPGTSIYSASKAALIQYTRTLSQETETWGIRALS 238

Query: 180 VAPGIV-DTDMQVNIRENLGPQGMSQEHLEM 209
           +APG+V DTDM   I+E + PQ   Q +L M
Sbjct: 239 MAPGLVTDTDM---IQE-MDPQTRQQLNLLM 265

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 98/229 (42%), Gaps = 47/229 (20%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIAR-------------SEAPLKALK 49
           Q E+KV LVTG + GIG   V  L+      IVY   R             +EA  +  K
Sbjct: 15  QKERKVALVTGGNSGIGWYTVLHLYM--HGFIVYVGGRNSSRVNQAIKAIQNEAKSRQRK 72

Query: 50  DTYG----DRFFYTVGDITND-DTLKKYVNSAIEGHG---KINSLIANAGVLE-PVQNIN 100
            T+     +R F  +  ++ D   L+    +A +  G    ++ LI NAGV+  P +   
Sbjct: 73  STFKGLKLERNFGKLHFLSLDLSDLRSVDKAAAKFKGLELSLDVLINNAGVMALPYE--- 129

Query: 101 NIDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASD---TYFS-------- 149
            I  + ++     N+ S   L    LP +K+ +G  + VSS   +   TYF+        
Sbjct: 130 -ITKDGFEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSIGHNLEFTYFNLNRDFNYM 188

Query: 150 -----SWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVDTDMQVNI 193
                +W  Y  +K AL  F   LA +   V  ++V PG+V   M+ N+
Sbjct: 189 PNIIFTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV---METNL 234

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 86/219 (39%), Gaps = 39/219 (17%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGI--ARSEAPLKALKDTYGDR----- 55
           + E+KV LVTG + GIG   V  L+     V V G   +R    +K +K    +R     
Sbjct: 16  RVERKVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQEAENRLETAR 75

Query: 56  -------------FFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNI 102
                          Y   D+T+  +++K           ++ LI NAGV+     + + 
Sbjct: 76  QDPHDELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYELTH- 134

Query: 103 DVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSS----------------DASDT 146
             + ++     N+ S   L    LP++K++ G  + +SS                D    
Sbjct: 135 --DGFEVQMQTNYVSHFLLTMRLLPYVKRSGGRVVTLSSIGHKIQFTYCPLDCHFDYRPN 192

Query: 147 YFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185
            F +W  Y  +K A   F   LA +   V  +AV PG+V
Sbjct: 193 IFFTWLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 93/196 (47%), Gaps = 19/196 (9%)

Query: 10  LVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDDTL 69
           L+TG S G+G  +   L      VIV  I     P  A +  Y + F+Y   DIT+ D +
Sbjct: 42  LITGGSSGLGFELAKELSRRINKVIVADI--QSFPTFA-QVEYNNIFYYQC-DITSLDEI 97

Query: 70  KKYVNSAIEGHGKINSLIANAGV--LEPVQNINNIDVNAWKQLYNINFFSIVSLVD-IAL 126
           K    +    HG IN +I NAGV  ++ ++++ N +V   +QL +IN      ++   A 
Sbjct: 98  KNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEV---EQLIDINLIGAYRIISTFAE 154

Query: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAAL--------NHF-AMTLANEEKAVRA 177
             +    G  + ++S   +   +   +YG+SK A+         HF +++    +  ++ 
Sbjct: 155 DMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKT 214

Query: 178 LAVAPGIVDTDMQVNI 193
           L V PG + T+M +++
Sbjct: 215 LLVCPGKIKTNMFIDV 230

>Scas_478.2
          Length = 920

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG-DRFFYTVGDITN 65
           KV+++TG + G+GKS           VI+  I   E  +  +   +G D  F    +I  
Sbjct: 326 KVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNIIT 385

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIA 125
           +  L   V +AI+  G ++ L+ NAG+L   ++   +    W  +  ++  +  ++    
Sbjct: 386 ESEL--VVKTAIDHFGHVDILVNNAGILRD-KSFLKMTEKEWYPVLQVHLQATFAMCKAV 442

Query: 126 LPHLKKTHGSALFVSSDASDTY 147
            PH  K +   +  ++  S  Y
Sbjct: 443 WPHFSKQNSGFIINTTSTSGIY 464

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 12/140 (8%)

Query: 73  VNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPHLK-K 131
           + +AI+  GKI+ LI NAG+L  V + N +    ++ + +++      L   A P++K +
Sbjct: 86  IKTAIDNFGKIDILINNAGILRDV-SFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKAQ 144

Query: 132 THGSALFVSSDASDTYFSSWGA--YGSSKAALNHFAMTLANEEKAVRAL--AVAP----G 183
             G  +  +S A    F ++G   Y ++K  L   A TLA E      L  ++AP     
Sbjct: 145 KFGRIINTASPAG--LFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAPLARSR 202

Query: 184 IVDTDMQVNIRENLGPQGMS 203
           + +  +  +I + LGP+ ++
Sbjct: 203 MTENVLPPHILKQLGPEKIA 222

>Kwal_14.2598
          Length = 311

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 81/197 (41%), Gaps = 25/197 (12%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLK-ALKDTYGDRFFYTVGDITN 65
           +V+L+ G S+G+GK+     ++   N  V  ++RS   L+ A+ D  G +   T  ++  
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSGLK---TAPELLP 65

Query: 66  DDTLKK------YVNSAIEGHGKINSLIAN--AGVLEPVQNI---NNIDVNAWKQL---- 110
           D  + K      Y    +  + ++  L  +  A  LEP Q +          +K L    
Sbjct: 66  DTEIPKNGNHIWYSPCDLAEYAQVEKLYESLKACSLEPTQVLLCAGGSTPGLFKDLQGPE 125

Query: 111 ----YNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAM 166
                 +N+ + V+L  IA+ H   +H   +F SS+ +   F  +  Y   K ++     
Sbjct: 126 LELGVRVNYMTCVNLAHIAVCHWPTSH--LVFFSSEVAFFPFIGYSQYAPLKQSIKSLVA 183

Query: 167 TLANEEKAVRALAVAPG 183
            L  E    R   V PG
Sbjct: 184 ILRQECPQQRISCVYPG 200

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 110/265 (41%), Gaps = 29/265 (10%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEA-PL-KALKDTYGDR--F 56
           M+ + +    + G SRGIG ++V  L +   N ++  I  S + P  K ++D    R   
Sbjct: 1   MNTSSRITYFIIGGSRGIGFNLVKILSASTGNTVITSIRGSPSLPKNKQVEDLAKIRKNI 60

Query: 57  FYTVGDITNDDTLKKYVNSAIEG--HGKINSLIANAGVLEPVQNINNIDVNAWKQLYNIN 114
                D+T D+++    +   +      I+  IA + V +    +     + W   Y+ N
Sbjct: 61  HIVQLDLTKDESIGNIADEIKKTPFFLGIDIFIACSAVSDSYYKVLETPKSVWLNHYSTN 120

Query: 115 FFSIVSLVDIALPHL--KKTHGSALFVSSDA-SDTYFS--SWGAYGSSKAALNHFAMTLA 169
               +  +    P L  KKT     F+SS A S   F   S  AYG SKAALN+   TL+
Sbjct: 121 ALGPILALQKVYPLLLLKKTR-KIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLS 179

Query: 170 NEEK--AVRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPAT 227
            E K      +A  PG+V TD             M Q  L+ F++   D   ++   P  
Sbjct: 180 FELKPEGFTVVAFHPGMVSTD-------------MGQYGLDHFKEKNIDISGVNIITPEE 226

Query: 228 VYSKL--ALNGIPEEINGQYLSFDA 250
             S L      I  E NG++ ++D 
Sbjct: 227 SASALIDVFRKILPEDNGKFFNYDG 251

>Kwal_26.7950
          Length = 897

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (41%), Gaps = 19/186 (10%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           KV+++TG   G+G+S   T       V+V  I      +  ++  YG      V D    
Sbjct: 325 KVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRN--SAVAD--KH 380

Query: 67  DTLK---KYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVD 123
           D +K   + V SA +  G+++ L+ NAGVL   ++   +    W+ +  ++ FS   L  
Sbjct: 381 DVVKDPGEIVKSAFQTFGRVDILVNNAGVLRD-RSFAKMSDEEWEIVLKVHLFSTFGLCK 439

Query: 124 IALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNH-----FAMTLANE--EKAVR 176
              P   K     +  ++  S  Y    G +G +  A        F+ TLA E  +  +R
Sbjct: 440 AVWPIFVKQKSGYIINTTSTSGIY----GNFGQANYAAAKAAVLGFSKTLALEGSKHNIR 495

Query: 177 ALAVAP 182
              VAP
Sbjct: 496 VNIVAP 501

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query: 73  VNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPHLKKT 132
           V +A++  G+++ +I NAG+L    +  N+  +A+  + +++     +L   A PH+K  
Sbjct: 86  VQTAVDNFGRVDIIINNAGILRD-SSFANMSDSAFASVVDVHLTGAYNLTRAAWPHMKNQ 144

Query: 133 HGSALFVSSDASDTYFSSWGA-YGSSKAALNHFAMTLANE 171
               +  +   +  Y +   A Y ++K  L  F+ TLA E
Sbjct: 145 KFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETLAQE 184

>Kwal_26.8838
          Length = 323

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 93/225 (41%), Gaps = 42/225 (18%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDT----------- 51
           + ++KV LVTG + GIG   V  L+     V V G   S    +A+KD            
Sbjct: 15  RKDRKVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVN-RAIKDIKKEARTRIKKE 73

Query: 52  -------YGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDV 104
                   G+ +F ++ D+T    + K          +++ LI NAGV+    ++     
Sbjct: 74  DPESRHPVGELYFLSL-DLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTE--- 129

Query: 105 NAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASD---TYFS------------ 149
           + ++     N+ +   L    LP +K+  G  + VSS   +   +YFS            
Sbjct: 130 DGFEIQLQTNYIAHFLLTMRLLPSVKRCRGRIITVSSIGHNLEFSYFSLAQSFNYKPNML 189

Query: 150 -SWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVDTDMQVNI 193
            +W  Y  +K A   FA  LA +   V  ++V PG+V   M+ N+
Sbjct: 190 FTWMRYAMAKTASIQFAKMLAIKHPDVLCMSVHPGLV---MKTNL 231

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 15/190 (7%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60
           ++  + KV+++TG   G+GKS           V+V  I      +  +   YG+     +
Sbjct: 318 ITSLKDKVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEG--RAI 375

Query: 61  GDITNDDT-LKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIV 119
            D  N  T   + + +A++ +G+++ L+ NAG+L     +   D   W  +  ++ +S  
Sbjct: 376 PDTHNVVTEANQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWFAVVQVHLYSTF 434

Query: 120 SLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNH-----FAMTLANE--E 172
            L     P   K  G  +  ++  S  Y    G +G +  A        F+ T+A E  +
Sbjct: 435 LLSKAVWPIFLKQKGGHIINTTSTSGIY----GNFGQANYAAAKAAILGFSRTIAVEGAK 490

Query: 173 KAVRALAVAP 182
           + +R   +AP
Sbjct: 491 RGIRVNIIAP 500

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 73/147 (49%), Gaps = 12/147 (8%)

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIA 125
           +D  ++ V +AI+  G+I+ LI NAG+L  V +   +    +  + +++      L   A
Sbjct: 77  NDNGEQIVETAIKAFGRIDILINNAGILRDV-SFAKMTEKEFSAVLDVHLTGAYRLTKAA 135

Query: 126 LPHLKKTH-GSALFVSSDASDTYFSSWGA--YGSSKAALNHFAMTLANE--EKAVRALAV 180
            P++++   G  +  +S A    F ++G   Y ++K  L  FA TLA E  +  +   ++
Sbjct: 136 WPYMRQQKFGRIINTASPAG--LFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSI 193

Query: 181 AP----GIVDTDMQVNIRENLGPQGMS 203
           AP     + +  +  +I + LGP+ ++
Sbjct: 194 APLARSRMTENVLPPHILKQLGPEKIA 220

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 14/147 (9%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG------DRFFYTV 60
           K+++VTG   G+G+S           V+V  I   E  +  +   YG      D+     
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGGGSAIPDKH---- 240

Query: 61  GDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVS 120
            D+    T  + V +A+E  G+++ L+ NAG+L     +   D   W  +  ++ FS   
Sbjct: 241 -DVVTQPT--EIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTYG 296

Query: 121 LVDIALPHLKKTHGSALFVSSDASDTY 147
           L     P   K     +  ++  S  Y
Sbjct: 297 LSKAVWPVFLKQRSGYIINTTSTSGIY 323

>Kwal_14.1511
          Length = 277

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 83/209 (39%), Gaps = 27/209 (12%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIA----RSEAPLKALKDTYGD---RFFYT 59
           K IL+TG ++GIGK+I   L      + +  +     +++A LK +K+         F  
Sbjct: 3   KTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIFLP 62

Query: 60  VGDITNDDTLKKYVNSAIEGHGKINSLIANAGV-------------LEPVQNINNIDVNA 106
           + D++N +++   V+      G  + +I NAG+             L+ +  IN   V  
Sbjct: 63  I-DVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVAKILEATPEELDRIMKINVGGVLY 121

Query: 107 WKQLYNINFFSIVSLVDIALPHL----KKTHGSALFVSSDASDTYFSSWGAYGSSKAALN 162
             Q     F  +    D     +    KK  G  +   S A +    S G Y SSK A+ 
Sbjct: 122 GTQAATRKFVELNRAGDYTPATVKTASKKLTGKIINCCSIAGNEAIGSLGLYCSSKFAVK 181

Query: 163 HFAMTLANE--EKAVRALAVAPGIVDTDM 189
                 A E     +   A APGIV T M
Sbjct: 182 CLTQASAKELAPLGITVNAYAPGIVLTPM 210

>KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candida
           albicans putative sorbitol utilization protein (by
           homology), start by similarity
          Length = 292

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 93/200 (46%), Gaps = 24/200 (12%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKA--LKDTYG-DRFFYTVGDI 63
           K+ ++TG +  IG ++ +   S   +VI+  + R+  P  +  L  TYG +   Y V DI
Sbjct: 40  KLTVITGGAGAIGGALCEGFASCGSDVII--LDRTFQPELSVHLSKTYGIESKSYQV-DI 96

Query: 64  TNDDTLKKYVNSAIEGH-GK-INSLIANAGVLEPVQNINN--IDVNAWKQLYNINFFSIV 119
           TN D +K      +E   G+ IN+ IANAG+     +I N       W+++ ++N     
Sbjct: 97  TNADDVKFVFERILEDFPGRAINTFIANAGIAWTNGSILNDGSTPEMWRRVMDVNVQGTY 156

Query: 120 SLVDIALPHLK-KTHGSALFVSSDASDTYFSS----WGAYGSSKAALNHFAMTLANEEKA 174
                A    K + HG+ +  +S +S  Y S+       Y +SKAA+ H A   A E   
Sbjct: 157 HCSRYAAEVFKNQGHGNLILTASMSS--YISNVPNYQTCYNASKAAVRHMAKGFAVEFSG 214

Query: 175 -------VRALAVAPGIVDT 187
                  +R  +V+PG  DT
Sbjct: 215 LTSPAGKIRCNSVSPGYTDT 234

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 84/211 (39%), Gaps = 28/211 (13%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDIT 64
           ++ + LVTG + G+GK IV  L       ++  +     P   L+   G  F+    DI+
Sbjct: 59  KRDIALVTGGAGGLGKEIVRELRRRQIVTVILDV----VPPPDLESLTGVHFYAC--DIS 112

Query: 65  NDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDI 124
               ++    + I   G +  LI NA +   +  ++ +D +  +Q+  +N     +L+  
Sbjct: 113 LPGRIRVIHENIIRDVGHVTILINNAAITSDLP-LDRVDNDKIEQIIRVNLLGPYTLIRE 171

Query: 125 ALPHLKKT-HGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE------------ 171
            LP +     G  + ++S       +   AYG+SK  L     +L +E            
Sbjct: 172 FLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDELEQYTWKDSSNP 231

Query: 172 --------EKAVRALAVAPGIVDTDMQVNIR 194
                      +R+L V PG + T M  N R
Sbjct: 232 GYVPLLKSRGVIRSLLVCPGKLTTKMFDNAR 262

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 88/214 (41%), Gaps = 35/214 (16%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPL----------KALKDTYGD 54
           E +V+L+TG S+G+GK      ++  +N  +  ++RSEA L            L+    D
Sbjct: 6   EDQVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIEAHLRRETTD 65

Query: 55  ----------------RFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEP--V 96
                           R FY   D++  ++++   N+  +        +  AG   P   
Sbjct: 66  EGQVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGAVPKLF 125

Query: 97  QNINNIDVNAWKQLYNINFFSIVSLV-DIALPHLKKTHGSALFVSSDASDTY-FSSWGAY 154
           + ++  ++N      +IN+ + +++   IAL    K H   L + S A+  Y F  +  Y
Sbjct: 126 RGLSGHELNLG---MDINYKTTLNVAHQIALAEQTKEH--HLIIFSSATALYPFVGYSQY 180

Query: 155 GSSKAALNHFAMTLANEEKAVRALAVAPGIVDTD 188
             +KAA+      L  E    R   V PG  +++
Sbjct: 181 APAKAAIKSLVAILRQELTNFRISCVYPGNFESE 214

>Scas_650.8
          Length = 326

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 107/286 (37%), Gaps = 49/286 (17%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYG-------------IARSEAPLKAL- 48
           + ++KV ++TG + GIG   V  L+     V + G                +EA L  L 
Sbjct: 13  EVDRKVAVITGGNSGIGWYTVLHLYMHGFTVYLCGRTSHKIKKAINEITIEAEARLGLLE 72

Query: 49  -------KDTYGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINN 101
                  KD +     Y   D+T+   ++K     ++   KI+ LI NA +L     +  
Sbjct: 73  KEVDDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTK 132

Query: 102 IDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSS----------------DASD 145
              + ++     N+ +   L    LP +KK HG  + + S                D   
Sbjct: 133 ---DGFEIQLQTNYIAHFLLTMRLLPAIKKCHGRIITLGSLGHRLEVTYWNLNKKWDYKP 189

Query: 146 TYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVDTDMQVNIRENLGPQGM--- 202
               +W  Y  +K A   +   L+ +   V  L++ PG+V      +    L   GM   
Sbjct: 190 NMIFTWFRYAVAKTASIQYTKMLSIKYPEVLCLSLHPGLVMNTNLFSYWTRLPIVGMFFW 249

Query: 203 -SQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYLS 247
              + +  F  +  +   L     AT++  L+ +  PE  NG+Y +
Sbjct: 250 LFFQIIGYFVGVSNEQGSL-----ATLHCALSPDLTPERDNGKYFT 290

>Kwal_26.8282
          Length = 298

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 89/226 (39%), Gaps = 49/226 (21%)

Query: 8   VILVTGVSRGIGKSIVDTLFSLDKNVIVYGIA---------RSEAPL--------KALKD 50
           V LVTG +RGIG++IVD L   DK V    I          R   P         +AL  
Sbjct: 37  VALVTGATRGIGRAIVDKLA--DKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRALAI 94

Query: 51  TYGDRFFYTVGDITNDDTL------KKYVNSA-------IEGHGKINSLIANAGVLE--P 95
             G    +T  D+            + Y   A       I     I  L+  AG+ +  P
Sbjct: 95  DLGKWPQWTEQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQASP 154

Query: 96  VQNINNIDVNAWKQLYNINFFSIVSLVDIALPHLKK------THGSALFVSS---DASDT 146
               +  D+    ++ NIN+ S V+L  ++   + +      T    + VSS   D    
Sbjct: 155 ALRCSPEDI---LRITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPKTP 211

Query: 147 YFSSWGAYGSSKAALNHFAMTLANE--EKAVRALAVAPGIV-DTDM 189
                  Y +SKAAL  ++  L+ E     ++  +++P +V DTDM
Sbjct: 212 PLPGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDM 257

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 35.8 bits (81), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 80/209 (38%), Gaps = 35/209 (16%)

Query: 5   EQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPL-KALKDTYGD--------- 54
           + + +LV G S+G+GK      F+      V  ++RS A L  A+KD  G          
Sbjct: 10  DHQTLLVAGGSQGLGKQFACKYFAEGTANTVIVVSRSAAKLAAAVKDITGQDAQELTVDL 69

Query: 55  -------RFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPV--------QNI 99
                    FY   D+++    +K     +E +     ++  AG   P         + +
Sbjct: 70  EFDSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTPKLFKDLTGDELV 129

Query: 100 NNIDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKA 159
             + VN    +  +N   +++    +LPH+       +F SS+ +   F  +  Y   K 
Sbjct: 130 TGVQVN---YMTCLNLAHVLARKHSSLPHV-------IFFSSETAFFPFIGYSQYAPMKQ 179

Query: 160 ALNHFAMTLANEEKAVRALAVAPGIVDTD 188
           ++    M L  E    R   V PG  +++
Sbjct: 180 SIKALVMILRQEFPESRISCVYPGNFESE 208

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 34.7 bits (78), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 89/200 (44%), Gaps = 21/200 (10%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLK--ALKDTYGDRFFY 58
           + + +  ++L+TG S+G+G++IV  L     N+ +  +    + ++   +KD        
Sbjct: 65  LREFKNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKD-------- 116

Query: 59  TVGDITNDDTLKKYVNSAIEGH-GKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFS 117
            + D+++D+ +   +N     +  +I  ++ NAGV       N ++ +   +++ IN F+
Sbjct: 117 LICDLSDDEEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFA 176

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDAS-------DTYFSSWGAYGSSKAALNHFAMTLAN 170
            +  +    P    T     ++ + AS           +   +  +  A    ++  L N
Sbjct: 177 PLQFIQELAPSRHSTRQC--YIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQN 234

Query: 171 E-EKAVRALAVAPGIVDTDM 189
           E  + +R L V PG ++T+M
Sbjct: 235 EGVRNIRTLLVTPGQLNTEM 254

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 34.3 bits (77), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 23/202 (11%)

Query: 10  LVTGVSRGIGKSIVDTLFSLD-KNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITNDDT 68
           L+TG S G+G  IV     L+ K  I+  +   +      +       FY   DI+N   
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPCDISNPKE 146

Query: 69  LKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPH 128
           + +        HG +  LI NAG+    + +  +     ++   +N+ S    +   LP 
Sbjct: 147 IAELHKKIKLQHGNVTILINNAGITSGYR-LQELSDKVIEKTIQVNYVSAFYTIQEFLPD 205

Query: 129 L-KKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE---------------- 171
           +   + G  + V+S       +   AYG+SK  L      L NE                
Sbjct: 206 MVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIKRTRPQDSLHNL 265

Query: 172 ----EKAVRALAVAPGIVDTDM 189
               +  ++AL V PG + T +
Sbjct: 266 SPRSKIPIKALLVCPGKIKTPL 287

>Scas_721.47
          Length = 344

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 78/183 (42%), Gaps = 26/183 (14%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66
           K  +VTG S GIGK   + + +   N+++  I+R+ + L+ALK+ +  ++   V  +  D
Sbjct: 63  KYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEFEKKYGIKVEILAID 120

Query: 67  ---DTLKKYVNSAIEGHGK---INSLIANAGVL------------EPVQNINNIDVNAWK 108
              D+   Y    I+G  K   I  LI N G              E ++NI  I+  A  
Sbjct: 121 ISSDSQDNY--EFIKGLCKDLPITVLINNVGQSHSIPVPFLETEEEELRNIITINNTATL 178

Query: 109 QLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTL 168
            +  I    I  ++   +   KK+ G  L + S            Y  SKA L  ++ +L
Sbjct: 179 LITQI----IAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWSTSL 234

Query: 169 ANE 171
           A E
Sbjct: 235 AGE 237

>Scas_652.19d
          Length = 341

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDIT-- 64
           K  L+TG + GIG  ++  L+S + N+I   + RS    +A K    +++  + G I+  
Sbjct: 42  KTALITGTNTGIGFEVMKLLYSKNCNII--AVVRSAEKGEAAKKEAIEKYPNSKGSISVV 99

Query: 65  --NDDTLKKYVNSAIE------GHGKINSLIANAGVLEPV 96
             ND      V  A E      G   +N +I NAG++ PV
Sbjct: 100 GGNDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPV 139

>Scas_652.19d1
          Length = 344

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 7  KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEA 43
          K  +VTG + GIGK +V+ L+  + NVI  G+ R++A
Sbjct: 42 KTAVVTGCNTGIGKHVVELLYQKNCNVI--GVVRTDA 76

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 10  LVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRF 56
           +VTG S GIGK     L S   N+++  I+R+E+ L ALKD    +F
Sbjct: 66  VVTGASDGIGKEFASQLASKGFNLVL--ISRTESKLVALKDELEGKF 110

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 88/222 (39%), Gaps = 44/222 (19%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYG-----------------IARSEAPL 45
           Q + +V +VTG + GIG   V  L+     V V G                 + R    L
Sbjct: 14  QVDDRVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYL 73

Query: 46  KALKDTYGDRFFYTVGDITNDDTLKKYVNSA------IEGHGKINSLIANAGVLEPVQNI 99
           K L D    R+  ++  +  D T  K V+ A      +E H  ++ L+ NAGV+     I
Sbjct: 74  KGLHDQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENH--LDVLVNNAGVMAVPYEI 131

Query: 100 NNIDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSS------------DASDTY 147
                + ++     N+ +   L    LP L+ +HG  + +SS            D +  Y
Sbjct: 132 TK---DGFEIQMQTNYIAHFLLTMRLLPLLRCSHGRVVTLSSLGHHIIFKYSKLDETWNY 188

Query: 148 FS----SWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185
           F     +W  Y  +K A   +   LA +   +  ++V PG+V
Sbjct: 189 FPNFVFTWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>Sklu_1575.1 YGR198W, Contig c1575 138-2306 reverse complement
          Length = 722

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 11/104 (10%)

Query: 87  IANAGVLEPVQNINN-IDVNA-WKQLYNINFFSIVSLVDI---ALPHLKKTHGSALFVSS 141
            +   V E + N  N I+ N+ + +L N N++ +VS++D     L H+K +H    F  S
Sbjct: 262 FSKKNVKESILNFTNFINYNSRFYELNNKNYYDVVSVIDAYNHVLSHVKNSHIEGKFSIS 321

Query: 142 DASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185
           DA   +      +   K    HF + L   EK+   L+ +P ++
Sbjct: 322 DALSQF------HDLLKQFYGHFGIPLIVTEKSSDWLSNSPRLI 359

>KLLA0B05016g 454717..457377 gi|1709486|sp|P54788|ORC1_KLULA
           Kluyveromyces lactis Origin recognition complex subunit
           1, start by similarity
          Length = 886

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 15/128 (11%)

Query: 60  VGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNIN--FFS 117
           V +I N+   K+Y++S  EG    N  +  +  L    N+ ++D++ +++    +    S
Sbjct: 152 VANIKNE---KEYLDSVNEGKMDSNMFLCRSACLPSGTNLADLDIHFFEEKIRSSNPKVS 208

Query: 118 IVSLVDIALPHL------KKTHGSALFVS----SDASDTYFSSWGAYGSSKAALNHFAMT 167
           +  L DI LP L       K H     V+    SD + +  S       + A +   A T
Sbjct: 209 LEYLRDITLPKLPKPLNKSKVHAREKVVATKLQSDNTPSKKSFQQTVSKTNAEVQRIAST 268

Query: 168 LANEEKAV 175
           + NE++A+
Sbjct: 269 IVNEKEAI 276

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 68/140 (48%), Gaps = 12/140 (8%)

Query: 70  KKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPHL 129
           +K + +AI+  G+++ LI NAG+L  V +   +    +  + +++      L   A P++
Sbjct: 81  EKIIETAIKEFGRVDVLINNAGILRDV-SFAKMTEREFASVVDVHLTGGYKLSRAAWPYM 139

Query: 130 K-KTHGSALFVSSDASDTYFSSWGA--YGSSKAALNHFAMTLANE--EKAVRALAVAP-- 182
           + +  G  +  +S A    F ++G   Y ++K  L   A TLA E  +  +   ++AP  
Sbjct: 140 RSQKFGRIINTASPAG--LFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAPLA 197

Query: 183 --GIVDTDMQVNIRENLGPQ 200
              + +  +  +I + LGP+
Sbjct: 198 RSRMTENVLPPHILKQLGPE 217

>Scas_709.36
          Length = 670

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 132 THGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMT---LANEEKAVRALAVAPGIVDTD 188
           T  S+L  S D S  +  SW +    + +++H  ++   + NEE++   +       + D
Sbjct: 470 TSVSSLASSIDDSQRFVKSWNSANRKRKSMSHIQLSSSQMENEEESRTGMMQNINNTEKD 529

Query: 189 MQVNIRENLGPQGMSQEHLEMFR--DLKKDNKLLHS-SIPATVYSKLALNG 236
            Q N R ++   G +       R  +L+KD++  H   IP     K++++G
Sbjct: 530 TQRNERPSMARAGSTGTIRRNHRSENLEKDSR--HDLEIPNNTQKKVSVSG 578

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 82/223 (36%), Gaps = 45/223 (20%)

Query: 3   QTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARS--------------------- 41
           + + KV LVTG + GIG   V  L+     V + G   S                     
Sbjct: 16  KVDNKVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQ 75

Query: 42  -EAPLKALKDTYGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLE-PVQ-N 98
            E P   L      +  Y   D+T+ ++++K           ++ LI NAGV+  P +  
Sbjct: 76  DEKPHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELT 135

Query: 99  INNIDVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSS------------DASDT 146
            +N ++         N+ S   L    LP +K   G  + VSS             A   
Sbjct: 136 KDNFEIQM-----QTNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNPGAQFN 190

Query: 147 YFSS----WGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIV 185
           Y+ S    W  Y  +K A   F   LA +   +  +++ PG+V
Sbjct: 191 YWPSMFFMWCRYALAKTASIQFTKMLAIKNPDILCMSLHPGLV 233

>CAGL0J05852g complement(554403..555434) weakly similar to
          sp|P40580 Saccharomyces cerevisiae YIR036, hypothetical
          start
          Length = 343

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 7  KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEA 43
          K  +VTG + G+GK     L+  + NVI  G+ R+E+
Sbjct: 42 KTAVVTGCNTGVGKEAAKLLYQKNCNVI--GVCRTES 76

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 10  LVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVG----DITN 65
           LVTG S GIGK     L S   NV++  ++R+EA L  LK     ++         D   
Sbjct: 72  LVTGASDGIGKEFALQLASKGFNVLL--VSRTEAKLLELKQEIMAKYKVDARVLSVDFGV 129

Query: 66  DDTLKKYVNSAIEGHGKINSLIANAGV 92
           D+ L     S + G   +  L+ N GV
Sbjct: 130 DNRLTYTAISELCGELPVTVLVNNVGV 156

>YDR430C (CYM1) [1253] chr4 complement(1325489..1328458) Putative
           zinc metalloprotease [2970 bp, 989 aa]
          Length = 989

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 16/90 (17%)

Query: 58  YTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFS 117
           +T G++   DTLK+ +N    G+GK         +L P+    +IDV    Q        
Sbjct: 243 FTYGNLPLVDTLKQ-LNEQFSGYGK---RARKDKLLMPIDLKKDIDVKLLGQ-------- 290

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDASDTY 147
               +D  LP  K+T  S  ++     DTY
Sbjct: 291 ----IDTMLPPEKQTKASMTWICGAPQDTY 316

>Kwal_55.21822
          Length = 283

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 85/205 (41%), Gaps = 18/205 (8%)

Query: 1   MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTV 60
           M   + KV  VTG S GIG  +         +V ++    S   +  L     +++   V
Sbjct: 25  MFSLKGKVAAVTGASSGIGYDVAVAFAQAGADVAMW--YNSNPHITELVGEISEKYGVKV 82

Query: 61  GDITNDDTLKKYVNSAIEG-----HGKINSLIANAGVL---EPVQNINNIDVNA----WK 108
                  T  K V S I+       GKI+ ++ NAGV     P+ ++   D       W 
Sbjct: 83  KAYKCSVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWN 142

Query: 109 QLYNINFFSIVSLV-DIALPHLKKTHGSALFVSSDASDT--YFSSWGAYGSSKAALNHFA 165
           ++ +++   I  +  +I     ++ HGS +  +S +           AY ++KA + H +
Sbjct: 143 KVIDVDLNGIYRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMS 202

Query: 166 MTLANEEKA-VRALAVAPGIVDTDM 189
            +LA E     R   V+PG + T++
Sbjct: 203 KSLAVEWAGFARVNTVSPGYIATEI 227

>CAGL0I09328g 898234..899325 similar to sp|P38342 Saccharomyces
          cerevisiae YBR265w 3-ketosphinganine reductase,
          hypothetical start
          Length = 363

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1  MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLK-ALKDTYGDR 55
          M   E +V+L+ G S+G+GK      +   ++  +  ++RS+  L+ A+ D  G R
Sbjct: 1  MFCLEDQVVLIAGGSQGLGKQFGQKYWDESRHSKIILVSRSDVKLRNAITDITGGR 56

>KLLA0F01749g complement(163821..164762) similar to sp|P38342
           Saccharomyces cerevisiae YBR265w TSC10 3-ketosphinganine
           reductase singleton, start by similarity
          Length = 313

 Score = 28.5 bits (62), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 85/207 (41%), Gaps = 42/207 (20%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLD-------KNVIVYGIARSEAPLKALKDTYG------ 53
           +VIL++G S+G+G+S        D         VI+  ++RS++ L    +  G      
Sbjct: 9   QVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVII--VSRSQSKLVKACERIGVDGVSL 66

Query: 54  DRFFYTVGDITNDDTLKKYVNSAIEGHGKI---------NSLIANAGVLEPVQNINNIDV 104
           DR+   V D   ++T   Y +     + K+         + L+ +   +    +I  + +
Sbjct: 67  DRY---VNDTNRNETKLIYHSCDTSSYDKVALMFKLLVKSELVPSQVYMCAGGSIPKLFL 123

Query: 105 N-AWKQLYN---INFFSIVSLVDIAL----PHLKKTHGSALFVSSDASDTYFSSWGAYGS 156
           +   ++L N    N+ + V+L  ++L    PHL       LF SS+ +   F  +  Y  
Sbjct: 124 DLTPEELQNGITTNYSTAVNLAHVSLKHDVPHL-------LFFSSEVAFFPFIGYAQYAP 176

Query: 157 SKAALNHFAMTLANEEKAVRALAVAPG 183
            K ++      L  E  + R   V PG
Sbjct: 177 LKQSIRSLVAILRQEHSSTRITCVYPG 203

>YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein
           involved in telomere length regulation and
           transcriptional silencing, interacts with Rap1p [5751
           bp, 1916 aa]
          Length = 1916

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 72  YVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIALPHLKK 131
           YV    E +   N++I     +   +N+N +D     Q +NI   +I S+++I +PHL+ 
Sbjct: 231 YVARRFEVYATFNNIIP----ILTTKNVNEVD-----QKFNILIVNIESIIEICIPHLQI 281

Query: 132 THGSALFVSSDASDTY 147
              + L  SS+  + +
Sbjct: 282 AQDT-LLSSSEKKNPF 296

>Kwal_27.12155
          Length = 280

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 99/253 (39%), Gaps = 40/253 (15%)

Query: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPL----KALKDTYGDRFFYTVGD 62
           KV  ++G S GIG ++ +       ++ V+    S   L    + L +TY  R       
Sbjct: 31  KVACISGASSGIGAAVAEAFAQAGADLAVW--YNSHPALVETARDLANTYHVRVVAYKCP 88

Query: 63  ITNDDTLKKYVNSAIEGHGKINSLIANAGVLE---PVQNINNIDV--NAWKQLYNINFFS 117
           + ++  ++  +   I   G+I+  +ANAGV     P+ +     V    W ++   +F  
Sbjct: 89  VDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQTDFQG 148

Query: 118 IVSLVDIALPHLKKTHGSALFVSSDASDTYFSS---WGAYGSSKAALNHFAMTLANEEKA 174
           +           ++    +L V++  S    +      AY ++KAA+ H + +LA E   
Sbjct: 149 VYYCSKYVGEVFQRQQHGSLVVTASMSGHVVNVPQLQAAYNAAKAAVVHLSRSLAVEWAG 208

Query: 175 -VRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLA 233
             R  +V+PG + T                   +  F DLK   + L         + + 
Sbjct: 209 FARVNSVSPGYIATP------------------ISKFADLKTRQRWLE-------LTPVG 243

Query: 234 LNGIPEEINGQYL 246
             G+P E+ G YL
Sbjct: 244 REGVPRELVGAYL 256

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 88  ANAGVLEPVQNINNIDVNAWKQL 110
           ANA V  P ++ N+ D N+WKQ+
Sbjct: 204 ANAPVKRPRESDNDYDANSWKQI 226

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
           (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 126 LPHLKKTHGSA--LFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPG 183
           L H    HG+   +F SS A+   F  +  Y   KAAL      L  E   VR   V PG
Sbjct: 131 LAHGAVRHGARHLVFFSSAAAVYPFIGYSQYAPLKAALRALVAVLRQECDGVRVSCVYPG 190

>Scas_692.12
          Length = 476

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 104 VNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGS 156
           VN  +QL+N   F  +SL  +     +  H    F+++   +  FSSWG + S
Sbjct: 354 VNTIQQLHNSLPFRAISLYSVGY---RNVHPENSFINNTRGEPEFSSWGIHWS 403

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 28.1 bits (61), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 70/177 (39%), Gaps = 21/177 (11%)

Query: 10  LVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVG----DITN 65
           +VTG S GIGK     L     N+I+  I+R+E+ L  LK          V     D+++
Sbjct: 69  VVTGASDGIGKEYAKQLAKRGFNLIL--ISRTESKLVELKKEIETECKIDVKILAIDVSS 126

Query: 66  DD----TLKKYVNSAIEGHGKINSLIANAGVLEPVQ-NINNIDVNAWKQLYNINFFSIVS 120
           D     TL + V S +     +  LI N G    +    +  + +  + +  IN  + + 
Sbjct: 127 DSKENYTLIREVASGLP----VTVLINNVGKSHSIPVPFDQTEESELRDIITINNTATLM 182

Query: 121 LVDIALPHLK------KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE 171
           +    LP LK      K  G  L + S            Y  SKA L  ++  LA E
Sbjct: 183 ITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAGE 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,145,581
Number of extensions: 346188
Number of successful extensions: 1228
Number of sequences better than 10.0: 101
Number of HSP's gapped: 1164
Number of HSP's successfully gapped: 107
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)