Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F06875g37236618040.0
Scas_628.537236515820.0
YIR034C (LYS1)37336414850.0
Sklu_2380.737436314610.0
KLLA0E07964g37236513670.0
Kwal_14.88037336313420.0
ACR167C37236513120.0
Scas_593.11960145720.68
Scas_706.281234109663.3
Sklu_2267.683034655.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F06875g
         (366 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F06875g complement(673222..674340) highly similar to sp|P38...   699   0.0  
Scas_628.5                                                            613   0.0  
YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopi...   576   0.0  
Sklu_2380.7 YIR034C, Contig c2380 16828-17952                         567   0.0  
KLLA0E07964g complement(718820..719938) similar to sp|P38998 Sac...   531   0.0  
Kwal_14.880                                                           521   0.0  
ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH] (649155..65...   509   0.0  
Scas_593.11                                                            32   0.68 
Scas_706.28                                                            30   3.3  
Sklu_2267.6 YNL201C, Contig c2267 7034-9526 reverse complement         30   5.3  

>CAGL0F06875g complement(673222..674340) highly similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase, hypothetical start
          Length = 372

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/366 (94%), Positives = 345/366 (94%)

Query: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60
           MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF
Sbjct: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60

Query: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120
           GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120

Query: 121 EFLEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGK 180
           EFLEDDNGRRV                     KQTHKDSEDLPAVSPYPNEKALIKDIGK
Sbjct: 121 EFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLPAVSPYPNEKALIKDIGK 180

Query: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240
           AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA
Sbjct: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240

Query: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
           ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP
Sbjct: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360
           TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN
Sbjct: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360

Query: 361 RHSARA 366
           RHSARA
Sbjct: 361 RHSARA 366

>Scas_628.5
          Length = 372

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/365 (81%), Positives = 318/365 (87%)

Query: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60
           M+VTLHLR ETKPLE RAALTPTTVK LI KGFKIYVE+SPQSIF IDEY++AGAIIVP 
Sbjct: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60

Query: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120
           GSWISAPRDRIIIGLKEMPE DKFPLVHEHIQFAHCYK+QAGWKDVL RFINGNGTLYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120

Query: 121 EFLEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGK 180
           EFLEDD GRRV                     KQTH D+EDLPAVSPYPNEKALIKDI  
Sbjct: 121 EFLEDDEGRRVAAFGFYAGFAGAALGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180

Query: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240
            YKNALK GAKKP VLIIGALGRCGSGAID L+K+GLPEENIIKWD++ET+RGGPFPEIA
Sbjct: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240

Query: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
            +DIFINCIYLSKPI PFINY+LLNK  R+LRTVVDVSADTTNPHNPIPIYNIATVFNKP
Sbjct: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360
           TV V T++GPKLSVISIDHLPSLLPREASEFFA DLLPSLEQLP R+ +PVWV+AEKLFN
Sbjct: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360

Query: 361 RHSAR 365
           RH AR
Sbjct: 361 RHCAR 365

>YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopine
           dehydrogenase (NAD+, L-lysine forming), catalyzes the
           eighth and final step in lysine biosynthesis pathway
           [1122 bp, 373 aa]
          Length = 373

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/364 (76%), Positives = 305/364 (83%)

Query: 2   SVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPFG 61
           +VTLHLR ETKPLE RAALTPTTVK LI KGFKIYVE+SPQS F I+EYR+AGAIIVP G
Sbjct: 3   AVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAG 62

Query: 62  SWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDLE 121
           SW +APRDRIIIGLKEMPE D FPLVHEHIQFAHCYKDQAGW++VL RFI G+GTLYDLE
Sbjct: 63  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLE 122

Query: 122 FLEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGKA 181
           FLE+D GRRV                     KQTH D EDLPAVSPYPNEKAL+KD+ K 
Sbjct: 123 FLENDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKD 182

Query: 182 YKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIAA 241
           YK AL TGA+KP VLIIGALGRCGSGAID L KVG+P+ NI+KWDI+ETSRGGPF EI  
Sbjct: 183 YKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQ 242

Query: 242 SDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKPT 301
           +DIFINCIYLSKPIAPF N E LN P+R+LRTVVDVSADTTNPHNPIPIY +ATVFNKPT
Sbjct: 243 ADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPT 302

Query: 302 VKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFNR 361
           V V T++GPKLSVISIDHLPSLLPREASEFF+HDLLPSLE LP R  +PVWVRA+KLF+R
Sbjct: 303 VLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDR 362

Query: 362 HSAR 365
           H AR
Sbjct: 363 HCAR 366

>Sklu_2380.7 YIR034C, Contig c2380 16828-17952
          Length = 374

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/363 (75%), Positives = 305/363 (84%)

Query: 3   VTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPFGS 62
           VTLHLR ETKP+E RAALTPTTVK L+ KGFKIYVEES QS F I+EYR AGA IVP GS
Sbjct: 5   VTLHLRAETKPMEARAALTPTTVKKLLSKGFKIYVEESEQSTFDINEYREAGAEIVPTGS 64

Query: 63  WISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDLEF 122
           W++AP+DRIIIGLKEMPE D FPLVHEHIQFAHCYK+QAGW+DVL RF  GNGTLYDLEF
Sbjct: 65  WVNAPKDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGNGTLYDLEF 124

Query: 123 LEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGKAY 182
           LE+D GRRV                     KQ H D++DLPAVSPYPNEKALIKD+   Y
Sbjct: 125 LENDQGRRVAAFGFYAGFAGAALGLRDWSFKQLHSDNQDLPAVSPYPNEKALIKDVVNDY 184

Query: 183 KNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIAAS 242
           + ALK GAKKP+VLIIGALGRCGSGA+D L K G+ +ENI+KWDI+ETSRGGPF EIA +
Sbjct: 185 QAALKKGAKKPRVLIIGALGRCGSGAVDLLHKAGVSDENILKWDIKETSRGGPFEEIAQA 244

Query: 243 DIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302
           DIFINCIYLSKPIAPFINYELLNK +RKLRTVVDVSADTTNPHNP+PIY IATVF+ PTV
Sbjct: 245 DIFINCIYLSKPIAPFINYELLNKKNRKLRTVVDVSADTTNPHNPVPIYEIATVFSSPTV 304

Query: 303 KVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFNRH 362
            V T++GPKLSVISIDHLPSLLPRE+SEFFAHDLLPSLEQLP R+ +PVWV+A+KLF++H
Sbjct: 305 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPERYTAPVWVKAKKLFDKH 364

Query: 363 SAR 365
            AR
Sbjct: 365 CAR 367

>KLLA0E07964g complement(718820..719938) similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase singleton, start by similarity
          Length = 372

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/365 (69%), Positives = 291/365 (79%)

Query: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60
           MSVTLHLR ETKPLE R ALTPTT K L+ KGFKI+VEES QS F I+EY++ GA IVP 
Sbjct: 1   MSVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSAFDIEEYKKVGATIVPE 60

Query: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120
           GSW +APRDRIIIGLKEMPE D FPLVHEHIQFAHCYK+QAGW+DVL RF  GNG LYDL
Sbjct: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120

Query: 121 EFLEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGK 180
           EFLE+D GRRV                     KQTH DSE+L A+ PY NE+A+IKD+ +
Sbjct: 121 EFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180

Query: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240
            Y+ ALK GA+KPKVLIIGALGRCGSGA D L+K GLPEENIIKWD++ET+RGGPF EIA
Sbjct: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240

Query: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
            +D+FINCIYLSKPI PFIN ELLNKP R+LRTVVDVSADTTNPHNP+PIY I T F+ P
Sbjct: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300

Query: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360
           TV+V T+ GPKLSV SIDHLPSLLP+EASE F+ DLLPSLEQLP R  + VWV+A  L+ 
Sbjct: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360

Query: 361 RHSAR 365
           + +A+
Sbjct: 361 KFAAK 365

>Kwal_14.880
          Length = 373

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/363 (71%), Positives = 296/363 (81%)

Query: 3   VTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPFGS 62
           V LHLR ETK  E RAALTPTTV+ LI KGFKIYVEES QS F I+EY++AGA IVP GS
Sbjct: 4   VILHLRAETKDQEARAALTPTTVQKLIAKGFKIYVEESEQSTFSIEEYKKAGAEIVPKGS 63

Query: 63  WISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDLEF 122
           W++AP+DRIIIGLKE+PEED FPLVHEHIQFAHCYK+QAGW+DVL RF  G+GTLYDLEF
Sbjct: 64  WVNAPKDRIIIGLKELPEEDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGHGTLYDLEF 123

Query: 123 LEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGKAY 182
           LE+D GRRV                     KQTH DSEDLP V+P+PNE  L+KD+   Y
Sbjct: 124 LENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHSDSEDLPGVTPFPNEHELVKDVVGDY 183

Query: 183 KNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIAAS 242
           K ALK GAKKP VLIIGALGRCGSGA+D L+K G+PE+NIIKWD++ET+RGGPF EIA +
Sbjct: 184 KAALKKGAKKPTVLIIGALGRCGSGAVDMLRKAGIPEKNIIKWDMKETARGGPFQEIAQA 243

Query: 243 DIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302
           DIFINCIYLSKPIAPFIN  LLN   R+LR++VDVSADTTN HNP+P+Y IATVF+KPTV
Sbjct: 244 DIFINCIYLSKPIAPFINSTLLNSKSRRLRSIVDVSADTTNVHNPVPVYTIATVFSKPTV 303

Query: 303 KVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFNRH 362
            V T++GPKLSVISIDHLPSLLPRE+SEFFAHDLLPSLEQLP R  +PVW RA+ L+++H
Sbjct: 304 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPYRDQAPVWARAKALYHKH 363

Query: 363 SAR 365
            AR
Sbjct: 364 CAR 366

>ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH]
           (649155..650273) [1119 bp, 372 aa]
          Length = 372

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/365 (66%), Positives = 292/365 (80%)

Query: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60
           MS  LHLR ETKP+E RAALTPTTV+ L+  GFKIYVEES QS+F+  EY  AGA +V  
Sbjct: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSVFEAAEYAAAGAEVVAT 60

Query: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120
           GSW  APR+RII+GLKE+PEED FPL H HIQFAHCYK+Q+GW++VL RF +G G LYDL
Sbjct: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120

Query: 121 EFLEDDNGRRVXXXXXXXXXXXXXXXXXXXXXKQTHKDSEDLPAVSPYPNEKALIKDIGK 180
           EFL+DD GRRV                     KQTH D+EDLPAV+PY NE+AL+ ++  
Sbjct: 121 EFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180

Query: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240
           A + A K GA+KP+VL+IGALGRCGSGA++ L++ GL +++II+WDI ET+RGGPFPEIA
Sbjct: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240

Query: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300
           A+DIFINCIYLS+PIAPFIN ELL++PDRKLRT+VDVSADTTNPHNP+P+YN+ATVF+ P
Sbjct: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNVATVFSSP 300

Query: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360
           TV V TS GPKLSVISIDHLPSLLPREASE FA DLLPSL QLP R  +PVW+RA++LF 
Sbjct: 301 TVVVPTSQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360

Query: 361 RHSAR 365
           +H  R
Sbjct: 361 QHCER 365

>Scas_593.11
          Length = 960

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 62/145 (42%), Gaps = 14/145 (9%)

Query: 187 KTGAKKPKVLIIG-ALGRCGSGAIDFLKKVGLPEENIIKWDIQ-ETSRGGPFPEIAASDI 244
           K G KK  V+++     +   GA+D+L  +G+ +E++ K  +  +  +   F       I
Sbjct: 326 KDGWKKVSVILVSDGRAKVNQGALDYLAALGVYQEDMAKASVNGDPVKAHVFELTTQVSI 385

Query: 245 FINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKPTVKV 304
             +  Y+SK I P      L + ++K            N H    ++N      +PTV  
Sbjct: 386 NSDLDYVSKDIVPVQLVFCLKEENKK----------KINSHR--WLFNAFCPVLQPTVVC 433

Query: 305 NTSSGPKLSVISIDHLPSLLPREAS 329
               G +L+  +I HL  +  R+++
Sbjct: 434 LVDVGTRLNHTAIYHLWKVFDRDSN 458

>Scas_706.28
          Length = 1234

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 43/109 (39%), Gaps = 14/109 (12%)

Query: 169  PNEKALIKDIGKAYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQ 228
             +E  LI+ + + Y   +    K  K + I  L      A D LKK   PEE IIK    
Sbjct: 962  SSEYLLIRKVIRFYLERIGKHGKVIKAIKICGLLGVSENAEDELKKRDNPEEKIIK---- 1017

Query: 229  ETSRGGPFPEIAASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDV 277
                  P+      D+  +C+ L K     + Y  +N     +R V+ V
Sbjct: 1018 ----KAPY------DVRYSCLILVKIFIKLLIYRFMNTLFISIRLVIGV 1056

>Sklu_2267.6 YNL201C, Contig c2267 7034-9526 reverse complement
          Length = 830

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 97  YKDQA--GWKDVLRRFINGNGTLYDLEFLEDDNG 128
           Y DQ   G  D+L  F NGNGT+   E L D  G
Sbjct: 522 YNDQGSNGNMDILMNFYNGNGTVGGAESLHDSAG 555

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,430,802
Number of extensions: 545061
Number of successful extensions: 1274
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1280
Number of HSP's successfully gapped: 12
Length of query: 366
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 263
Effective length of database: 13,030,455
Effective search space: 3427009665
Effective search space used: 3427009665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)