Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F05137g2272249721e-135
CAGL0G07667g2581443874e-46
YKR013W (PRY2)3291383864e-45
YJL079C (PRY1)2991343801e-44
Kwal_14.24103731403746e-43
KLLA0D02442g3681383738e-43
Scas_675.272901443618e-42
AAL179W3601423597e-41
Scas_711.372671453407e-39
YJL078C (PRY3)8811483552e-38
Sklu_956.13191283324e-37
KLLA0D02420g2121382922e-32
Kwal_14.24092381372881e-31
AAL178W2051392722e-29
KLLA0C01496g4561391981e-17
Kwal_33.131927991411841e-15
AFR700W4341411831e-15
KLLA0F17435g127134625.2
CAGL0F04301g148354617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F05137g
         (224 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   379   e-135
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   153   4e-46
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   153   4e-45
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   150   1e-44
Kwal_14.2410                                                          148   6e-43
KLLA0D02442g complement(207613..208719) some similarities with s...   148   8e-43
Scas_675.27                                                           143   8e-42
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   142   7e-41
Scas_711.37                                                           135   7e-39
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   141   2e-38
Sklu_956.1 YJL079C, Contig c956 998-1957                              132   4e-37
KLLA0D02420g complement(206544..207182) some similarities with s...   117   2e-32
Kwal_14.2409                                                          115   1e-31
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   109   2e-29
KLLA0C01496g complement(113533..114903) some similarities with s...    81   1e-17
Kwal_33.13192                                                          75   1e-15
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    75   1e-15
KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217 S...    28   5.2  
CAGL0F04301g 426122..430573 similar to sp|P38198 Saccharomyces c...    28   7.8  

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  379 bits (972), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/224 (83%), Positives = 187/224 (83%)

Query: 1   MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARVTVQAVVNVEDGGRXXXXXXXXXXXXXX 60
           MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARVTVQAVVNVEDGGR              
Sbjct: 1   MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARVTVQAVVNVEDGGRQSSLSTLEKKTKTK 60

Query: 61  XXXXXXXXXXXDLDKRAQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQS 120
                      DLDKRAQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQS
Sbjct: 61  SQKKTKPTPSTDLDKRAQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQS 120

Query: 121 YADRYDCSGNLAHNPEFIEAIGENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFT 180
           YADRYDCSGNLAHNPEFIEAIGENLAVG            EIQHYDYSNPVHQGRTAHFT
Sbjct: 121 YADRYDCSGNLAHNPEFIEAIGENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFT 180

Query: 181 QLVWKDTKNVGCAYKTCGGDLYNYIVCEYDPAGNWAGEFADNVK 224
           QLVWKDTKNVGCAYKTCGGDLYNYIVCEYDPAGNWAGEFADNVK
Sbjct: 181 QLVWKDTKNVGCAYKTCGGDLYNYIVCEYDPAGNWAGEFADNVK 224

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  153 bits (387), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 73/144 (50%), Positives = 96/144 (66%), Gaps = 3/144 (2%)

Query: 80  KRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIE 139
           + SNLS++ + ML++HN KR LH+DT+ L W+D LA  AQ+YA+ YDCSGNL H+     
Sbjct: 114 QDSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGG--- 170

Query: 140 AIGENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGG 199
             GENLA+G            EI+ Y+Y+NP     T HFTQ+VWK +  VGCA K+CGG
Sbjct: 171 PYGENLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGG 230

Query: 200 DLYNYIVCEYDPAGNWAGEFADNV 223
              +Y++C YDPAGN+ GEFA NV
Sbjct: 231 VWGDYVICSYDPAGNFLGEFAQNV 254

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 1  MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARV-TVQAVVNVEDG 44
          MK+S           LAAPAVVTVT+ A    V TV+ VV V+ G
Sbjct: 1  MKLSIPLLSLAATSVLAAPAVVTVTEVAHEHDVKTVRGVVYVQGG 45

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  153 bits (386), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 86/138 (62%), Gaps = 3/138 (2%)

Query: 86  EWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENL 145
           ++   M+++HN KR LHKDT SL W+D LA  AQ+YAD YDCSGNL H+       GENL
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGG---PYGENL 247

Query: 146 AVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYI 205
           A+G            EI  YDYSNP       HFTQ+VWK T  VGC  K+CGG+  +YI
Sbjct: 248 ALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYI 307

Query: 206 VCEYDPAGNWAGEFADNV 223
           +C Y  AGN  GEFADNV
Sbjct: 308 ICSYKAAGNVIGEFADNV 325

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  150 bits (380), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 87/134 (64%), Gaps = 3/134 (2%)

Query: 91  MLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAVGXX 150
           +L +HNKKR LHKDT +L W+D LA  AQ YAD YDCSG L H+       GENLA+G  
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGG---PYGENLALGYD 222

Query: 151 XXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIVCEYD 210
                     EI +YD+SNP     T HFTQ+VWK T  VGC  KTCGG   +Y++C YD
Sbjct: 223 GPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYD 282

Query: 211 PAGNWAGEFADNVK 224
           PAGN+ GE+ADNV+
Sbjct: 283 PAGNYEGEYADNVE 296

>Kwal_14.2410
          Length = 373

 Score =  148 bits (374), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 89/140 (63%), Gaps = 3/140 (2%)

Query: 85  SEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGEN 144
           S++   +L  HN KR LHKDT  L W+D LA  AQ YAD+YDCSG+L+H+       GEN
Sbjct: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGG---PYGEN 290

Query: 145 LAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNY 204
           LAVG            EI+ YD+SNP +   T HFTQ+VWK +  +GC  K+CGG   +Y
Sbjct: 291 LAVGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDY 350

Query: 205 IVCEYDPAGNWAGEFADNVK 224
           ++C Y  AGN+ GEFA+NVK
Sbjct: 351 VICSYKTAGNFLGEFAENVK 370

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  148 bits (373), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 86/138 (62%), Gaps = 3/138 (2%)

Query: 87  WQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLA 146
           +   MLD+HN KR LHKDT +L W+D LA  AQ+YAD YDCSG+L H+       GENLA
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGG---PYGENLA 287

Query: 147 VGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIV 206
           +G            EI+ Y +SNP +   T HFTQ+VWK T  VGC  K CGG   +YI+
Sbjct: 288 IGYGTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYII 347

Query: 207 CEYDPAGNWAGEFADNVK 224
           C YDPAGN  G FA NV+
Sbjct: 348 CSYDPAGNMLGTFASNVE 365

>Scas_675.27
          Length = 290

 Score =  143 bits (361), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 92/144 (63%), Gaps = 4/144 (2%)

Query: 82  SNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAI 141
           SNLSE+   +L++HN KR LH++T +L W+D+LA  AQ+YAD YDCSGNL H+       
Sbjct: 147 SNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSG---GPY 203

Query: 142 GENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDL 201
           GENLA+G            EI  YDYSNP       HFTQ+VWK +  VGC  K C    
Sbjct: 204 GENLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATG 263

Query: 202 Y-NYIVCEYDPAGNWAGEFADNVK 224
           + +Y++C Y+PAGN+ GEFA+NV+
Sbjct: 264 WGSYVICSYNPAGNFIGEFAENVE 287

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  142 bits (359), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 90/142 (63%), Gaps = 4/142 (2%)

Query: 83  NLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIG 142
           N + +++++L  HN +R+LHKDT  L W++ LA  A+ +A++YDCSG L H+       G
Sbjct: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHS---DSPYG 274

Query: 143 ENLAVGXXXXXXXXXX-XXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDL 201
           ENLAVG             EI  Y YS+P     T HF+QLVWKDTK++GCA K CGG +
Sbjct: 275 ENLAVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSV 334

Query: 202 YNYIVCEYDPAGNWAGEFADNV 223
            +Y++C YDPAGN+   F +NV
Sbjct: 335 GDYLICSYDPAGNFLRRFGENV 356

>Scas_711.37
          Length = 267

 Score =  135 bits (340), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 4/145 (2%)

Query: 80  KRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYAD-RYDCSGNLAHNPEFI 138
           ++++LS++Q  +L++HNKKR LH++T  L W++ LA  AQ+YAD  Y+C G L H+    
Sbjct: 121 QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGG-- 178

Query: 139 EAIGENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCG 198
              GENLA G            EI  YDYSNP     T HFTQLVWKDT  VGCA K+C 
Sbjct: 179 -PYGENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCN 237

Query: 199 GDLYNYIVCEYDPAGNWAGEFADNV 223
                Y++C Y+ AGN+ GE+  NV
Sbjct: 238 NAWGTYLICSYNSAGNFDGEYEANV 262

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  141 bits (355), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 77  AQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPE 136
           A K ++    ++  +L++HNK R LH DT  L W+D LA  AQ+YAD+YDCSG L H+  
Sbjct: 15  AVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDG 74

Query: 137 FIEAIGENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKT 196
                GENLA+G            EI  Y+YSNP     T HFTQ+VWK T  +GC YK 
Sbjct: 75  ---PYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKY 131

Query: 197 CGGDLYNYIVCEYDPAGNWAGEFADNVK 224
           CG    NYIVC Y+P GN+ GEFA+ V+
Sbjct: 132 CGTTWNNYIVCSYNPPGNYLGEFAEEVE 159

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  132 bits (332), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 79/128 (61%), Gaps = 3/128 (2%)

Query: 83  NLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIG 142
           +LS++   +LD+HNKKR LHKDT +L W++ LA  AQ YAD YDCSG+L H+       G
Sbjct: 168 DLSDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSG---GPYG 224

Query: 143 ENLAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLY 202
           ENLA+G            EI  YD+SNP +   T HFTQ+VWK T  VGC  K+C     
Sbjct: 225 ENLALGYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWG 284

Query: 203 NYIVCEYD 210
           +Y++C Y+
Sbjct: 285 SYVICSYN 292

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 1  MKVSTIFSVSLIAGALAAPAVVTVTK-EAPPARVTVQAVVNVEDG 44
          MK S +  ++  +  LAAPAVVTVT+ +     V VQ  V+V+DG
Sbjct: 1  MKFSKVSLLATASTVLAAPAVVTVTEHQHNKHTVVVQGYVSVQDG 45

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  117 bits (292), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 82/138 (59%), Gaps = 4/138 (2%)

Query: 86  EWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENL 145
           +++ ++LD HN  R+ H+   SLVW   LA  AQ++A+ Y C+G L H+       GENL
Sbjct: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKL---PYGENL 130

Query: 146 AVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYI 205
           A+G            E++ YD++NP     T HFTQLVWK+T  +GCA+  CG     Y 
Sbjct: 131 ALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYT 190

Query: 206 VCEYDPAGNWAGEFADNV 223
           VCEYDP GN  G+F++NV
Sbjct: 191 VCEYDPPGNVIGKFSENV 208

>Kwal_14.2409
          Length = 238

 Score =  115 bits (288), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 87  WQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLA 146
           +Q +ML+ HN+ R+LH D  +L W+ +L   AQ YA+ Y+C+G L H+       GENLA
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGS---PYGENLA 158

Query: 147 VGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIV 206
           +G            E++ Y+Y  P    +T HFTQLVWK + ++GCA   CG     Y +
Sbjct: 159 LGFNTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTI 218

Query: 207 CEYDPAGNWAGEFADNV 223
           C YDP GN AG++ DNV
Sbjct: 219 CSYDPPGNVAGQYQDNV 235

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  109 bits (272), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 73/139 (52%), Gaps = 8/139 (5%)

Query: 87  WQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHN--PEFIEAIGEN 144
           +   +LD HN  R  H     L WN  L   AQ YA+R  C+G+L H+  P      GEN
Sbjct: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPH-----GEN 124

Query: 145 LAVGXXXXXXXXXXXXEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNY 204
           LA+G            EI  YD+S P     T HFTQLVW+ T +VGCAY  CG     Y
Sbjct: 125 LALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLY 184

Query: 205 IVCEYDPAGNWAGEFADNV 223
           I+C+YDP GN A ++  NV
Sbjct: 185 IICQYDPPGNVADQYVANV 203

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score = 80.9 bits (198), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 69/139 (49%), Gaps = 16/139 (11%)

Query: 88  QQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSY------ADRYDCSGNLAHNPEFIEAI 141
           ++ +L+ HN+ R  H+ T+ LVWN+ LA  A  Y      +D   C+  L H+       
Sbjct: 298 RESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSG---GPY 354

Query: 142 GENLAVGXXXXXXXXXXX--XEIQHYDYSNPV---HQGR-TAHFTQLVWKDTKNVGCAYK 195
           GENLA G              EI +YDY+N     H G    HFTQLVW  + +VGC+  
Sbjct: 355 GENLAAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVT 414

Query: 196 TCGGDLYNYIVCEYDPAGN 214
            C      Y++CEY PAGN
Sbjct: 415 KCSSGSV-YLICEYSPAGN 432

>Kwal_33.13192
          Length = 799

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 53/141 (37%), Positives = 69/141 (48%), Gaps = 18/141 (12%)

Query: 91  MLDQHNKKRELHKDTDSLVWNDNLAILAQSYA------DRYDCSGNLAHNPEFIEAIGEN 144
           +L +HN KR LH +T  L W+D L+  A +YA      +R  CSG L H+    +  GEN
Sbjct: 635 ILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTR-DNQGEN 693

Query: 145 LAVGXXXXXXXXXX--XXEIQHYDYSNPV---HQGR-TAHFTQLVWKDTKNVGCAYKTCG 198
           +A G              EI  YDY +     H G+   HFTQ+VW  T+ VGCA   C 
Sbjct: 694 IAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQCD 753

Query: 199 -----GDLYNYIVCEYDPAGN 214
                G    Y++CEY  AGN
Sbjct: 754 TMAKYGQNSIYLLCEYKDAGN 774

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 68/141 (48%), Gaps = 19/141 (13%)

Query: 90  KMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRY------DCSGNLAHNPEFIEAIGE 143
           +++  HN KR LH+DT  L WN+ L+  A SY           C+  L H+       GE
Sbjct: 273 ELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHS---NGPYGE 329

Query: 144 NLAVGXXXXXXXXXX-----XXEIQHYDYSN---PVHQGR-TAHFTQLVWKDTKNVGCAY 194
           N+A G                 EI+ YDY++     H+G+   HFTQLVW  ++ VGCA 
Sbjct: 330 NIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAV 389

Query: 195 KTCGGDLYN-YIVCEYDPAGN 214
             C  +    YI+CEY P GN
Sbjct: 390 VYCSNNGKGIYILCEYHPVGN 410

>KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217
           Saccharomyces cerevisiae YMR128w ECM16 putative DEAH-box
           RNA helicase, start by similarity
          Length = 1271

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 73  LDKRAQKKRSNLSEWQQKMLDQHNKKRELHKDTD 106
           ++KRA KKR N   W+QK+  +  ++R+L  D D
Sbjct: 242 VNKRASKKRYN---WKQKVEQEERRRRKLDDDQD 272

>CAGL0F04301g 426122..430573 similar to sp|P38198 Saccharomyces
            cerevisiae YBL034c STU1, hypothetical start
          Length = 1483

 Score = 28.1 bits (61), Expect = 7.8,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 94   QHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAV 147
            Q NK+ E  +  +  + N      A+   +R   +G++ HNP+ + A G+N  V
Sbjct: 990  QSNKEDEYKQYMEMTMVNP----FAKKQDERIPSTGSVVHNPDMVTAFGDNSTV 1039

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,302,281
Number of extensions: 223992
Number of successful extensions: 720
Number of sequences better than 10.0: 24
Number of HSP's gapped: 696
Number of HSP's successfully gapped: 29
Length of query: 224
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 126
Effective length of database: 13,203,545
Effective search space: 1663646670
Effective search space used: 1663646670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)