Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F03443g31230715290.0
Scas_696.373223056927e-90
YMR274C (RCE1)3153126404e-82
Kwal_27.103143153065241e-64
KLLA0D01705g3213094632e-55
AAL186W3192983909e-45
Scas_676.2214078720.18
KLLA0A03377g24847635.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03443g
         (307 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   593   0.0  
Scas_696.37                                                           271   7e-90
YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   251   4e-82
Kwal_27.10314                                                         206   1e-64
KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   182   2e-55
AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   154   9e-45
Scas_676.22                                                            32   0.18 
KLLA0A03377g complement(304117..304863) similar to sp|P39721 Sac...    29   5.5  

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/307 (95%), Positives = 293/307 (95%)

Query: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPL 60
           MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPL
Sbjct: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPL 60

Query: 61  LHSIIVPQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLCLVMLLYIGPLTDMVLY 120
           LHSIIVPQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLCLVMLLYIGPLTDMVLY
Sbjct: 61  LHSIIVPQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLCLVMLLYIGPLTDMVLY 120

Query: 121 YISNKESSILSAFREEFMNIWGLRNYIFAPITEEXXXXXXXXXXXXXXEPRKPKLTTLLW 180
           YISNKESSILSAFREEFMNIWGLRNYIFAPITEE              EPRKPKLTTLLW
Sbjct: 121 YISNKESSILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRKPKLTTLLW 180

Query: 181 QPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWSC 240
           QPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWSC
Sbjct: 181 QPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWSC 240

Query: 241 ILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMGILFFKDGLW 300
           ILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMGILFFKDGLW
Sbjct: 241 ILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMGILFFKDGLW 300

Query: 301 RLTSCPE 307
           RLTSCPE
Sbjct: 301 RLTSCPE 307

>Scas_696.37
          Length = 322

 Score =  271 bits (692), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 140/305 (45%), Positives = 193/305 (63%), Gaps = 9/305 (2%)

Query: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPA-RRDDPRVIKRRLKNVLMVSILNTAIVP 59
           +N+  FC+   IS+SYVAV+Y +SK    YP   RDDP VIKRR++ VLM++  N  +VP
Sbjct: 2   LNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVP 61

Query: 60  LLHSIIV-------PQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLCLVMLLYIG 112
            L  +I          +S   A +N+GI+PG+++ G   I  Y   I+  + +V LLY+G
Sbjct: 62  FLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGHWDISSYYYDIISGIWVVTLLYVG 121

Query: 113 PLTDMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEEXXXXXXXXXXXXXXEPRK 172
           PL D+ L+Y+  K  ++   +++EF NI+ LRNYIFAPITEE               P +
Sbjct: 122 PLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIE 181

Query: 173 P-KLTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFL 231
              L TLLWQPSLFF +AHIHHAY +   G+ +  +I++NT+ Q  YT +FGAFTNF+FL
Sbjct: 182 SLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFL 241

Query: 232 RTGGNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMG 291
           RTGGNLW+C+  HSFCN+MGFP  S L  +FT+I+  K    + L++ WNK Y  LLF+G
Sbjct: 242 RTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSYIFLLFLG 301

Query: 292 ILFFK 296
           I  FK
Sbjct: 302 IYLFK 306

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  251 bits (640), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 190/312 (60%), Gaps = 10/312 (3%)

Query: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPL 60
           + +  F + + IS+SYV  LY TS   +   ++RD+PR IK R++ + ++ I N  +VP 
Sbjct: 2   LQFSTFLVLLYISISYVLPLYATS---QPEGSKRDNPRTIKSRMQKLTIMLISNLFLVPF 58

Query: 61  LHSII---VPQLSYKEAFLNIGIIPGYHQHGSS--QIKLYIGTILKNLCLVMLLYIGPLT 115
           L S +      +S+K+AFL +GIIPGY+    +  Q   ++  + K + +++ LY GP+ 
Sbjct: 59  LQSQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVL 118

Query: 116 DMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEEXXXXXXXXXXXXXXEPRKP-K 174
           D VLY++ N +SSIL  F  EF+NIW  RN+IFAPITEE               P     
Sbjct: 119 DFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLS 178

Query: 175 LTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTG 234
              L WQPSLFF +AH HHAYE    G+ +T SI++ T FQ+ YT +FG  T FVF+RTG
Sbjct: 179 YQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTG 238

Query: 235 GNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMGILF 294
           GNLW CI+LH+ CN+MGFP  S L  +FTV+   K+ ++  L+SIWNK Y+ LL +G++ 
Sbjct: 239 GNLWCCIILHALCNIMGFPGPSRLNLHFTVVDK-KAGRISKLVSIWNKCYFALLVLGLIS 297

Query: 295 FKDGLWRLTSCP 306
            KD L  L   P
Sbjct: 298 LKDTLQTLVGTP 309

>Kwal_27.10314
          Length = 315

 Score =  206 bits (524), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 178/306 (58%), Gaps = 10/306 (3%)

Query: 6   FCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSII 65
           F I++ +S+SYVA +++ S+ I  + ARRDDPRVIK R++ V +++ +N  +VP L S  
Sbjct: 6   FLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQSTF 65

Query: 66  -VPQLSYKEAFLNIGIIPGYHQHGSS--QIKLYIGTILKNLCLVMLLYIGPLTDMVLYYI 122
              ++++ +AFL +GIIP  ++  +    +  ++  I++ L LV +LY GPL D VLYY+
Sbjct: 66  SAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDNVLYYL 125

Query: 123 SNKESSILSAFRE---EFMNIWGLRNYIFAPITEEXXXXXXXXXXXXXXEPRKPKLTTLL 179
              + ++  AF++   E  +IWGLRNY+F P TEE                       +L
Sbjct: 126 LVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVTYKAIL 185

Query: 180 WQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWS 239
             P LFF +AH+HHA+E + VG +S   I I TL QM YT +FG FTNFV+LRTG N W 
Sbjct: 186 LLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTGQNFWC 245

Query: 240 CILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLS-IWNKVYYILLFMGILFFKDG 298
           C  +H+F N MG P  S L E F +    +S   + L+S  W   Y  +L +G++ FK  
Sbjct: 246 CFAIHAFANYMGLPKMSALCEQFDL---NRSTGFRSLVSKFWKWGYVAMLLIGLVKFKGN 302

Query: 299 LWRLTS 304
           +W LT 
Sbjct: 303 MWELTD 308

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  182 bits (463), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 168/309 (54%), Gaps = 15/309 (4%)

Query: 8   INIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSIIVP 67
           + + ISLSYV  ++  S+ +  +  RRDDP+VIK R+K V+ +S  +   +PLL   +  
Sbjct: 9   VAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIPLLLKYMNG 68

Query: 68  QLSYKEAFLNIGIIPGYHQHGSSQIKL-----YIGTILKNLCLVMLLYIGPLTDMVLYYI 122
             S +   L  G++PG+     + +       Y     ++L L ++LY  PL D +L+Y 
Sbjct: 69  D-SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTPLLDSLLHYC 127

Query: 123 SNKESS---ILSAFREEFMNIWGLRNYIFAPITEEXXXXXXXXXXXX---XXEPRKPKLT 176
              + S   I+S    EF  IWGLR+YIF PITEE                         
Sbjct: 128 FLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSSQYDANYL 187

Query: 177 TLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGN 236
           TL+  P+LF  IAH+HHA+E   +G  +  +II  TL QM+YT +FG+FTN++FL + GN
Sbjct: 188 TLI-VPNLF-GIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFLNSSGN 245

Query: 237 LWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLL-SIWNKVYYILLFMGILFF 295
           LWSCIL+H+FCN MG P G+   + + ++   K   L  L  S+W  +Y  LL + I+ F
Sbjct: 246 LWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVISIVLF 305

Query: 296 KDGLWRLTS 304
           K+ L  LT+
Sbjct: 306 KNNLTSLTA 314

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  154 bits (390), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 147/298 (49%), Gaps = 11/298 (3%)

Query: 15  SYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSIIVPQ-LSYKE 73
           SYVA LY+         A R+DP+ I   +K V    + N  I+P L S +     S+ +
Sbjct: 16  SYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIPWLQSRLASDGFSFVD 75

Query: 74  AFLNIGIIPGYHQHGSS---QIKLYIGTILKNLCLVMLLYIGPLTDMVLYYISNKESSIL 130
            F  +G++PG + H          Y   IL+ L ++  LY   L D   YY+   ++S +
Sbjct: 76  CFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGSLYAADLLDSAAYYLLVPDTSPV 135

Query: 131 SAFREEFMNIWGLRNYIFAPITEEXXXXXXXXXXXXXXEPRKPKLTTLLWQPSLFFSIAH 190
               +      GLRNY+F PITEE              +P   +   LL  P +FF +AH
Sbjct: 136 VDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQPTISRAMLLLATP-MFFGVAH 194

Query: 191 IHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWSCILLHSFCNVM 250
           +HHA +    G+     + + + FQ+ YT +FG FTN+++  T GNLW+CILLH+ CN +
Sbjct: 195 VHHARQLLATGH-RPAQVALTSSFQILYTTLFGTFTNYIYYHTAGNLWACILLHAVCNYL 253

Query: 251 GFPS-GSELYEYFTVIKTPKSLKL---QHLLSIWNKVYYILLFMGILFFKDGLWRLTS 304
            FPS  S+++  +   K P +L+      LL  W   Y + L  G+L F DG+   +S
Sbjct: 254 SFPSLSSDVFADYCA-KVPPALRALWKMRLLHAWGYTYRLCLLCGLLAFLDGIRTFSS 310

>Scas_676.22
          Length = 140

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 182 PSLFFSIAHIHHAYEATLVGNFSTT---SIIINTLFQMAYTGIFGAFTNFVFLRTGGNLW 238
           PSL++ I +    Y+ T + N S     ++    +F  A+ G  G   +F   RTGG +W
Sbjct: 20  PSLYWPINN--KKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAGLLASFSHRRTGGGIW 77

Query: 239 SCILLHSFCNVMGFPSGS 256
             ++  +F  V G   G+
Sbjct: 78  IMVIYLTFAGVQGLAMGT 95

>KLLA0A03377g complement(304117..304863) similar to sp|P39721
           Saccharomyces cerevisiae YAL049c singleton, start by
           similarity
          Length = 248

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 247 CNVMGF-----PSGS--ELYEYFTVIKTPKSLKLQHLLSIWNKVYYI 286
           C   GF     P+G+   LY + T +  P+SLK +H+L I   +Y I
Sbjct: 9   CCAQGFYHEGTPAGTTTSLYGFETYVAGPESLKNEHVLVIVTDIYGI 55

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.143    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,444,377
Number of extensions: 375733
Number of successful extensions: 1145
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1138
Number of HSP's successfully gapped: 11
Length of query: 307
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 206
Effective length of database: 13,099,691
Effective search space: 2698536346
Effective search space used: 2698536346
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)