Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F03421g81780540610.0
YMR273C (ZDS1)9156165134e-54
Kwal_27.103189253054081e-40
KLLA0D01683g944874052e-40
Scas_650.229931694001e-39
AAL185W10184393865e-38
YML109W (ZDS2)9425023856e-38
CAGL0J06688g828833713e-36
Kwal_56.2263759585712.3
KLLA0E00847g71367668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03421g
         (805 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...  1568   0.0  
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   202   4e-54
Kwal_27.10318                                                         161   1e-40
KLLA0D01683g complement(148855..151689) some similarities with s...   160   2e-40
Scas_650.22                                                           158   1e-39
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   153   5e-38
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   152   6e-38
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   147   3e-36
Kwal_56.22637                                                          32   2.3  
KLLA0E00847g complement(87991..90132) some similarities with sgd...    30   8.3  

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score = 1568 bits (4061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/805 (95%), Positives = 771/805 (95%)

Query: 1   MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGYRNSWSTQLEQ 60
           MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGS             YNNGYRNSWSTQLEQ
Sbjct: 1   MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDMLPYNNGYRNSWSTQLEQ 60

Query: 61  GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG 120
           GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG
Sbjct: 61  GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG 120

Query: 121 AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN 180
           AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN
Sbjct: 121 AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN 180

Query: 181 IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK 240
           IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK
Sbjct: 181 IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK 240

Query: 241 EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD 300
           EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD
Sbjct: 241 EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD 300

Query: 301 DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT 360
           DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT
Sbjct: 301 DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT 360

Query: 361 IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI 420
           IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI
Sbjct: 361 IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI 420

Query: 421 VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV 480
           VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV
Sbjct: 421 VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV 480

Query: 481 PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA 540
           PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA
Sbjct: 481 PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA 540

Query: 541 GLKISQLQWRNNDHKEKAVEAXXXXXXXXGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ 600
           GLKISQLQWRNNDHKEKAVEA        GSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ
Sbjct: 541 GLKISQLQWRNNDHKEKAVEATNNTEENNGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ 600

Query: 601 TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEKXXXXXXX 660
           TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEK       
Sbjct: 601 TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEKQTQGQDQ 660

Query: 661 XXXXXXAHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL 720
                 AHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL
Sbjct: 661 GQDQGQAHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL 720

Query: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780
           YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH
Sbjct: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780

Query: 781 LKLSNSKRALREQVLLSNFMYSYLN 805
           LKLSNSKRALREQVLLSNFMYSYLN
Sbjct: 781 LKLSNSKRALREQVLLSNFMYSYLN 805

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  202 bits (513), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 214/616 (34%), Positives = 305/616 (49%), Gaps = 144/616 (23%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYN-NGYRNSWS-TQLEQGDK 63
           SEV IAAQSLD E+RSVKNLKRLSIGS                +  R SWS T       
Sbjct: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSSSASM 87

Query: 64  P-----LKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTR 118
           P     + +TRYSDPT         E L  + N         + +E++ K        T+
Sbjct: 88  PSDTTTVNNTRYSDPTPL-------ENLHGRGN---------SGIESSNK--------TK 123

Query: 119 RGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDAL 178
           +G  N+     + +  HS  S K+N  +   + +NLLWV A+QHPNVKP+N++ELVQD L
Sbjct: 124 QG--NYLG---IKKGVHSP-SRKLNANV---LKKNLLWVPANQHPNVKPDNFLELVQDTL 174

Query: 179 HNIQI-DKTEEHDK---ENSDT----LDKVSRYYNSNNKRSPN---------NTGLVRRP 221
            NIQ+ D  E++D    EN+D      DK S+ Y +    + N         N  L+RRP
Sbjct: 175 QNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRP 234

Query: 222 SLLRKSYTEFDEVKDSDIKEQSS--TNNNVD---STPHNKKFTLKDITEELTRISNKAGL 276
           S LR+SYTEFD+ +D D K  S+  T N V+   S    +  +L+DITEELT+ISN AGL
Sbjct: 235 STLRRSYTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGL 294

Query: 277 TNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDY--------ARQSRNNDDN-YASTM 327
           T+NDA+TLARTLSMA         D +++P+ E  Y          Q+   DD  +AS M
Sbjct: 295 TDNDAITLARTLSMAG-----SYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNM 349

Query: 328 LLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTIPVSTESQHQDVIE------------ 374
            +  +++   E S+L+RS++ TY IR+QE ++  +  S +    D  E            
Sbjct: 350 PI-NNTMTWPERSSLRRSRFNTYRIRSQE-QEKEVEQSVDEMKNDDEERLKLTKNTIKVE 407

Query: 375 ------------------ASPGSIN---DIYDHYREPSGDWSSLIQVAPENEN---KKRT 410
                             +SPGSI    DIY+HYR+ SG+W   + +  E E    K R 
Sbjct: 408 IDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRN 467

Query: 411 DTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLW-----SSKTSE 465
           DT ++ + ++ + +T+ V   +T        D NK+   HR +RNGW W     S +   
Sbjct: 468 DT-VEQDLELREGTTDMVKPSAT--------DDNKETKRHR-RRNGWTWLNNKMSREDDN 517

Query: 466 KVNVTSDKHENEDIVPESR--FNHSKNRHEPLYN--HKIEIAN--------TLGTLPEKK 513
           + N   D  ENE+ V   R   ++SK  +  L+N   K E++N        T     + +
Sbjct: 518 EENQGDD--ENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTR 575

Query: 514 NAIDKKISNIFRRKHH 529
             I+K  +N+FRRK H
Sbjct: 576 QKIEKTFANLFRRKPH 591

 Score =  168 bits (425), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (83%), Gaps = 5/104 (4%)

Query: 707 EATDSSKTASKKPL-----YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVI 761
           EA+  ++  +  PL      PPRKLTFADVKK DK N+P++FTDSAFGFPLP LT STVI
Sbjct: 787 EASAQTQAPAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVI 846

Query: 762 MFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLN 805
           MFDHRLPI+VERAIYRLSHLKLSNSKR LREQVLLSNFMY+YLN
Sbjct: 847 MFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLN 890

>Kwal_27.10318
          Length = 925

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 161/305 (52%), Gaps = 63/305 (20%)

Query: 130 VDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEH 189
           V R   SK   ++++   D V QNL WV A+QHPNVKPENY+ELVQD LH + ID   E 
Sbjct: 150 VRRGGMSKKPRELSNGGDDNVTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDS--EV 207

Query: 190 DKENSDTLDKVSRYYNS-NNKRSPNN------TGLVRRPSLLRKSYTEFD-----EVKDS 237
           +     T++  + Y  S N K SP++        LVRRPS LRKSYTE +     E++DS
Sbjct: 208 EPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDS 267

Query: 238 D---IKEQSSTNNNVDSTPH--NKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMAS 292
           D      QS  NN + + P   +   +LKDITEELTRISNKAG T+ DAV LARTLSMAS
Sbjct: 268 DENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTLSMAS 327

Query: 293 VAEEDETDDLQERPEAEDDYARQSRNN----DDNYASTMLLPTDSLIKSEHSTLKRSKY- 347
                         + E   A QS N     D  YAST+L   + L     S+L+RSK+ 
Sbjct: 328 SY------------DGEQSQANQSANTDHTPDSEYASTILT-KNGLAIPARSSLRRSKFN 374

Query: 348 TYHIRT------------------QEDKDPTIPVSTESQHQDVIEASPGSIND---IYDH 386
           TY IRT                  +E KDP   +    + +     SP S+ND   IYDH
Sbjct: 375 TYRIRTPNGSSVTSSSLRSTSLPNEERKDPEGYIEKSDRLR-----SPTSVNDFNEIYDH 429

Query: 387 YREPS 391
           YR+ S
Sbjct: 430 YRQGS 434

 Score =  140 bits (352), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%)

Query: 722 PPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHL 781
           PPRKLTF+DV K ++ N+P++F+DS+FGFPLP LT STV+M DHRL I+VERAIYRLSHL
Sbjct: 812 PPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLSHL 871

Query: 782 KLSNSKRALREQVLLSNFMYSYLN 805
           KL + KR LR+QV+LSNFMY+YLN
Sbjct: 872 KLGDPKRELRQQVVLSNFMYAYLN 895

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 72/87 (82%), Positives = 79/87 (90%), Gaps = 1/87 (1%)

Query: 719 PLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRL 778
           PL PPRKLTFADV K D+ N+P++FTDSAFGFPLP LT STVIMFDHRLPIHVERAIYRL
Sbjct: 823 PL-PPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRL 881

Query: 779 SHLKLSNSKRALREQVLLSNFMYSYLN 805
           SHLKLS+ KR LR+QVLLSNFMY+YLN
Sbjct: 882 SHLKLSDPKRVLRQQVLLSNFMYAYLN 908

 Score =  139 bits (351), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 179/360 (49%), Gaps = 58/360 (16%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQI-------DKTEEHDKENSDTLDKVSR 202
           + QNLLWVRADQHPNVKPENY+ELVQ+ L N+ +       ++T+        TL K  R
Sbjct: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRK--R 245

Query: 203 YYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKD 262
              S N        L RRPS LR SYTE  E  +              +    +  +LKD
Sbjct: 246 SMQSGN-------SLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKD 298

Query: 263 ITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDN 322
           ITEELT++SN+AGLT+ DAVTLARTL    VA+E  TD   +        +    + ++ 
Sbjct: 299 ITEELTKLSNQAGLTDTDAVTLARTL---WVADESTTDSTGQ------GLSNNLADEEEE 349

Query: 323 YASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTIPVSTESQHQDVIEASPGSIN 381
           +ASTM   +   + + HS L+RSK+ TY I++   K+  I    E++       SP SI 
Sbjct: 350 FASTMFTKSGFTVPARHS-LRRSKFNTYRIQSSSSKEERI---IETRSPSGSNNSPNSII 405

Query: 382 DIYDHYREPSGDWSSLIQ----VAPENENKKRTDTDIDSNTKIVQHSTEHVDLGSTGHST 437
            +Y+   EP  +   ++Q      P ++     D + +S+T+  + S +  +  S+   T
Sbjct: 406 GLYND--EPFNEKKPIVQEFFSTLPASD-----DFESESSTEDAESSADFSNEVSSELET 458

Query: 438 SDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIVPES-----RFNHSKNRH 492
           +DK  IN+   +       W WS   +     TS+ ++    VP+      + NHS+NRH
Sbjct: 459 TDKQRINETSKS-------WRWSQSPT-----TSNDYQQAQYVPKENIAPLKINHSRNRH 506

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (92%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          SEV IAAQSLD+E++ VKNLKRLSIGS
Sbjct: 11 SEVLIAAQSLDQEVKHVKNLKRLSIGS 37

>Scas_650.22
          Length = 993

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 101/169 (59%), Gaps = 44/169 (26%)

Query: 676 SLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL--------------- 720
           SLQPAV+VTSTKN  +     + +   + RE   D S+  S   L               
Sbjct: 771 SLQPAVSVTSTKNVHL-----SASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVM 825

Query: 721 ------------------------YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELT 756
                                    P RKLTFADVK+ D+ NAPI+FTDSAFGFPLP LT
Sbjct: 826 NSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLT 885

Query: 757 YSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLN 805
            STVIMFDHRL I+VERAIYRLSHLKLS+SKR LR+QVLLSNFMY+YLN
Sbjct: 886 VSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLN 934

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 159/489 (32%), Positives = 230/489 (47%), Gaps = 122/489 (24%)

Query: 147 PDEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDK---TEEH-------------- 189
           PD++ +NLLWV A+QHPNVKPENY+ELVQD L NI +++   + +H              
Sbjct: 193 PDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDI 252

Query: 190 DKENSDTLDKVSRYYNSNNKR----SPNNTGLVRRPSLLRKSYTEFDEVKDSDIKE-QSS 244
            K N    + + R+  S +K     +  N  LVRRPS LR SYTEF+E   S+ +E ++ 
Sbjct: 253 SKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAK 312

Query: 245 TNNNVDSTPHNKKF-------------------TLKDITEELTRISNKAGLTNNDAVTLA 285
           TN +  S+   K F                   +LKDITEELT ISNKAGLT++DA+TLA
Sbjct: 313 TNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLA 372

Query: 286 RTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRS 345
           RTLSMAS   +   +  + + + E        N +  +AS M +  + L   E S+L+RS
Sbjct: 373 RTLSMASSFSDGNVNLGKSKLQNES-------NEESEFASNMFM-KNGLTIPERSSLRRS 424

Query: 346 KY-TYHIR-------TQEDKDPTI------------------PVSTESQ--HQDVIEASP 377
           K+ TY IR       T+E   P +                  PVS  ++  +     +SP
Sbjct: 425 KFNTYRIRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATTTSSP 484

Query: 378 GSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKIVQHSTEHVD-------- 429
           GSI+D+YDHY++ +       +   +N+N+ R   D+ S+  I Q S+   +        
Sbjct: 485 GSISDLYDHYQDNAES-----KQGNDNDNEAR-QGDL-SHASISQESSFLSNESSNDSIL 537

Query: 430 ---LGSTG--HSTSDKS-DINKKEPAHRK----------------KRNGWLWSS--KTSE 465
              LGS    H   D   D +  +PA++K                KRNGW WS     SE
Sbjct: 538 VKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGNRANSE 597

Query: 466 KVNVTSDKHENEDIVPESRFNHSKNRHEPLYNH-----KIEIANTLGTLPEKKNAIDKKI 520
           +        ++ED    +    SK+RH P+        KI     L     K+  I+K+ 
Sbjct: 598 EDATVLVNSQDEDQTGYTD-QKSKSRHRPILARSRDHLKINKEAELPKESHKRETIEKRF 656

Query: 521 SNIFRRKHH 529
             +FRRK H
Sbjct: 657 VKLFRRKGH 665

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  153 bits (386), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 143/439 (32%), Positives = 210/439 (47%), Gaps = 87/439 (19%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGY--------RNS---- 53
           SEV IAAQSLD EL++VKNLKR+SIGS               NG         RNS    
Sbjct: 75  SEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM--NGAAVSPSASPRNSLTEE 132

Query: 54  ---W---STQLEQGDK-PL--KSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVE 104
              W   S + EQG + PL  +S         +S   R E L         +       E
Sbjct: 133 SLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELL-------TSASSVVPSEE 185

Query: 105 NTKKQPGSPKSLTRRGAVNFSSRRPVDR----SNHSKNSSKINDTLPDEVAQNLLWVRAD 160
            +   P SP +  ++  +  SSR  + R    + H+K ++       +  + NLLWVRAD
Sbjct: 186 LSCSHPLSPPAAAKKSTL-MSSRSKLGRQHTDTTHTKQATG------EPFSSNLLWVRAD 238

Query: 161 QHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRR 220
           QHPNVKPENY+ELV D L+N++I     H + +S      +   N  +  +   + LVR+
Sbjct: 239 QHPNVKPENYLELVHDTLNNLRIGA--RHGRGDSPVQQSNTPVANGESSTASARS-LVRK 295

Query: 221 PSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNND 280
            S LRKS+TE + +++S   +  S  + +      +  +LK+ITEELTRISN AGLT++D
Sbjct: 296 QSRLRKSFTEVEAIEESQFTD--SIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSD 353

Query: 281 AVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHS 340
           A+TLARTL + S + ++     +  P AE +        ++ YAS++L   + L     S
Sbjct: 354 AITLARTLGIGSQSADEHATFSECVPSAEAE--------ENEYASSILA-KNGLAIPARS 404

Query: 341 TLKRSKY-TYHIRT-----------------------QEDKDPTIPVST--------ESQ 368
           +L+RSK+ TY IR+                       +  + P +  +           +
Sbjct: 405 SLRRSKFTTYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGE 464

Query: 369 HQDVIEASPGSINDIYDHY 387
           +  +   SP SINDIYDHY
Sbjct: 465 NTSLAPQSPNSINDIYDHY 483

 Score =  149 bits (375), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 66/85 (77%), Positives = 74/85 (87%)

Query: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780
            PPRKL F DV + +K N+P++FT SAFGFPLP LT STVIMFDHRLPI+VERAIYRLSH
Sbjct: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955

Query: 781 LKLSNSKRALREQVLLSNFMYSYLN 805
           LKLS+ KR LR+QVLLSNFMYSYLN
Sbjct: 956 LKLSDPKRELRQQVLLSNFMYSYLN 980

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  152 bits (385), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 151/502 (30%), Positives = 225/502 (44%), Gaps = 161/502 (32%)

Query: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNN 208
           ++ QNLLWV ADQHPNVKPENY+EL+QD L NIQI   ++ D+   + L+  + +  SN 
Sbjct: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE---NKLELGNNHVISNR 262

Query: 209 KRSPNNTGLVRRPSLLRKSYTEFDE---VKDSDIKEQSSTNNNVDSTPHN--KKFTLKDI 263
           KR+     +VRRPS L+ SYT+FD+   + D   + +   +  + S+     +  +LK+I
Sbjct: 263 KRT---GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEI 319

Query: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323
           TEELT+ISN AGLT++DAVTLAR+LSM+  +  +E+  L                ND+ +
Sbjct: 320 TEELTKISNNAGLTDSDAVTLARSLSMSG-SFTNESLHLN----------GNHTENDNEF 368

Query: 324 ASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP--------------------TIP 362
           AS M   T  L   E S+L+RSK+ TY IR +    P                    + P
Sbjct: 369 ASNMFNET-GLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSP 427

Query: 363 VSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTD----------- 411
            S     Q+  +AS    ++I+DHYR  S DWS+        EN+K  D           
Sbjct: 428 ASYTQVPQE--QASLNDFHEIFDHYRRTSTDWST--------ENEKYVDSTNYYSDEEDL 477

Query: 412 -------------TDIDSNTKIVQ-HST---------EHVDLGSTGHSTSDKSDINKKEP 448
                        TD  +N+ +++ H+T         +HV       S+S+KS+ N  E 
Sbjct: 478 THASISQESSLLSTDSSNNSVLIKPHNTGSMISEKLDQHV-------SSSEKSNTNNSEA 530

Query: 449 AHRKKRNGWLWSSKTSEKVNVTSDKH---------------ENEDIVPES---------- 483
            H     GW W + ++  +N     +               E  D V  S          
Sbjct: 531 NH-----GWSWLNSSNGSLNANEQTYQQLTDDEDDEECVDNEKADFVNLSVSRRAKSTKR 585

Query: 484 ---RFNHSKNRHEPLYNHKIEIANTLGTLPE----------------------------- 511
              R NHSKNRH P++    E A ++   P                              
Sbjct: 586 ASERINHSKNRHSPIFQIHSEEAKSVVITPSVVSSSESQPSKPTAPAVVEKKVELPTDTQ 645

Query: 512 ----KKNAIDKKISNIFRRKHH 529
               KKN+++K+++ +F+RK H
Sbjct: 646 ASTHKKNSLEKRLAKLFKRKQH 667

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  147 bits (371), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 66/83 (79%), Positives = 74/83 (89%)

Query: 723 PRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLK 782
           P+KLTF DVKK ++ANAP+EFTDSAFGFPLP LT STVIM DHRL I+VERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 783 LSNSKRALREQVLLSNFMYSYLN 805
           LS + R LR+QVLLSNFMY+YLN
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLN 778

 Score =  136 bits (342), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 199/374 (53%), Gaps = 49/374 (13%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGYRN-SWSTQLEQG--- 61
           SE   AAQSLD+E+++VKNLKRLSIGS                   + S+   L  G   
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFT 80

Query: 62  --DKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPG-SPKSLTR 118
             D        SD    ++ I R  R+ +            T  +NT++    SPK + R
Sbjct: 81  EEDDTTTEIDGSDADETSASIDRT-RVEY-----------LTSYDNTQESSNESPKGVAR 128

Query: 119 RGAVNF----------SSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPE 168
             ++N           S +    R + S ++ K        V+  L WV A+QHPNVKPE
Sbjct: 129 TRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPE 188

Query: 169 NYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTG-----LVRRPSL 223
           NY+ELV++ L+ I+   T+  +K  +++ ++VS      NK + N  G     +VRRPS 
Sbjct: 189 NYLELVKETLNKIRDINTDGKEKSENNSEEEVS------NKENINENGRLRGSIVRRPSK 242

Query: 224 LRKSYTEFDEVKDSDIKEQSSTNNNVDS---TPHNKKFTLKDITEELTRISNKAGLTNND 280
           LRKSYTEF   +D ++ +++ +NN + S   T ++K+ +LK+IT EL + SNKAGLT+++
Sbjct: 243 LRKSYTEFSS-EDLELLDKALSNNRIISTRNTTNSKRLSLKEITNELVKHSNKAGLTDDN 301

Query: 281 AVTLARTLSMA-SVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEH 339
           AVTLARTLS+A SV  ++ET       ++  +  +QS + DD+  +T ++     + S  
Sbjct: 302 AVTLARTLSIASSVTNQNETG---RNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNT 358

Query: 340 STLKRSKY-TYHIR 352
           S+L+RSK+ TY ++
Sbjct: 359 SSLRRSKFNTYRVK 372

>Kwal_56.22637
          Length = 595

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 10/85 (11%)

Query: 487 HSKNRHEPLYNHKIEIANTLGTL----------PEKKNAIDKKISNIFRRKHHTRRANQE 536
           H   R EPLYN  I I N   T+          PE+  A++        ++++  R  Q 
Sbjct: 501 HIDERSEPLYNSIIRIRNDFETVMTKCSKKTKHPERFLAVNYTYLLDALQQNYISRLRQG 560

Query: 537 NSLAGLKISQLQWRNNDHKEKAVEA 561
           +  +  KIS +     DH E  VEA
Sbjct: 561 HDDSNFKISLIYQETKDHLEAIVEA 585

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 351 IRTQEDKDPTIPVST---ESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENK 407
           +RT+E+   +I VS     +  +D+ +  P + +++  H    + +W SL Q    + NK
Sbjct: 50  VRTEENSSDSISVSCILRTNNLEDITKWDPLAFSELALHLESDNSEWYSLFQCLLHDWNK 109

Query: 408 KRTDTDI 414
           K  + +I
Sbjct: 110 KHYNANI 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.124    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,015,405
Number of extensions: 1343930
Number of successful extensions: 6579
Number of sequences better than 10.0: 358
Number of HSP's gapped: 6664
Number of HSP's successfully gapped: 411
Length of query: 805
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 695
Effective length of database: 12,788,129
Effective search space: 8887749655
Effective search space used: 8887749655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)