Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F03399g38037418370.0
Scas_696.3642637613320.0
KLLA0D01639g38137712581e-174
YMR272C (SCS7)38437812511e-172
Kwal_27.1033237837711481e-157
AAL183W37737310961e-149
Kwal_47.18167227601062e-05
Scas_666.1212167979e-05
Scas_717.1418960920.001
CAGL0L03828g12166850.003
KLLA0F27577g17244840.009
Kwal_26.804619851850.009
YML054C (CYB2)59154860.014
ADL085C27330820.031
CAGL0K03069g19446800.040
Kwal_26.846112337750.082
AFL223W16554760.088
Scas_571.1d60937790.11
Kwal_14.80757883780.13
KLLA0B14795g55627780.14
YNL111C (CYB5)12047700.33
Sklu_2258.558043730.47
Scas_571.260250730.53
Scas_406.1904100730.56
CAGL0K10736g59361720.62
Sklu_2444.356430701.0
Kwal_26.8331432126701.0
Kwal_23.282356035691.5
KLLA0A12111g23630672.0
KLLA0F23672g12346642.6
KLLA0D02640g58930646.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03399g
         (374 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   712   0.0  
Scas_696.36                                                           517   0.0  
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   489   e-174
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   486   e-172
Kwal_27.10332                                                         446   e-157
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   426   e-149
Kwal_47.18167                                                          45   2e-05
Scas_666.12                                                            42   9e-05
Scas_717.14                                                            40   0.001
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    37   0.003
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    37   0.009
Kwal_26.8046                                                           37   0.009
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    38   0.014
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    36   0.031
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    35   0.040
Kwal_26.8461                                                           33   0.082
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    34   0.088
Scas_571.1d                                                            35   0.11 
Kwal_14.807                                                            35   0.13 
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    35   0.14 
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    32   0.33 
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        33   0.47 
Scas_571.2                                                             33   0.53 
Scas_406.1                                                             33   0.56 
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    32   0.62 
Sklu_2444.3 , Contig c2444 10960-12654                                 32   1.0  
Kwal_26.8331                                                           32   1.0  
Kwal_23.2823                                                           31   1.5  
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    30   2.0  
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    29   2.6  
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    29   6.1  

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/374 (93%), Positives = 350/374 (93%)

Query: 1   MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG 60
           MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG
Sbjct: 1   MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG 60

Query: 61  KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK 120
           KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK
Sbjct: 61  KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK 120

Query: 121 DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP 180
           DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP
Sbjct: 121 DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP 180

Query: 181 LFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH 240
           LFGNFLEAFTKTA            LYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH
Sbjct: 181 LFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH 240

Query: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP 300
           RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP
Sbjct: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP 300

Query: 301 YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFW 360
           YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMR            NYQLGFGVTSWFW
Sbjct: 301 YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFW 360

Query: 361 DKVFGTYLGPDAPL 374
           DKVFGTYLGPDAPL
Sbjct: 361 DKVFGTYLGPDAPL 374

>Scas_696.36
          Length = 426

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 292/376 (77%), Gaps = 4/376 (1%)

Query: 2   SVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61
            ++++ SKTLELF +  +AKHN+++DCWV+ ++RKIYDVSK+L DHP+   ++ K   GK
Sbjct: 46  QMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHA-GK 104

Query: 62  HGTDISQMELTTLK--FVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFDSTTF 118
             T++ + E    +   + D YL+GY+AT  EE+KLLTNK HKVEVKLN + NTFDSTTF
Sbjct: 105 DITELLKDEKIDQQTDLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTF 164

Query: 119 VKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGS 178
           VKDLPTEDKLSI TDYE+D KKH FLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG+ S
Sbjct: 165 VKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQES 224

Query: 179 APLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238
           APLFGNFLE FTKTA             Y I  A  N+N   A+ LF +G++VWT IEYC
Sbjct: 225 APLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYC 284

Query: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298
           +HRFLFHFDE LPEH+  +MIHFLLHGCHHYLPMD YRLVVPP LF+ LCAP YKLVFA 
Sbjct: 285 MHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFAL 344

Query: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSW 358
           LPYYWACAGFAGGM GYICYDLCHYFLHHSK+PPFMR            NYQLG+GVTSW
Sbjct: 345 LPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSW 404

Query: 359 FWDKVFGTYLGPDAPL 374
           +WDK FGTYL PD+PL
Sbjct: 405 YWDKKFGTYLSPDSPL 420

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  489 bits (1258), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 242/377 (64%), Positives = 281/377 (74%), Gaps = 13/377 (3%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           SS+ L L+ ++ L KHN K+DCWVS ++RKIY+V+++L +HP  A+ +   LD   GTDI
Sbjct: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYI---LDYA-GTDI 58

Query: 67  SQMELTTL---------KFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           + +    L         + + + YLVGYLAT +EEKKLLTNK H VEV L  +N FDST 
Sbjct: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTV 118

Query: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           FVK+LPTEDKLSI TDY+ DYKKHKFLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYGKG
Sbjct: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178

Query: 178 SAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237
           SAPLFGNFLE  +KT              Y I TALMNMN   A+FLF +G+FVWTLIEY
Sbjct: 179 SAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238

Query: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297
            LHRFLFH D+ LPE    F +HFLLHG HHYLPMD +RLV+PP LFVVLC P YKLVFA
Sbjct: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298

Query: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTS 357
            LPYYWACAGFAGGMLGY+CYDL HYFLHHS++PP+MR            NY+LGFGVTS
Sbjct: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 358 WFWDKVFGTYLGPDAPL 374
           WFWDKVFGTYLG +APL
Sbjct: 359 WFWDKVFGTYLGENAPL 375

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  486 bits (1251), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/378 (61%), Positives = 283/378 (74%), Gaps = 6/378 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57
           ++ ++SKTLELF +  + +HN+ +DCWV+   RKIYDV+++L +HP   +++        
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT-FDST 116
            +    +D+ +   +  + + D+YL+GYLAT +E  +LLTNK+HKVEV+L+AD T FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFVK+LP E+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  TKTA            +Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
           A LP YWA AGFAGG+ GY+CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPL 374
           SWFWD+VFGTYLGPDAPL
Sbjct: 361 SWFWDEVFGTYLGPDAPL 378

>Kwal_27.10332
          Length = 378

 Score =  446 bits (1148), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 270/377 (71%), Gaps = 15/377 (3%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
            +KTL L+  S + +HNS DDCWV+   RKIYDV+K+L+DHP   D + +      G DI
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA----GKDI 57

Query: 67  SQM---------ELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           +++              + + ++Y VGYLAT++EE+KLL N  HKVEVKL  ++ +DST 
Sbjct: 58  TEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKL--EDEYDSTV 115

Query: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           FV ++P E+KLSI TDY RDY +HKFLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+G
Sbjct: 116 FVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRG 175

Query: 178 SAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237
           SAPLFGNFLE  +KT+             Y I TA+ NMN   A+FLF +GIFVWTLIEY
Sbjct: 176 SAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEY 235

Query: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297
            +HRFLFH D +LP + + + +HFLLHG HHYLPMD YRLV+PP LF++LC P YKLVFA
Sbjct: 236 GMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFA 295

Query: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTS 357
            LPYYWACAGFAGGMLGY+CYDL HYFLHH+K+P  ++            NY+LGFGVTS
Sbjct: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTS 355

Query: 358 WFWDKVFGTYLGPDAPL 374
           W WDKVFGTYL  +APL
Sbjct: 356 WVWDKVFGTYLAENAPL 372

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  426 bits (1096), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/373 (57%), Positives = 258/373 (69%), Gaps = 10/373 (2%)

Query: 8   SKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDIS 67
           SKTL L+ ++ L KH  +  CWVS   RKIYDVS++L +HP   D       GK  T + 
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG-GDQYILDYAGKDITAVL 61

Query: 68  QMEL------TTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKD 121
           + +L         + + + YLVGYLAT +EE KLLTN+ H +EV        D+TTFVK+
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV---TPENLDTTTFVKE 118

Query: 122 LPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPL 181
           LP E+ LS+ TD+  DY KH FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYGKGSAPL
Sbjct: 119 LPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPL 178

Query: 182 FGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHR 241
           FGNFLE  +KT             LY++T AL NM   LAL  F  G+FVWTLIEY LHR
Sbjct: 179 FGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHR 238

Query: 242 FLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPY 301
           FLFHFD+ +PE ++ F +HFLLHG HHYLPMD YRLV+PPALFVVLCAP Y+LVF+  P 
Sbjct: 239 FLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPE 298

Query: 302 YWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 361
           Y AC  FAGG+ GY+CYD+ HYFLHH K+PPFMR            NY+LGFGVTSW+WD
Sbjct: 299 YCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWD 358

Query: 362 KVFGTYLGPDAPL 374
           KVFGTYL  ++P+
Sbjct: 359 KVFGTYLASNSPV 371

>Kwal_47.18167
          Length = 227

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 5  ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          + +S  L       +A H   DDCW+S H  K+YDVS YL  HP  A  + K L GK  T
Sbjct: 25 SQTSSQLPFISSDEVATHTDADDCWISIH-GKVYDVSSYLPQHPGGAQVMLK-LAGKDAT 82

>Scas_666.12
          Length = 121

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP---------EEADAVHKALDGKH 62
          +++    +A+HN  DD W+   E K+YDVSK+L +HP            DA    LD  H
Sbjct: 3  QVYSYQQIAEHNKPDDAWIII-EGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGH 61

Query: 63 GTDISQM 69
            D  Q+
Sbjct: 62 SDDALQI 68

>Scas_717.14
          Length = 189

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 10  TLELFP-----QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           T +++P      S+L +H S+ DCW + ++ K+Y VS YL+ HP   D + +   GK  T
Sbjct: 104 TYQIYPFLKINNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST 162

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
          cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 37.4 bits (85), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHP---------EEADAVHKALDGKHGTDISQM 69
          +++HN + DCW+   +  +YDVSK+L +HP            DA    +D  H  D  ++
Sbjct: 10 VSEHNKEGDCWIII-DGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGHSDDALKI 68

Query: 70 ELTTLK 75
           L TLK
Sbjct: 69 -LKTLK 73

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
          Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 13 LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHK 56
          L     +A+H+S+ DCW   H  K+YD++ +L  HP  A  + K
Sbjct: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLK 47

>Kwal_26.8046
          Length = 198

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           ++ LA+H + +DCW   ++ K+Y +S YL  HP   D + K   GK  T +
Sbjct: 125 KAQLAQHKAPEDCWCVINQ-KVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 6   DSSKTLELFPQSV----LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           D+   L++  Q +    +AKHN  DDCWV  +   +YD++++L +HP   D + 
Sbjct: 79  DNEPKLDMNKQKISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIK 131

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +++H S+DDCW   H R +YD++  L++HP
Sbjct: 98  VSQHTSRDDCWFIIHGR-VYDITGLLENHP 126

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           LA+HN+ +DCW   +  K+Y +S YL  HP  A  +     G+  T
Sbjct: 124 LARHNTAEDCWTVING-KVYSISSYLSFHPGGAKILIDKSSGQDST 168

>Kwal_26.8461
          Length = 123

 Score = 33.5 bits (75), Expect = 0.082,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +L+    +A+HN++ D W+   + K+YD +K++ +HP
Sbjct: 3  KLYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHP 38

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
          complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 33.9 bits (76), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +L+    +A+HNS++D W+  +  K+YD +K+ ++HP   D V   L G+  T+
Sbjct: 42 KLYTYQEIAEHNSENDLWLIIN-GKVYDCTKFAEEHP-GGDEVLIDLAGQDATE 93

>Scas_571.1d
          Length = 609

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           + KHNS++DCW+  +  ++YD++ ++  HP  +D + 
Sbjct: 100 VTKHNSENDCWIVIN-GQVYDLTSFMSIHPGGSDIIK 135

>Kwal_14.807
          Length = 578

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 18/83 (21%)

Query: 13  LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK---------HG 63
           + PQ V AKH+  DDCWV  +   +YD+S ++  HP    A+ KA  GK         H 
Sbjct: 79  IRPQEV-AKHSKPDDCWVVINGY-VYDLSDFIAVHP-GGPAIIKANAGKDVSAIFNAFHA 135

Query: 64  TDISQMELTTLKFVTDDYLVGYL 86
           +D+ +      KF+ +   +G L
Sbjct: 136 SDVIE------KFIPEKKRIGPL 152

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 22  HNSKDDCWVSTHERKIYDVSKYLKDHP 48
           HN  DDCW+   + ++YD++K+L  HP
Sbjct: 89  HNRIDDCWIVI-DNEVYDITKFLSQHP 114

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 31.6 bits (70), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN  ++ W+   + K+YDVS++  +HP   D +   L G+  T+
Sbjct: 10 VAEHNGPENFWIIIDD-KVYDVSQFKDEHP-GGDEIIMDLGGQDATE 54

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           DSSK   + PQ V AKHN   DCWV   +  +YD+++++  HP
Sbjct: 75  DSSKK-PIDPQDV-AKHNDPKDCWVVI-DGYVYDLTEFIHSHP 114

>Scas_571.2
          Length = 602

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 17  SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           S +A+HN+  DCW+  +   +YD++ ++  HP  AD + K+  GK  T I
Sbjct: 92  SEVARHNTPADCWIVINGV-VYDLTSFIPVHPGGADII-KSNAGKDVTAI 139

>Scas_406.1
          Length = 904

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 21  KHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHG---TDISQMELTTLKFV 77
           K+ +K D ++  +   I+D+S     H   A+     + G  G    D ++++L  LK +
Sbjct: 780 KNGTKQDLYMIENITLIFDISH----HRLTAEETELKISGYFGPLEVDFTELQLLYLKEI 835

Query: 78  TDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           +D  L G    SDEEK+ LT        + N  NT DS+T
Sbjct: 836 SDQ-LKGAFTISDEEKQQLT-------TEYNYTNTLDSST 867

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
           DSSK  ++ P  V+ KHN+ +DCWV   +  +YD++ ++  HP   D + K   GK  T 
Sbjct: 84  DSSKP-KISPSEVI-KHNTPEDCWVVI-DGYVYDLTNFIALHPGGPDII-KTNAGKDVTA 139

Query: 66  I 66
           I
Sbjct: 140 I 140

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 22  HNSKDDCWVSTHERKIYDVSKYLKDHPEEA 51
           HN+ DDCW+  +   +YD+++++K HP  A
Sbjct: 96  HNNIDDCWIVLNG-DVYDITEFIKIHPGGA 124

>Kwal_26.8331
          Length = 432

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 61/126 (48%), Gaps = 14/126 (11%)

Query: 64  TDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEV----KLNADNTFDSTTFV 119
           + I+  +   L+ + D+YL+   A     +KLL  + H  ++    K  A N+F ++   
Sbjct: 310 SSITGFKEALLQRLMDNYLIEEPAA----EKLLREQEHTAQITNKKKAKASNSFLNSVDY 365

Query: 120 KDLPTEDKLSITTDYERDYKKHKFLD---LNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
             +PT   L+   +Y  ++KKH + +   L   ++ +  FG+  + FY   + R ++  K
Sbjct: 366 VQIPTAINLAKYPEYFPEWKKHGYAEVPFLGAQIVAKQGFGHSNESFY---VTREKYEKK 422

Query: 177 GSAPLF 182
           G + ++
Sbjct: 423 GPSVIW 428

>Kwal_23.2823
          Length = 560

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 14  FPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
            P S +  HN  +DCW+  ++ ++YDV+ ++  HP
Sbjct: 81  IPVSEVMLHNKLNDCWIVLND-EVYDVTSFIAAHP 114

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +  HN  DDCW+   +  +YD++ +L  HP
Sbjct: 86  VKSHNRIDDCWI-VIDGDVYDITGFLSKHP 114

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          +++H + DD W+   + K+YD +K++ +HP   D +   L G+  T
Sbjct: 10 VSEHKTVDDLWMII-DGKVYDCTKFVDEHP-GGDEILVDLGGQDAT 53

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +AKH+S  DCWV   E  +Y+++ ++  HP
Sbjct: 95  VAKHSSPKDCWV-VIEGYVYNLTDFISAHP 123

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,585,019
Number of extensions: 551911
Number of successful extensions: 2032
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2074
Number of HSP's successfully gapped: 47
Length of query: 374
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 271
Effective length of database: 13,030,455
Effective search space: 3531253305
Effective search space used: 3531253305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)