Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00869g28728313510.0
YOL048C3422674682e-56
Scas_643.21*3142503967e-46
KLLA0D02112g3152592534e-25
ADL027W3362561973e-17
YAL018C3252451955e-17
Kwal_26.7146143771724e-15
ADR122C3752541692e-13
CAGL0H06237g3022421602e-12
Scas_548.5d3012731266e-08
KLLA0F07601g3052381133e-06
Kwal_23.56541992101015e-05
Scas_643.20d35764880.004
YOL047C356265850.011
CAGL0F00891g21576800.028
YHR015W (MIP6)65958740.28
ADR271W29375661.7
Scas_721.1388159653.6
Scas_605.1542865644.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00869g
         (283 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00869g join(complement(94301..94456),complement(93453..941...   525   0.0  
YOL048C (YOL048C) [4771] chr15 complement(240202..240945,241024....   184   2e-56
Scas_643.21*                                                          157   7e-46
KLLA0D02112g join(180975..181208,181302..182015) weakly similar ...   102   4e-25
ADL027W [1715] [Homologous to ScYAL018C - NSH] complement(652351...    80   3e-17
YAL018C (YAL018C) [50] chr1 complement(118567..119544) Nonessent...    80   5e-17
Kwal_26.7146                                                           71   4e-15
ADR122C [1863] [Homologous to ScYAL018C - NSH] (922514..923641) ...    70   2e-13
CAGL0H06237g complement(613054..613962) similar to sp|P31379 Sac...    66   2e-12
Scas_548.5d                                                            53   6e-08
KLLA0F07601g complement(717689..718606) weakly similar to sp|P31...    48   3e-06
Kwal_23.5654                                                           44   5e-05
Scas_643.20d                                                           39   0.004
YOL047C (YOL047C) [4772] chr15 complement(241612..242439,242503....    37   0.011
CAGL0F00891g complement(94950..95597) weakly similar to tr|Q0821...    35   0.028
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    33   0.28 
ADR271W [2012] [Homologous to ScYDL087C (LUC7) - SH] complement(...    30   1.7  
Scas_721.13                                                            30   3.6  
Scas_605.15                                                            29   4.0  

>CAGL0F00869g
           join(complement(94301..94456),complement(93453..94160))
           some similarities with tr|Q08219 Saccharomyces
           cerevisiae YOL048c or sp|P31379 Saccharomyces cerevisiae
           YAL018c
          Length = 287

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/283 (92%), Positives = 261/283 (92%)

Query: 1   MGIAGYLQQYLFTPVLDHAKLRQKRYLFKMDLIKQGFNKDLFLSSTYKYPLKGLFNVITR 60
           MGIAGYLQQYLFTPVLDHAKLRQKRYLFKMDLIKQGFNKDLFLSSTYKYPLKGLFNVITR
Sbjct: 1   MGIAGYLQQYLFTPVLDHAKLRQKRYLFKMDLIKQGFNKDLFLSSTYKYPLKGLFNVITR 60

Query: 61  PYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSI 120
           PYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSI
Sbjct: 61  PYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSI 120

Query: 121 AAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRKTTKSRRSIWSAHTIIYSFLS 180
           AAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRKTTKSRRSIWSAHTIIYSFLS
Sbjct: 121 AAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRKTTKSRRSIWSAHTIIYSFLS 180

Query: 181 AKVTXXXXXXXXXXXXXXXXXXXXXXNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKN 240
           AKVT                      NQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKN
Sbjct: 181 AKVTSLGQSIVLSLVSLIPVLGPLIVNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKN 240

Query: 241 LGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWSADLVKKE 283
           LGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWSADLVKKE
Sbjct: 241 LGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWSADLVKKE 283

>YOL048C (YOL048C) [4771] chr15
           complement(240202..240945,241024..241308) Protein of
           unknown function [1029 bp, 342 aa]
          Length = 342

 Score =  184 bits (468), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 149/267 (55%), Gaps = 12/267 (4%)

Query: 29  KMDLIKQGFNKDLFLSSTYKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVT 88
           + +L+++ F K++F S  + YP  G + V+T P YWK + +FA  Y +IF  +AG +YVT
Sbjct: 72  RYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALIFVTIAGLFYVT 131

Query: 89  IMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQ 148
           ++P ++  A+L +GP+G++L HIQW++Q+N + A++CR L+L  +  ++FD++L    Q 
Sbjct: 132 LVPLLVTWAILLLGPLGVILVHIQWILQTNVLTAFVCRTLVLTHITNQIFDISLVLQDQD 191

Query: 149 KLVSDAKYLSRKTTKSRR-----SIWSAHTI-------IYSFLSAKVTXXXXXXXXXXXX 196
           + +++ K L +     R+     ++ + +TI       I   L                 
Sbjct: 192 EFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLTLLS 251

Query: 197 XXXXXXXXXXNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFEL 256
                     NQ+ AP R  +YL RY  LK ++    K F+Y++     CFG+SAGL EL
Sbjct: 252 LIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLEL 311

Query: 257 IPLASMVTIMSNTVGAAIWSADLVKKE 283
           IP  ++VTI SNTVGAA W   L+K E
Sbjct: 312 IPFFTIVTISSNTVGAAKWCTSLLKGE 338

>Scas_643.21*
          Length = 314

 Score =  157 bits (396), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 131/250 (52%), Gaps = 19/250 (7%)

Query: 51  LKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGLVLAH 110
           +KG+  + T P YW+ + +F GSY VIF ++    Y  ++PF+L  + L +GPIG+ +AH
Sbjct: 57  VKGICEIFTNPIYWRFIFLFGGSYTVIFILILTIDYFILLPFLLAWSALILGPIGIGIAH 116

Query: 111 IQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSR----------- 159
           +QWLV S SI ++ C+ L+L  +  +VFD+ L  NG +  +++AK+L             
Sbjct: 117 VQWLVISASITSWSCKKLLLPIIRDKVFDMALVANGGENFLNNAKFLKSSDRRVQDVKVE 176

Query: 160 ------KTTKSRRSIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXXXXNQITAPD 213
                 K + +R   W      +  +S  V                       NQI AP 
Sbjct: 177 ENTEYDKKSNNRELKWVFRE--FCMVSNFVKKIFFFIMFVGISMVPIIGPAIVNQINAPR 234

Query: 214 RALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAA 273
           R  SY+ R+ +L  +     + F+Y++ G   CFG +AG+ E +P + ++T++SNTVGAA
Sbjct: 235 RGFSYMKRFFYLSGFDKVQTRDFQYEHFGLFLCFGTAAGILEFLPFSPIITMISNTVGAA 294

Query: 274 IWSADLVKKE 283
            WS  L+K++
Sbjct: 295 KWSISLLKEK 304

>KLLA0D02112g join(180975..181208,181302..182015) weakly similar to
           sgd|S0005408 Saccharomyces cerevisiae YOL048c,
           hypothetical start
          Length = 315

 Score =  102 bits (253), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 118/259 (45%), Gaps = 6/259 (2%)

Query: 27  LFKMDLIKQGFNKDLFLSSTYKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYY 86
           ++++D I+  F  D F + +  YP  G+F  +    YW    + +  YL++F  +   Y 
Sbjct: 53  IWRVDSIRTNFFHDFFQTKSIWYPFLGVFQFLICYRYWYYGLVTSVCYLILFFALLWLYA 112

Query: 87  VTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNG 146
             ++P + G  +L +GP+GL +A +Q L+Q N+      RN +L K   ++F+LTL + G
Sbjct: 113 AFLLPILAGWQILLLGPVGLAIAVLQMLLQCNAWTLRGVRNFVLPKFTNDIFELTLLRKG 172

Query: 147 QQKLVSDAKYLSRKTTKSRR----SIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXX 202
           Q + ++  K                 W  H + ++  S  +                   
Sbjct: 173 QIETLNSLKRRQLPACPELHLNNIEFW-IHDVPFNTFSF-LRWLFVFIFITLISLLPIVG 230

Query: 203 XXXXNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASM 262
                 +  PDRA  Y   ++  ++ +    +   Y  LGQL  FG++AGL ELIP  S 
Sbjct: 231 PLAATILQTPDRAYGYYDVWMIRRRLSDKAKRDEYYSRLGQLWAFGLTAGLLELIPGFSA 290

Query: 263 VTIMSNTVGAAIWSADLVK 281
           + ++SN +   +W+ D +K
Sbjct: 291 LLMISNVIAVGVWANDDIK 309

>ADL027W [1715] [Homologous to ScYAL018C - NSH]
           complement(652351..653361) [1011 bp, 336 aa]
          Length = 336

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 110/256 (42%), Gaps = 8/256 (3%)

Query: 33  IKQGFNKDLFLSSTYKYPLKGLFNVITRPYYWKPLGIFAG-SYLVIFAVVAGAYYVTIMP 91
           +++ F  D      Y YP++G    +  P YW   G+  G  Y ++F ++   Y+  ++P
Sbjct: 48  LRKNFWDDFTNYRNYLYPIRGFCEFLKWPRYWG-FGLIVGFCYALLFIMLTALYFTFLLP 106

Query: 92  FILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLV 151
            +    ++ +GPIG+V++ IQ ++Q N       +  +L  +  ++FD  L + G  +L+
Sbjct: 107 ILSAWQVVLLGPIGMVISIIQMVLQCNMWTVRGVKWFVLPVIKEDLFDTYLRRKGYGRLL 166

Query: 152 SDAKYLSRKTTKSRR----SIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXXXXN 207
           +  K  S     + R      W     +  FL   V                        
Sbjct: 167 NTLKQRSFPVVPTYRKNHLEFWIYQIPLQVFLF--VCSVTLTIFIIALSMVPIIGPTFAT 224

Query: 208 QITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMS 267
            + +P R+ +Y + ++   + T        Y+ LGQ   FG+S G FEL P+ S++ I S
Sbjct: 225 ILLSPRRSFNYYNTWMNQLRMTRQMKCDSYYEKLGQHMAFGLSCGFFELFPVLSIIGICS 284

Query: 268 NTVGAAIWSADLVKKE 283
           N +  A+   D + + 
Sbjct: 285 NVISTALVVEDEIDQR 300

>YAL018C (YAL018C) [50] chr1 complement(118567..119544) Nonessential
           protein of unknown molecular function, putative
           component of the spore wall [978 bp, 325 aa]
          Length = 325

 Score = 79.7 bits (195), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 109/245 (44%), Gaps = 11/245 (4%)

Query: 37  FNKDLFLSSTYKYPLKGL--FNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFIL 94
           F KD F    + YP KG   FN     Y    LGI + SYL++FA+V+  Y+ TI P + 
Sbjct: 61  FFKDAFTGGAFMYPFKGFLEFNTNKSSYSTTMLGILS-SYLIMFALVSFVYWATITP-MY 118

Query: 95  GGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDA 154
              L+ +GPIGL +A     +Q+N       R   L   N  + ++ L KNG ++ +S+ 
Sbjct: 119 TAFLIVLGPIGLFIAIFHSFLQANVFTLLFMR---LSHFNNHLVEVCLEKNGLEENLSEV 175

Query: 155 KYLSRKTTKSRRSIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXXXXNQI-TAPD 213
           K +      +    W+ +   + F   K                          I  +P 
Sbjct: 176 KPIKYYAPINSIYFWAYY---FPFKLVKYMLGLSVLFVLLVISFFPLIGPILFHILISPF 232

Query: 214 RALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAA 273
               Y ++ L L+ + +   ++  Y + GQ A FG  AGL E +P+ +   I +NT+G+ 
Sbjct: 233 ITQIYFTKVLRLQNFDNIQRRENIYLHAGQYASFGFLAGLIESVPILAGFAISTNTIGSV 292

Query: 274 IWSAD 278
           +++ D
Sbjct: 293 LFNLD 297

>Kwal_26.7146
          Length = 143

 Score = 70.9 bits (172), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 50/77 (64%)

Query: 207 NQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIM 266
           NQ+ +P R  SY SRY  LK      +K   Y++LG+   FG+ AGL ELIP+ S++TI 
Sbjct: 65  NQLKSPKRGFSYGSRYYTLKNLGGAQLKDKFYEHLGEYTGFGMMAGLLELIPVMSIITIP 124

Query: 267 SNTVGAAIWSADLVKKE 283
           SN +  A+W+++ +KK+
Sbjct: 125 SNIIAGALWASNELKKD 141

>ADR122C [1863] [Homologous to ScYAL018C - NSH] (922514..923641)
           [1128 bp, 375 aa]
          Length = 375

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 111/254 (43%), Gaps = 35/254 (13%)

Query: 40  DLFLSSTYKYPLKGLF-NVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGAL 98
           D F    Y+YP++ L  +  TR Y+   + IF   Y  I+ V+   Y++TI P  LG ++
Sbjct: 63  DFFRDQAYRYPVRALIRSCTTRRYFVVNISIFV-FYSAIYVVITVIYFLTIFPVYLGLSV 121

Query: 99  LTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAK--- 155
           + +GP G+V+A +  L+ +N++A  + R   + +++       L  NG  +L+ +     
Sbjct: 122 I-LGPAGIVMAWLHMLLHTNNLAMMVLR---MSQVSRYTLKNALKVNGNIELLENPPVPV 177

Query: 156 -----------YLSRKTTKSRRSIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXX 204
                      +++    K    +  A T++   L + +                     
Sbjct: 178 KLFYPLDTPYFWMNHFPWKMLEYMGGAFTMVVLLLVSAIP---------------VFGPV 222

Query: 205 XXNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVT 264
             N + +P     YL++YL L+ + +   ++  Y N GQ   FG+ A   E+ P  S +T
Sbjct: 223 FFNILISPFVTRLYLAKYLRLRGFNNIQREERFYDNFGQYVAFGLVATCLEIPPFLSGIT 282

Query: 265 IMSNTVGAAIWSAD 278
             +N +  A+W  +
Sbjct: 283 YATNNIAVALWDPE 296

>CAGL0H06237g complement(613054..613962) similar to sp|P31379
           Saccharomyces cerevisiae YAL018c, start by similarity
          Length = 302

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 106/242 (43%), Gaps = 10/242 (4%)

Query: 39  KDLFLSSTYKYPLKGLFNVIT--RPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGG 96
            DLF  + + YP KG++ + +  R Y      +F+  YLV +A+V   Y+ TI P +   
Sbjct: 63  DDLFTGNMFVYPFKGMYELYSNFRDYAASTTALFS-LYLVSYAIVTMVYWATITP-VYTA 120

Query: 97  ALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKY 156
             + +GP G+++A I  ++ +N +     R   +  LN  +    +  NG Q L      
Sbjct: 121 LFIVLGPFGILIAWIHSILHTNMLTMMFLR---VSHLNEGLVKNCVDANGYQSLFRHTP- 176

Query: 157 LSRKTTKSRRSIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXXXXNQITAPDRAL 216
           +  + + S    W  H  +   LS  +T                      + + +P  + 
Sbjct: 177 IKYQVSPSTPYFWYFH--LTKKLSEYLTGLIILVFLLIISSIPIVGPFTFHFLVSPALSR 234

Query: 217 SYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWS 276
            Y S+ L LK  ++ +  +  Y++ GQ   FG++AG  +  P  + +++ +N +GA +  
Sbjct: 235 VYFSKMLRLKGLSNIERYERIYQHPGQYTMFGITAGFLDSFPFLAGISLSTNILGATLLG 294

Query: 277 AD 278
            D
Sbjct: 295 ID 296

>Scas_548.5d
          Length = 301

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 103/273 (37%), Gaps = 50/273 (18%)

Query: 29  KMDLIKQGFNKDLFLSSTYKYPLKGL----FNV------ITRPYYWKPLGIFAGSYLVIF 78
           ++ L+   F  D F    Y YP KG      NV      ITR Y           Y + F
Sbjct: 53  RISLMTSSFLSDFFSIKPYYYPFKGFKEMQLNVAGYMPTITRLYLL---------YCLSF 103

Query: 79  AVVAGAYYVTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICR----NLMLEKLN 134
           A V G Y+VTI P +    LL  GP G +L  +  L+ +N +     R    N  L  + 
Sbjct: 104 ATVFGIYWVTITP-VYFSILLVFGPFGFILTGLHSLLHANLLTMLFLRMSHFNNQLTIVC 162

Query: 135 TEVFDLTLAKNGQ--------QKLVSDAKYLSRKTTKSRRSIWSAHTIIYSFLSAKVTXX 186
            + + LT+ K+ +          L     YL  KT K     +    I+ S L +     
Sbjct: 163 MKTYGLTVDKDARPTKHFVPLNSLYFWTYYLPYKTMK-----YGIGFIVLSILLS----- 212

Query: 187 XXXXXXXXXXXXXXXXXXXXNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLAC 246
                               + I AP  +  Y S+   L+ +     ++  +   G  A 
Sbjct: 213 --------ISFLPIFGPIIFSVIIAPFVSKIYFSKMFRLRGFDDRRREEIFFNRFGLYAS 264

Query: 247 FGVSAGLFELIPLASMVTIMSNTVGAAIWSADL 279
           FG+ A L E IP+ S + I  NT+G  +   ++
Sbjct: 265 FGIVASLTETIPIFSALFISFNTIGCTLLGIEM 297

>KLLA0F07601g complement(717689..718606) weakly similar to sp|P31379
           Saccharomyces cerevisiae YAL018c singleton, start by
           similarity
          Length = 305

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 100/238 (42%), Gaps = 13/238 (5%)

Query: 47  YKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGL 106
           Y YPL   + +++ P YWK        YL+++A+V   Y +TI+P     ++  +GPIGL
Sbjct: 71  YLYPLVSYWELLSTPEYWKSSVPIMVVYLLLYALVTFVYLLTILPVYTPLSVF-LGPIGL 129

Query: 107 VLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRKTTKSRR 166
           ++A I   + +N +     R   + ++N+      +A       + DA   + +  K   
Sbjct: 130 IVAWIHMFLHTNMLTMMTIR---MSQMNSFTMYQGMAIRSMDVNIIDAG--NDQPIKYYY 184

Query: 167 SIWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXXX----XXNQITAPDRALSYLSRY 222
            + S +   ++ L  K+T                          + + +P     Y + Y
Sbjct: 185 PLASTY-FFFNHLPWKLTEYFAGFVVLCGLLLISSIPILGPFIFHTLISPFITRLYWAPY 243

Query: 223 L-FLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWSADL 279
           L +LK        +F YK +GQ   FG+ AG  E  P+ S +   ++ +    W+ DL
Sbjct: 244 LRYLKVDNLQRETRF-YKMMGQYIAFGLVAGQLESWPIVSALAYSAHAIAICQWAQDL 300

>Kwal_23.5654
          Length = 199

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 82/210 (39%), Gaps = 26/210 (12%)

Query: 87  VTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICR-------NLMLEKLNTEVFD 139
           +T+ PF+LG   + +GP G+ +A +   +  N  A  + R        +MLEKL  +   
Sbjct: 1   MTLFPFVLGVNTVLLGPFGVTIAVLHSFLHVNLYATSLTRLGCLGYAKVMLEKLLRD--- 57

Query: 140 LTLAKNGQQKLVSDAKYLSRKTTKSRRSIWSAH---TIIYSFLSAKVTXXXXXXXXXXXX 196
               K  Q  +V  AK + ++    +  +   H   ++I   + A +             
Sbjct: 58  ----KKDQSAVV--AKIIRQQARAVQLPVAKRHWTQSLIVFLVKAAIRISFFSLLFVVSF 111

Query: 197 XXXXXXXXXXNQITAP---DRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGL 253
                              D ++ Y S      Q    D     Y N+G+   FG+++G 
Sbjct: 112 LPIVGVVVVKMVRCGDIGYDYSIPYPSNCRNPVQRRGDDF----YSNIGKYMAFGITSGF 167

Query: 254 FELIPLASMVTIMSNTVGAAIWSADLVKKE 283
            EL+P+ S +TI SN +G A W     K E
Sbjct: 168 LELLPVISGLTIASNYLGRATWFLADAKAE 197

>Scas_643.20d
          Length = 357

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 209 ITAPDRALSYLSRYLF-LKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMS 267
           +TA     SY   Y + L++  S + +K  Y + G+   FGVS  + E IP+ S ++I S
Sbjct: 279 LTAARHGFSYSFPYFWELRKVNSNERRKIFYGHYGKWFWFGVSCYICEFIPIFSTLSITS 338

Query: 268 NTVG 271
           N+VG
Sbjct: 339 NSVG 342

>YOL047C (YOL047C) [4772] chr15
           complement(241612..242439,242503..242745) Protein of
           unknown function [1071 bp, 356 aa]
          Length = 356

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 101/265 (38%), Gaps = 16/265 (6%)

Query: 32  LIKQGFNKDLFLSSTYK---YPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVT 88
           L+K  F KDL   S+++   YP KG+   +    Y     +  G YL+   ++     + 
Sbjct: 60  LVKDNFWKDL--ESSHQIIWYPYKGISESVGNSDYLHLFFLIFGYYLLNLLLIVAFTSIL 117

Query: 89  IMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQ 148
               ++   L  +G   L LA++Q ++ S ++   + +      L T ++ +T A+ G  
Sbjct: 118 AWSLLVCIYLPFLGLFALPLAYMQTILISTTLCNSMVKGTDF-VLFTRIYGVTFARKGLT 176

Query: 149 KLVSDAKYLSRKTTKSRRS-----IWSAHTIIYSFLSAKVTXXXXXXXXXXXXXXXXXXX 203
           +L    + +S      RRS     ++S    + S     +                    
Sbjct: 177 ELSEACETISFTPFVYRRSHRLGGLFSKRFYLVSLPQFFIFFFWYIFIAFMFLLLLLVPI 236

Query: 204 XXXNQIT----APDRALSYLSRYLF-LKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIP 258
                I     +P     Y   Y   +    S  + K  YK   +   + +S+GL E IP
Sbjct: 237 VGPITINMLPFSPGMGFYYFEPYFVDVLHLDSRKLSKVYYKGFAKWLLYSISSGLLESIP 296

Query: 259 LASMVTIMSNTVGAAIWSADLVKKE 283
           +   + I +N VGA++W    +K  
Sbjct: 297 ILGGLFIGTNAVGASLWIVKEIKDR 321

>CAGL0F00891g complement(94950..95597) weakly similar to tr|Q08218
           Saccharomyces cerevisiae YOL047c or sp|P31379
           Saccharomyces cerevisiae YAL018c, hypothetical start
          Length = 215

 Score = 35.4 bits (80), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 209 ITAPDRALSYLSRYL-FLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMS 267
           I A     +Y   Y   L++    +++K  Y+N  +   +GV+  + E +P  S     S
Sbjct: 123 IFAGQNGFAYFQPYFKELRKMDEKELRKVYYQNYSKWYLYGVACAVIESLPFLSGYLQPS 182

Query: 268 NTVGAAIWSADLVKKE 283
             VGA++WSA  +K+E
Sbjct: 183 LFVGASLWSARELKEE 198

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 96  GALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTE-VFDLTLAKNGQQKLVS 152
           GA   +G + L  A ++   + NS+  Y C+N   EK   E VF+ T+AK   QK ++
Sbjct: 51  GAGYKLGDVKLKDAEVK---EKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYIT 105

>ADR271W [2012] [Homologous to ScYDL087C (LUC7) - SH]
           complement(1165929..1166810) [882 bp, 293 aa]
          Length = 293

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 14/75 (18%)

Query: 104 IGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTE-------VFDLT--LAKNGQQKL---- 150
           +GL++  I+ LV+SN +   + ++L L+ L  E       V D+T  + ++ QQKL    
Sbjct: 134 MGLMIQEIETLVRSNEVVKAMVQSLKLQTLQKERHELAKKVRDITENVGQSAQQKLQVCK 193

Query: 151 VSDAKYLSRKTTKSR 165
           V  A YLSR  T  R
Sbjct: 194 VCGA-YLSRLDTDRR 207

>Scas_721.13
          Length = 881

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 8/59 (13%)

Query: 62  YYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMGPIGLVLAHIQWLVQSNSI 120
           + WK LG  +GS  ++ +++  AY++  +P  L        P  L L +I  L + N I
Sbjct: 755 FSWKSLGQLSGSLAILCSLLGAAYFINDLPRAL--------PQNLSLKYIAKLNELNYI 805

>Scas_605.15
          Length = 428

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 22  RQKRYLFKMDLIKQGFNKDLFLSSTYKYPLKGLFNV-ITRPYYWKPLGIFAGSYLVIFAV 80
           R++R L   DL+ QG        S YK  L+G  NV   + Y   P+G  A  + +  A 
Sbjct: 180 RRRRSLEGQDLVMQGLVSAANSKSEYKKLLQGTSNVFFAKKYGIPPIGTVAHEWFMGIAA 239

Query: 81  VAGAY 85
           +   Y
Sbjct: 240 ITNDY 244

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,951,706
Number of extensions: 296041
Number of successful extensions: 1036
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1038
Number of HSP's successfully gapped: 32
Length of query: 283
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 183
Effective length of database: 13,134,309
Effective search space: 2403578547
Effective search space used: 2403578547
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)