Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00781g1411397192e-99
YDR159W (SAC3)130153670.55
Kwal_26.704222634650.61
Kwal_27.1201024982631.2
KLLA0B04587g40065612.7
Kwal_27.1132077526594.4
AEL173W53134594.8
Kwal_14.126363546594.9
Scas_711.5562833587.4
YJL210W (PEX2)271111577.7
Sklu_2389.459725579.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00781g
         (139 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00781g 88010..88435 no similarity, hypothetical start           281   2e-99
YDR159W (SAC3) [1001] chr4 (771871..775776) Nuclear protein requ...    30   0.55 
Kwal_26.7042                                                           30   0.61 
Kwal_27.12010                                                          29   1.2  
KLLA0B04587g 411097..412299 similar to sp|P47160 Saccharomyces c...    28   2.7  
Kwal_27.11320                                                          27   4.4  
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    27   4.8  
Kwal_14.1263                                                           27   4.9  
Scas_711.55                                                            27   7.4  
YJL210W (PEX2) [2718] chr10 (36919..37734) Peroxisomal biogenesi...    27   7.7  
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            27   9.9  

>CAGL0F00781g 88010..88435 no similarity, hypothetical start
          Length = 141

 Score =  281 bits (719), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%)

Query: 1   MEVIGGDLRFSPLPTRLSETYLPSATEPPAASYRKNPHPCQKAIELPTKTPQRTRSVPCR 60
           MEVIGGDLRFSPLPTRLSETYLPSATEPPAASYRKNPHPCQKAIELPTKTPQRTRSVPCR
Sbjct: 1   MEVIGGDLRFSPLPTRLSETYLPSATEPPAASYRKNPHPCQKAIELPTKTPQRTRSVPCR 60

Query: 61  IKHPQKHRRTSRPPPDCPLCGLRLCEVRVCRAGRIVVGYIAKSPTTSQVATATGATGALM 120
           IKHPQKHRRTSRPPPDCPLCGLRLCEVRVCRAGRIVVGYIAKSPTTSQVATATGATGALM
Sbjct: 61  IKHPQKHRRTSRPPPDCPLCGLRLCEVRVCRAGRIVVGYIAKSPTTSQVATATGATGALM 120

Query: 121 EAPSYIRAVWRASRSVNMG 139
           EAPSYIRAVWRASRSVNMG
Sbjct: 121 EAPSYIRAVWRASRSVNMG 139

>YDR159W (SAC3) [1001] chr4 (771871..775776) Nuclear protein required
            for mRNA export from the nucleus to the cytoplasm and for
            leucine transport, mutants exhibit defects in
            cytoskeletal function and in mitosis [3906 bp, 1301 aa]
          Length = 1301

 Score = 30.4 bits (67), Expect = 0.55,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 11   SPLPTRLSETYLPSATEPP-----AASYRKNPHPCQKAIELPTKTPQRTRSVP 58
            +PL +RL+ +   S+T PP     A  +RKN         LP  TP  + ++P
Sbjct: 1167 TPLASRLNTS--GSSTSPPLPSHLAMKFRKNSRVTSLHTVLPVSTPSHSNNIP 1217

>Kwal_26.7042
          Length = 226

 Score = 29.6 bits (65), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 3/34 (8%)

Query: 17 LSETYLPSATE---PPAASYRKNPHPCQKAIELP 47
          LS T LP ++E   PPAAS  KN     K + LP
Sbjct: 18 LSTTILPDSSEATTPPAASLFKNSEEMVKVVSLP 51

>Kwal_27.12010
          Length = 249

 Score = 28.9 bits (63), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 31/82 (37%), Gaps = 9/82 (10%)

Query: 58  PCRIKHPQKH---------RRTSRPPPDCPLCGLRLCEVRVCRAGRIVVGYIAKSPTTSQ 108
           P  ++HP  H         +   +P P   L  +R C  ++ R  R   G  A      Q
Sbjct: 48  PFTVRHPHTHAASLARPGFQSQVQPQPCSDLDMVRSCGEKIARLARERRGDQAFQELPRQ 107

Query: 109 VATATGATGALMEAPSYIRAVW 130
           V   + +  AL  AP +  A W
Sbjct: 108 VKQFSASLQALQAAPEFDTAAW 129

>KLLA0B04587g 411097..412299 similar to sp|P47160 Saccharomyces
           cerevisiae YJR125c ENT3 cytoskeletal adaptor, start by
           similarity
          Length = 400

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 4/65 (6%)

Query: 18  SETYLPSATEPPA-ASYRKNPHPCQKAIELPTKTPQRTRSVPCRIKHPQKHRRTSRPPPD 76
           S TY+PSAT  PA A   KN  P           P +    P   K PQ +  T+    D
Sbjct: 313 SHTYVPSATVTPAIAETSKNSDPFGSLFSSAKNEPFKAAPKP---KQPQLNANTNNASKD 369

Query: 77  CPLCG 81
             L G
Sbjct: 370 TDLFG 374

>Kwal_27.11320
          Length = 775

 Score = 27.3 bits (59), Expect = 4.4,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 13/26 (50%)

Query: 12 PLPTRLSETYLPSATEPPAASYRKNP 37
          PLPT    TY  +   PP A ++  P
Sbjct: 9  PLPTEAGNTYQRAPVPPPYAEFKSEP 34

>AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH]
           complement(313261..314856) [1596 bp, 531 aa]
          Length = 531

 Score = 27.3 bits (59), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 94  RIVVGYIAKSPTTSQVATATGATGAL-MEAPSYI 126
           +I++G   +S    Q+ TATGATG L   AP  +
Sbjct: 310 KILIGDFGESQLRGQLRTATGATGTLEFTAPELV 343

>Kwal_14.1263
          Length = 635

 Score = 27.3 bits (59), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 7   DLRFSPLPTRLSETYLPSATEPPAASYRKNPHPCQKAIELPTKTPQ 52
           D++FSP    LS    PSA+EP      KN       +E+P++TP+
Sbjct: 75  DMQFSPSGNFLSTWERPSASEPE----HKNVKIWYLNLEVPSETPK 116

>Scas_711.55
          Length = 628

 Score = 26.9 bits (58), Expect = 7.4,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 95  IVVGYIAKSPTTSQVATATGATGAL-MEAPSYI 126
           IV+G + +S    +  TATGATG L   AP  I
Sbjct: 357 IVIGDLGESQMEGESRTATGATGTLEFTAPEVI 389

>YJL210W (PEX2) [2718] chr10 (36919..37734) Peroxisomal biogenesis
           protein (peroxin) required for peroxisomal import of
           some proteins [816 bp, 271 aa]
          Length = 271

 Score = 26.6 bits (57), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 7/111 (6%)

Query: 18  SETYLPSATEPPAASYRKNPHPCQKAIELPTKTPQRTRSVPCRIKHPQKHRRTSRPPPDC 77
           SE Y  S +      Y+         +EL + T    R +   +K P + R T+     C
Sbjct: 165 SEFY--SNSVFAGLEYQNRQLLWNALLELFSNTLLTKRGLLTFVKKPPRSRSTTTYKTVC 222

Query: 78  PLCG---LRLCEVRVCRAGRIVVGYIAKSPTTSQVATATGATGALMEAPSY 125
           P CG       ++  CRA    V  + K+   S +  A G++G L  +P Y
Sbjct: 223 PRCGGFPTNPYQIACCRANYCYVC-VVKALEWS-MCDACGSSGRLTASPVY 271

>Sklu_2389.4 YJL057C, Contig c2389 7783-9576
          Length = 597

 Score = 26.6 bits (57), Expect = 9.9,   Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 95  IVVGYIAKSPTTSQVATATGATGAL 119
           +++G   +S  + Q+ +ATGATG L
Sbjct: 346 VIIGDFGESQVSGQLRSATGATGTL 370

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,328,555
Number of extensions: 165956
Number of successful extensions: 562
Number of sequences better than 10.0: 30
Number of HSP's gapped: 560
Number of HSP's successfully gapped: 32
Length of query: 139
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 48
Effective length of database: 13,445,871
Effective search space: 645401808
Effective search space used: 645401808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)