Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00759g73472236430.0
Kwal_26.710574072420530.0
YAL023C (PMT2)75969820440.0
CAGL0J08734g74272120230.0
Scas_505.275272320160.0
YOR321W (PMT3)75371319620.0
KLLA0F15829g74169819510.0
Scas_643.2476973618990.0
ACR290W75572618830.0
YGR199W (PMT6)75973814560.0
Kwal_33.1547175574314530.0
KLLA0F21978g75765314420.0
CAGL0K00979g73066512961e-169
CAGL0L07216g8586548761e-105
Kwal_23.36238766528231e-97
YDL095W (PMT1)8176558181e-97
ADR279C8176568069e-96
KLLA0E01342g8386548024e-95
Scas_408.1*3913767677e-95
CAGL0M00220g7656247136e-83
YDL093W (PMT5)7436496891e-79
ABL085W7576866523e-74
KLLA0B03762g7726886472e-73
Scas_710.19196546401e-71
YJR143C (PMT4)7626146295e-71
Kwal_47.167347926276298e-71
Scas_442.13092975887e-70
Scas_719.807626346041e-67
CAGL0L07172g7776354961e-52
Sklu_2215.66534403716e-37
Scas_30.11281042921e-30
Scas_329.12731923041e-30
AAL050W6573413005e-28
Kwal_33.143576572742748e-25
YDR307W6623092499e-22
Scas_588.77264352481e-21
KLLA0C14828g6294882283e-19
Scas_710.0d2711451093e-05
CAGL0J11044g736120810.13
CAGL0D04356g39129702.4
CAGL0D00572g103764693.7
CAGL0B03817g33269683.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00759g
         (722 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...  1407   0.0  
Kwal_26.7105                                                          795   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...   791   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...   783   0.0  
Scas_505.2                                                            781   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   760   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...   756   0.0  
Scas_643.24                                                           736   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...   729   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   565   0.0  
Kwal_33.15471                                                         564   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   560   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   503   e-169
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   342   e-105
Kwal_23.3623                                                          321   1e-97
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   319   1e-97
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   315   9e-96
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   313   4e-95
Scas_408.1*                                                           300   7e-95
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   279   6e-83
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   270   1e-79
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   255   3e-74
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   253   2e-73
Scas_710.1                                                            251   1e-71
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   246   5e-71
Kwal_47.16734                                                         246   8e-71
Scas_442.1                                                            231   7e-70
Scas_719.80                                                           237   1e-67
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   195   1e-52
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       147   6e-37
Scas_30.1                                                             117   1e-30
Scas_329.1                                                            121   1e-30
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   120   5e-28
Kwal_33.14357                                                         110   8e-25
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...   100   9e-22
Scas_588.7                                                            100   1e-21
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    92   3e-19
Scas_710.0d                                                            47   3e-05
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    36   0.13 
CAGL0D04356g 426132..427307 highly similar to sp|P48015 Saccharo...    32   2.4  
CAGL0D00572g complement(72970..76083) similar to sp|Q07468 Sacch...    31   3.7  
CAGL0B03817g 378159..379157 highly similar to sp|P47085 Saccharo...    31   3.9  

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score = 1407 bits (3643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/722 (93%), Positives = 677/722 (93%)

Query: 1   MDSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXX 60
           MDSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFT      
Sbjct: 1   MDSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTLLALLV 60

Query: 61  XXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120
                      TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS
Sbjct: 61  RLYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120

Query: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXX 180
           GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTT   
Sbjct: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGK 180

Query: 181 XXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240
                    FFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT
Sbjct: 181 LILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240

Query: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300
           LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG
Sbjct: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300

Query: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTC 360
           DHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTC
Sbjct: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTC 360

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL
Sbjct: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420

Query: 421 DYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL 480
           DYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL
Sbjct: 421 DYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL 480

Query: 481 PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMM 540
           PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMM
Sbjct: 481 PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMM 540

Query: 541 ATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXX 600
           ATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPST     
Sbjct: 541 ATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVLF 600

Query: 601 XXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLP 660
                      WNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLP
Sbjct: 601 LVFALLYKVLKWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLP 660

Query: 661 ALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLE 720
           ALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLE
Sbjct: 661 ALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLE 720

Query: 721 NY 722
           NY
Sbjct: 721 NY 722

>Kwal_26.7105
          Length = 740

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/724 (53%), Positives = 487/724 (67%), Gaps = 10/724 (1%)

Query: 2   DSELRARKAPSVSEV-KVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXX 60
           D  L+ RK  +V E+  +E D       D  E+K+      LRLE +AMP++FT      
Sbjct: 12  DGTLKQRKVTTVDEIPDIEVD-------DRIEEKSVEVNPLLRLESIAMPMIFTAVGFFT 64

Query: 61  XXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120
                       WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SG++AGYNGSWDFPS
Sbjct: 65  RMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS 124

Query: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXX 180
           G+ YPDY+ +VKMRIF    SALC+P+ YF AKAIGFSLPTVWL TILV+ ENSY T   
Sbjct: 125 GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGR 184

Query: 181 XXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240
                    FFTVA+  CF  FH+   KPFS +W  WL LTG S+GC ISVKMVGLF+IT
Sbjct: 185 FILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIIT 244

Query: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300
           LVGI+T++ELWTLLGDK ++ K YA HW+ARI+CLI+ PFLIF  CFK+HF LL  SG G
Sbjct: 245 LVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTG 304

Query: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGSTI-TLQNMKPRGAYLHSHHQTYPEGSKQRQVT 359
           D  MP  FQA L G+++G GPRD+++GS+I +++N    G+ LHSH Q YPEGS Q+QVT
Sbjct: 305 DANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVT 364

Query: 360 CYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK 419
           CY + D NN+W+  R      W   +TE E ++ G + RLVH  TG NLH+H + AP+ K
Sbjct: 365 CYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK 424

Query: 420 LDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479
            ++EVSGYG   +GD KDHWVVE++   G+ED++ +HP+T+  R ++A L CYLAQ+  H
Sbjct: 425 SEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAH 484

Query: 480 LPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKR 538
           LPEWGF Q+EV C++ P K D +T W V+THT+  L   P +F YP+ +F  +F  LN  
Sbjct: 485 LPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLA 544

Query: 539 MMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXX 598
           MMATNNAL    DK D L S +W+WPTL   +R+  W ++  +Y L+GSPASTW ST   
Sbjct: 545 MMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAV 604

Query: 599 XXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHY 658
                        W RQ Q   + HD  LF+ GG YPLLGW LH+ PFVIM RV YVHHY
Sbjct: 605 VGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHY 664

Query: 659 LPALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGK 718
           LPALYFAL +L+Y+F+AGL+  NKTK  ++ +  IY  Y ++VI GF  F+P S+G++G 
Sbjct: 665 LPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGP 724

Query: 719 LENY 722
             NY
Sbjct: 725 SSNY 728

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/698 (53%), Positives = 480/698 (68%), Gaps = 2/698 (0%)

Query: 27  ANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXXXXXXXXXXXXXTWDEAHFGKFGSYYL 86
           A D  ++K + +   LRLE V MP++FT                  WDEAHFGKFGSYYL
Sbjct: 45  AEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYL 104

Query: 87  RHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVP 146
           RH FYHDVHPPLGKMLVG SGYLAGYNGSWDFPSG+ YPDY+ +VKMR+F  + SALCVP
Sbjct: 105 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVP 164

Query: 147 MTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFFTVATFMCFQKFHSYH 206
           + YF AKAIGFSLPTVWL T+LVL ENSY+T            FFTVA+F  F  FH+  
Sbjct: 165 LAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQR 224

Query: 207 RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYAN 266
            KPFS +W  WL +TG S+GC ISVKMVGLF+IT+VGI+T+++LWT L DK+++WK Y N
Sbjct: 225 SKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYIN 284

Query: 267 HWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSI 326
           HW+ARI  LI+ PF IF LCFKIHF LL  SG GD  MP  FQA L G+++GQGPRD+++
Sbjct: 285 HWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIAL 344

Query: 327 GST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVND 385
           GS+ ++++N    G+ LHSH QTYP+GS Q+QVTCY Y D NN+W   R  G P W  N+
Sbjct: 345 GSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENE 404

Query: 386 TEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIK 445
           T+ E ++ G + RLVHK TG NLH+H V AP++K  +EVSGYG+  +GD KD+WV+EI+ 
Sbjct: 405 TDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMD 464

Query: 446 DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMW 505
             G+ED   +H +TT  R ++  + CYLAQ+   LPEWGF Q EV C++ P K D +T W
Sbjct: 465 QRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWW 524

Query: 506 IVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWP 564
            ++TH +  L   PE+F YP+ +F  DF  LN  MMATNNAL    DK DYL S +W+WP
Sbjct: 525 NIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWP 584

Query: 565 TLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHD 624
           TL   LR+  W +++ +Y LLG+PASTW S+                W RQ    +N  +
Sbjct: 585 TLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSN 644

Query: 625 EELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTK 684
             +F+ GG YPLL W LH+ PFVIM RV YVHHYLPALYFAL +LAY FDAGL+ ++++K
Sbjct: 645 WNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSK 704

Query: 685 TQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENY 722
             RI++F +YAG+M++VIG F  F+P S+GM G   N+
Sbjct: 705 CGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNF 742

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/721 (51%), Positives = 478/721 (66%), Gaps = 4/721 (0%)

Query: 2   DSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXXX 61
           D+EL+ARK  SV +V +E         D K  ++      L+LE   MP+VFT       
Sbjct: 13  DAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSP----LLQLEAYLMPLVFTGLALFVR 68

Query: 62  XXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSG 121
                      WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGS+DF SG
Sbjct: 69  MYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESG 128

Query: 122 QPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXX 181
             YP+YV FVKMR+F  + SA+CVP+ YF AKAIGFSLP VWL T +VL ENSY+T    
Sbjct: 129 HEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRF 188

Query: 182 XXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITL 241
                   FFTVA+   F  FH+   +PFS +W  WL LTG ++GC ISVKMVGLFVITL
Sbjct: 189 ILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITL 248

Query: 242 VGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGD 301
           VGI+T+++L  +L +K ++WK Y  HW+ARI+ LI  P  +F +CFK+HF LLW SG GD
Sbjct: 249 VGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGD 308

Query: 302 HEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCY 361
             MP  FQA L G+++G GPRDV+IGS+++++N    GA LHSH QTYPEGS Q+QVT Y
Sbjct: 309 ANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAY 368

Query: 362 NYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLD 421
           +Y D NN+W+ +R   + +W +N+T+ E + +G   RLVH  T  NLH+H + AP++K +
Sbjct: 369 SYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKN 428

Query: 422 YEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLP 481
           +EVSGYGN TIGD KD+WV+EI+   G+E+   +HP+TT  R R+  L+CYLAQ+  HLP
Sbjct: 429 WEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLP 488

Query: 482 EWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMA 541
           EWGF Q E+ C+++P + D +T W V++H +  L  PE F YP   F  DF  LN  MMA
Sbjct: 489 EWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMA 548

Query: 542 TNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXX 601
           TNNAL    DK DYL S +WEWPTL+  LR+  W +N+ +Y LLG+P +TW S+      
Sbjct: 549 TNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISF 608

Query: 602 XXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPA 661
                     W RQ   F N+ D  LF+ GG YP+LGW LHF PFVIM RV YVHHYLPA
Sbjct: 609 MILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPA 668

Query: 662 LYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLEN 721
           LYFAL +L YI DA  + + K+K   I++  ++A  ++ V+G F  F+P S+GMTG   N
Sbjct: 669 LYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAIN 728

Query: 722 Y 722
           Y
Sbjct: 729 Y 729

>Scas_505.2
          Length = 752

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/723 (52%), Positives = 483/723 (66%), Gaps = 6/723 (0%)

Query: 4   ELRARKAPSVSEVKVEHDHGHDLAND--NKEQKASNKQFWLRLERVAMPIVFTXXXXXXX 61
           E++AR+  ++   +   D   DL  +  + E+K SN    LR+E + MP+VFT       
Sbjct: 16  EVKARQDINIDTHEEIIDEKEDLKKEIVSTEKKESNTL--LRVESIIMPLVFTGLAIFIR 73

Query: 62  XXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSG 121
                      WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGS+DF SG
Sbjct: 74  MYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSG 133

Query: 122 QPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXX 181
             YPDYV +VKMRIF  A SA+CVP+ YF AKAIGFS+PTVWL TI VL ENSYTT    
Sbjct: 134 AEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKF 193

Query: 182 XXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITL 241
                   FFTV ++MCF  FH+   KPFS +W  W+ LTG SMGCAISVKMVGLF+IT+
Sbjct: 194 ILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITV 253

Query: 242 VGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGD 301
           VGI+TI++LW  LGDK ++WK Y  HW+ARIICLI+ PFL+F  CFKIHF LL  SG GD
Sbjct: 254 VGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGD 313

Query: 302 HEMPPRFQAALNGTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTC 360
             M   FQA L G+++G GPRDV++GS+ I+++N    GA LHSH+  YPEGS Q+QVT 
Sbjct: 314 ANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTA 373

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y+Y D NN+W   RP G+P +H N+T+ E +      RLVH  TG NLH+H V AP++  
Sbjct: 374 YSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISST 433

Query: 421 DYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL 480
            +EVSGYG+   GD +D+W++EI+   G+EDK  +HP+TT  R  +  ++CYL+Q+  HL
Sbjct: 434 QWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHL 493

Query: 481 PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRM 539
           PEWGF Q EV C++ P + D +T W ++T+ +  L   P +F +P+ +F+ DF +LN  M
Sbjct: 494 PEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAM 553

Query: 540 MATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXX 599
           MATNNAL    +K D L S +W+WPTLY  LRI SW E+  +Y LLG+PASTW S+    
Sbjct: 554 MATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVV 613

Query: 600 XXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYL 659
                       W RQ    Q+  D   F+ G  YPLL W LH+ PFVIM RV YVHHYL
Sbjct: 614 GLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYL 673

Query: 660 PALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKL 719
           PALYFAL +LAY+FDAGL++  KTK+ +I++  IY      VIG F  F+P S+GM G +
Sbjct: 674 PALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPM 733

Query: 720 ENY 722
           ENY
Sbjct: 734 ENY 736

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/713 (50%), Positives = 474/713 (66%), Gaps = 8/713 (1%)

Query: 16  VKVEHDHGHDLANDNKE--QKASNKQFWLRLERVAMPIVFTXXXXXXXXXXXXXXXXXTW 73
           VK E +   +   D+ E   K  N+     L+ + MPI+FT                  W
Sbjct: 25  VKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVW 84

Query: 74  DEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKM 133
           DEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGSWDFPSG+ YPDY+ +VKM
Sbjct: 85  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKM 144

Query: 134 RIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFFTV 193
           R+FQ   S+LCVP+ YF  +AIGFS  +VWL TILV+ ENSY T            FFTV
Sbjct: 145 RLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTV 204

Query: 194 ATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTL 253
           +++ C  KFH+  + PFS +W LWL LTG ++GCAISVKMVGLF+I++VGI+TI ELW L
Sbjct: 205 SSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNL 264

Query: 254 LGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALN 313
           L D++++WK Y NHW+ARI  LI+ P  +F LCFKIHF LL  SGPGD  MP  FQA+LN
Sbjct: 265 LSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLN 324

Query: 314 GTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIV 372
           GT +G+GPRDV++GS+ I+++N    GA LHSH Q +PEGS+Q+QVT Y Y D NN+W  
Sbjct: 325 GTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFF 384

Query: 373 YRPHGKPIWHVNDTEH---EAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGN 429
            R  G   W   D E+   E ++ G+  RL+H+ TG NLH+H+V AP++K +YEVS YG+
Sbjct: 385 QRIRGVEPW--TDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGD 442

Query: 430 LTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAE 489
           + +GD KD+W++EI++  G ED  L+HP++T  R ++++L CYLAQS +HLPEWGF Q E
Sbjct: 443 VDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGE 502

Query: 490 VRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVS 549
           V C++   K D +T W ++TH +  L   E+F+YP+ SF+ +F +LN  MMATNNAL  +
Sbjct: 503 VVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPN 562

Query: 550 KDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXXXXXXXXX 609
            +K D + S +W+WPTL   +R+  W+E   +Y LLGSPAS WPS+              
Sbjct: 563 PEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLT 622

Query: 610 XXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVL 669
             W RQ  I  +  + ++F+    YPLL W LH+ PFV+M RV Y HHYLP LYFAL +L
Sbjct: 623 LKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMIL 682

Query: 670 AYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENY 722
           +Y FD   + +    T + ++   Y  Y S+VI GF  F+PFS+GM G +++Y
Sbjct: 683 SYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDY 735

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/698 (52%), Positives = 463/698 (66%), Gaps = 2/698 (0%)

Query: 27  ANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXXXXXXXXXXXXXTWDEAHFGKFGSYYL 86
           A D  +QK  N+   L+LE + MPI+FT                  WDEAHFGKFGSYYL
Sbjct: 31  AEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYL 90

Query: 87  RHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVP 146
           RH FYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSG+ YP+Y+ FVKMR+F    SALCVP
Sbjct: 91  RHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVP 150

Query: 147 MTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFFTVATFMCFQKFHSYH 206
           + YF AK+IGFSLPTVWL T LVL ENSYTT            FFTV +  CF KFH+  
Sbjct: 151 VAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVR 210

Query: 207 RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYAN 266
            KPF+ +W  WLF TG S+GC ISVKMVGL +IT+VGI+T+V+LW +L D  ++ K YA 
Sbjct: 211 SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAA 270

Query: 267 HWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSI 326
           HW +R + LI+ PF +F  CFKIHF LL  SG GD  MP  FQA L G+++G+GPRDV++
Sbjct: 271 HWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVAL 330

Query: 327 GST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVND 385
           GS+ IT++N    G  LHSH QTYPEGS+Q+QVT Y + D NN W   R      +  N+
Sbjct: 331 GSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNE 390

Query: 386 TEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIK 445
           TE E + +G   RLVH  TG NLH+H   AP+    +EVSGYG+  +GD KD W++EI+ 
Sbjct: 391 TETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVD 450

Query: 446 DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMW 505
             G ED+  +HP+T+  R ++A + CYL+Q+   LP+WGF Q EV C++ P K D +T W
Sbjct: 451 QKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWW 510

Query: 506 IVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWP 564
            ++T+ +  L   PENF YP+ SF  DF  LN  MMATNNAL  + +K D L S +W+WP
Sbjct: 511 NIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWP 570

Query: 565 TLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHD 624
           TL   +R+  W E + +Y L+GSPASTWPST                W RQ     N  D
Sbjct: 571 TLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPED 630

Query: 625 EELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTK 684
             LF+ GG+YPLL W LHF PF+IM RV YVHHYLPALYFAL VLAY+F+  ++ +NK+K
Sbjct: 631 INLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLFEISMKKWNKSK 690

Query: 685 TQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENY 722
             +++++ IY  YM++VI GF  FAP S+GM+G   +Y
Sbjct: 691 CGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728

>Scas_643.24
          Length = 769

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/736 (50%), Positives = 477/736 (64%), Gaps = 16/736 (2%)

Query: 2   DSELRARKAPSVSEVKVEHDHGHDLANDN--KEQKASNKQFWLRLERVAMPIVFTXXXXX 59
           D ++R   + + +    +     D  ++N  K+Q  S +    ++E   MPIVFT     
Sbjct: 19  DLKVRQHNSSAATSKAAKDSASIDEKDENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFF 78

Query: 60  XXXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFP 119
                        WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGSWDFP
Sbjct: 79  TRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFP 138

Query: 120 SGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXX 179
           SG+ YPDY+ +VKMR+FQ   S+LCVPM Y  AKAIGFS+P VWL T LVL ENSY T  
Sbjct: 139 SGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLFENSYATLG 198

Query: 180 XXXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVI 239
                     FFTVA+FM F  FH+  + PFS +W   L L G ++GCAISVKMVGLF+I
Sbjct: 199 RFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVKMVGLFII 258

Query: 240 TLVGIHTIVELWTLL-------GDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFA 292
           TLVGI+T+ +LWTLL         K   WK Y  HWIARI+CLI+ PFL+F  CF+IHFA
Sbjct: 259 TLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFA 318

Query: 293 LLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPE 351
           LL  SG GD  MP  FQA L+G+++G+GPRDV++GS+ ++++N    GA LHSH QT+P+
Sbjct: 319 LLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQ 378

Query: 352 GSKQRQVTCYNYVDGNNDWIVYR---PHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNL 408
           GS Q+QVT Y Y D NN W   R   P  +P  +  +T+ E +R G+  RLVH+ T  NL
Sbjct: 379 GSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNL 438

Query: 409 HSHQVEAPLNKLDYEVSGYG-NLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHA 467
           H+ ++ AP++K D+EV+G+G    +GD  D+W++E+I+  G+EDK++IHP+TT    +HA
Sbjct: 439 HADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHA 498

Query: 468 VLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPE-NFIYPRR 526
           VL CYL Q+ + LPEWGF Q+E+ C  +  KND +T W V++H +  L  P+ +F YP+ 
Sbjct: 499 VLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKT 558

Query: 527 SFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLG 586
           +F+ DF  LN+ MMATNNAL    DK+D L S +W+WPTL   LR+  WN++  +Y LLG
Sbjct: 559 NFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLG 618

Query: 587 SPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPF 646
           SPASTWPST                W RQ+  F N+     F+ G  YPLL W LHF PF
Sbjct: 619 SPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPF 678

Query: 647 VIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFI 706
           VIM RV YVHHYLPALYFAL VLAY F+A +R   K    + I +     Y +VVIGGF 
Sbjct: 679 VIMARVTYVHHYLPALYFALLVLAYFFEAIIR-RPKGTLAKYITYITLVLYFAVVIGGFF 737

Query: 707 LFAPFSYGMTGKLENY 722
            F+P S+GM G  +NY
Sbjct: 738 YFSPISFGMDGPSKNY 753

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/726 (48%), Positives = 469/726 (64%), Gaps = 11/726 (1%)

Query: 6   RARKAPSVSEVKVEHDHG-----HDLANDNKEQKASNKQFWLRLERVAMPIVFTXXXXXX 60
           R    P+    K   + G      D++   + Q+  N  +  +LE   MP++FT      
Sbjct: 20  RHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLY--KLEAFVMPVLFTLLALYT 77

Query: 61  XXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120
                       WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGY+AGYNGSWDFPS
Sbjct: 78  RMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS 137

Query: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXX 180
           G+ YP+Y+ +VKMR+F    SA+C P+ YF  KAIGFSLPTVWL +ILV+ ENSY T   
Sbjct: 138 GEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGR 197

Query: 181 XXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240
                    FFTV +F  F  FH+   +PF  +W  WLF  G S+GC ISVKMVGLF+I+
Sbjct: 198 FILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIIS 257

Query: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300
           +VGI+T+V+LW  L + N++  R+A H+ AR +CLIV PF++F  CFK+HF  L  SG G
Sbjct: 258 VVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTG 317

Query: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVT 359
           D  MP  FQA L+G+++G GPRD+++GS+ ++++N    G  LHSH QTYP GS Q+QVT
Sbjct: 318 DAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVT 377

Query: 360 CYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK 419
            Y + D NN+W+  R  G P W +N+TEHE +++G   RLVH  TG NLH+H + AP++K
Sbjct: 378 TYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSK 437

Query: 420 LDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479
             +EVSGYG+  +GD KD+W++E +    +EDK+++H I+T  R ++  + CYLAQ+   
Sbjct: 438 THWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPS 497

Query: 480 LPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNL-EAPENFIYPRRSFWSDFFELNKR 538
           LPEWGF Q EV CI  P K D +T W ++T+ +  L   PE+F YP+ SF+ DF  LN  
Sbjct: 498 LPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLA 557

Query: 539 MMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXX 598
           MMATNNAL    DK D L S +W+WPTL   +R+ SW ++  +Y L+GSPASTWPST   
Sbjct: 558 MMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAV 617

Query: 599 XXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHY 658
                        W RQ+ +FQ   D  +F+ GG+YPLLGW LH+ PF +MGRV YVHHY
Sbjct: 618 GVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHY 677

Query: 659 LPALYFALFVLAYIFDAGLRYYNKTKTQ--RIIKFCIYAGYMSVVIGGFILFAPFSYGMT 716
           LPALYFAL +LAY+F+A LR   +++    +I+ + +YA Y   +I GF  F P + GM 
Sbjct: 678 LPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGME 737

Query: 717 GKLENY 722
           G   NY
Sbjct: 738 GPSSNY 743

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/738 (40%), Positives = 416/738 (56%), Gaps = 24/738 (3%)

Query: 2   DSELRAR----KAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRLER-VAMPIVFTXX 56
           D  LR R       + S+++ E     +   +    K + +   L++ R V  P++ T  
Sbjct: 16  DENLRERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILRDVIGPLLLTIT 75

Query: 57  XXXXXXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSW 116
                           WDEAHFGKFGSYY++H +YHDVHPPLGKML+  S ++AG++G +
Sbjct: 76  SFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALSEWMAGFDGQF 135

Query: 117 DFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYT 176
           DF S   YP+ V F  MR F     ALC P+ +F AK +GF+  TV+L   +V  E+SY 
Sbjct: 136 DFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIATMVTLEHSYI 195

Query: 177 TXXXXXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGL 236
                        FF++ TF C  K ++  ++  + +W LW+ LTG S+GC  SVK VGL
Sbjct: 196 VLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGCVCSVKWVGL 255

Query: 237 FVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWG 296
           F+  +VG++T +EL+ L  DK +   +Y  HW+ RII LIV PFLI+  CFKIHF LL+ 
Sbjct: 256 FITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLYCFKIHFVLLYK 315

Query: 297 SGPGDHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQR 356
           SG GD      FQ  L GT I  GPRDV+ GS +T+++       LHSH Q YPEGS QR
Sbjct: 316 SGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSELTIRSHGLSPNLLHSHIQVYPEGSGQR 375

Query: 357 QVTCYNYVDGNNDWI--VYRPHGKPIWHVNDTEHEA---IRNGDTIRLVHKGTGSNLHSH 411
           Q+T Y + D NN W     R  G  +   N T +     I +G  +RL HK TGSNLHSH
Sbjct: 376 QITGYGFADSNNVWKFEFSRSSGLEL-DQNGTLNGKIIPITDGVEVRLSHKNTGSNLHSH 434

Query: 412 QVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKDD-------GNEDKNLIHPITTHVRF 464
            V + +++ +YEVSGYG+ ++GD KD W+VEI+K          NE+  ++HP++T  R 
Sbjct: 435 DVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTILHPVSTFFRL 494

Query: 465 RHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYP 524
           RH VL CYLA +    P WGF QAE+ C     + D  T W V+ H + NLE  E+++ P
Sbjct: 495 RHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNLETAEDYVPP 554

Query: 525 RRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLL 584
           + +FW+DF   N  M ++NNAL   +DK+D L S++WEWPTL++ LR+ SW    TRY L
Sbjct: 555 KSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRMCSWAGYITRYYL 614

Query: 585 LGSPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFF 644
           +GSP +TW ST                W RQ     ++   ++ I  G++P + W  H+ 
Sbjct: 615 MGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQIWQITI-QGIFPFISWMTHYL 673

Query: 645 PFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGG 704
           PF +MGRV YVHHY+PALYFA+ V  ++ D  L     T+   ++K+ IY       I  
Sbjct: 674 PFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTL-----TRVHWMVKYPIYLSLFGGCIYI 728

Query: 705 FILFAPFSYGMTGKLENY 722
           + LFAP   GM G    Y
Sbjct: 729 YNLFAPICQGMHGDKAEY 746

>Kwal_33.15471
          Length = 755

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/743 (40%), Positives = 416/743 (55%), Gaps = 32/743 (4%)

Query: 2   DSELRAR-KAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLR-------LERVAMPIVF 53
            SEL  R +  + +E ++       L +D  E+ + NK  +         L +V   I+ 
Sbjct: 10  SSELNLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNVLLQVTGVILL 69

Query: 54  TXXXXXXXXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYN 113
           T                  WDEAHFGKFGSYY+++ FYHDVHPPLGKML+  S YLAG+N
Sbjct: 70  TILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGKMLIALSQYLAGFN 129

Query: 114 GSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCEN 173
           G + F SG PYP  + +  MR F     ALC P+    AK +GFS    +   ++V  E 
Sbjct: 130 GDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNLGSYFLGMMVALEL 189

Query: 174 SYTTXXXXXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKM 233
           S+              FFT  TF C  + H    +PF+ +W LW+ L G S+GC  SVK 
Sbjct: 190 SFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLLLGLSVGCVCSVKW 249

Query: 234 VGLFVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFAL 293
           VGLF+  + GI+T+V+L++   DK ++   Y  HW+ RII LIV PFL++  CFKIHFA+
Sbjct: 250 VGLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVIPFLVYLFCFKIHFAI 309

Query: 294 LWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGS 353
           L  SG GD      FQ  L+G  I  GPR+V+ GS +T+++       LHSH Q YP GS
Sbjct: 310 LHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSEVTIRSHGLSPNLLHSHVQLYPFGS 369

Query: 354 KQRQVTCYNYVDGNNDWIVYRPHGKPIWH----VNDTEHEAIRNGDTIRLVHKGTGSNLH 409
            Q QVT Y + D NN+W++  P    +      + D + + +  G  IRLVHK TG+NLH
Sbjct: 370 GQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDLLTEGSEIRLVHKNTGANLH 429

Query: 410 SHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIK--DDGN-----EDKNLIHPITTHV 462
           SH++ A ++K  +EVSGYG+  IGD+KD WVVEI++  D  N     ED +L+HPI+T  
Sbjct: 430 SHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNSSFPKEDPSLLHPISTSF 489

Query: 463 RFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFI 522
           R RH  L CYLA +    P WGF QAE+ C     K D  T W ++ H +PNLE  E ++
Sbjct: 490 RLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWWNIEDHWNPNLEKSEGYV 549

Query: 523 YPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRY 582
            P+  FW DF  +N  M ++NNAL   +DK+D L SE+W+WPTL+  LR+ SW+ +  +Y
Sbjct: 550 PPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWPTLHVGLRMCSWSNDTVKY 609

Query: 583 LLLGSPASTWPSTXXXXXXXXXXXXXXXXWNRQ-MQIFQNEHDEELFIYGGVYPLLGWFL 641
            LLGSP  TW ST                W RQ + +  NE  E      GV P L W L
Sbjct: 610 FLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTGNELSE--ISMQGVLPFLAWLL 667

Query: 642 HFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGL--RYYNKTKTQRIIKFCIYAGYMS 699
           H+ PFV+MGRV YVHHY+PALYFA+ V  ++ +  L  RY+       I+   +YAG + 
Sbjct: 668 HYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCLPKRYF----LNYIVYTALYAGCIY 723

Query: 700 VVIGGFILFAPFSYGMTGKLENY 722
           +    ++LF+P + G+ G   N+
Sbjct: 724 I----YVLFSPIAQGIDGPAHNF 742

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/653 (43%), Positives = 386/653 (59%), Gaps = 15/653 (2%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFV 131
            WDEAHFGKFGSYYL+H FYHDVHPPLGKML+G   YLAG++G++DF S   YPD V F 
Sbjct: 87  VWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLAGFDGNFDFSSNSSYPDEVNFK 146

Query: 132 KMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFF 191
            MR F    S+LC P+ ++AA+ + FS+PTV+L  ++V  E+SY              FF
Sbjct: 147 IMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVCFEHSYIVLGKFVLLDSMLLFF 206

Query: 192 TVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELW 251
           TV TF C  + +       + +W  W+  TG S+GC  SVK VGL +  LVGI+T+ EL+
Sbjct: 207 TVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGCVCSVKWVGLLITALVGIYTVSELY 266

Query: 252 TLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAA 311
            L  D++++  +Y  HWI RI  LIV P +++ + FKIHF LL+ +G GD      FQA 
Sbjct: 267 CLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVFFKIHFTLLYKTGTGDSSTHSLFQAN 326

Query: 312 LNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWI 371
           L G  I   PRD++ GS I+L++       LHSH QTYP+GS QRQVT Y+Y DGNN+WI
Sbjct: 327 LEGAQIKPSPRDIAFGSCISLRSHGLSPGLLHSHPQTYPDGSNQRQVTGYSYRDGNNNWI 386

Query: 372 V--YRPHGKPIWH--VNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGY 427
           V   R  GK      V       +++GD +RLVH+ T +NLH+HQ+ + ++K  YEVSGY
Sbjct: 387 VKYSRSSGKASAEERVYSDNILFLKDGDLLRLVHEKTKNNLHTHQIPSHVSKGHYEVSGY 446

Query: 428 GNLTIGDLKDHWVVEIIKD--DGN---EDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPE 482
           GN  +GDLKD W++E+++    GN   E+K LIHP+TT  R R+  L CYLA +    P 
Sbjct: 447 GNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIHPLTTSFRLRNKELGCYLAATGLSYPG 506

Query: 483 WGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMAT 542
           WG++QAE+ C     + D  T W V+ H + NL   + F  P   FW+DF  +N  M A+
Sbjct: 507 WGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLHIDQTFTPPPTKFWTDFVVINFAMAAS 566

Query: 543 NNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXX 602
           NNAL    DK+D + SE WEWP LY+ LR+ +WN+   +Y LLGSP +TW ST       
Sbjct: 567 NNALIPDLDKYDRIASEPWEWPILYKGLRMCNWNDKTVKYYLLGSPFNTWLSTAALPILL 626

Query: 603 XXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPAL 662
                    + RQ      +    LF   G+   +GW LH+ PF IMGRV Y+HHY+PAL
Sbjct: 627 ILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SFIGWLLHYAPFFIMGRVTYIHHYVPAL 685

Query: 663 YFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGM 715
           +FA+   AY+ D  L       + R +K   Y+   +     +  FAPF  GM
Sbjct: 686 FFAIMTFAYVVDFAL-----ANSNRYLKVVAYSSLYAGCTFTYWYFAPFCQGM 733

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  503 bits (1296), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/665 (43%), Positives = 379/665 (56%), Gaps = 23/665 (3%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFV 131
            WDEAHFGKFGSYY+RH FYHDVHPPLGKML+  S +LAG++G +DF SG  YPD V F 
Sbjct: 62  VWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYPDGVNFK 121

Query: 132 KMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFF 191
            MR F     ALC P+ +F AK +  S P V+L T++V  E+S+              FF
Sbjct: 122 FMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLDSMLLFF 181

Query: 192 TVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELW 251
           T  TF C  K         + QW  WL LTG S+GC  SVK VGLF+  +VG+ TI++L 
Sbjct: 182 TATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLFTIIDLL 241

Query: 252 TLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAA 311
               +K  + K Y  HWI RII LI+ PFL++  CFKIHF LL+ SG GD      FQ  
Sbjct: 242 EHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTNSLFQVN 301

Query: 312 LNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWI 371
           L GT I   PR V  GS +T+++       LHSH Q YP+GS+QRQVT Y + DGNN+W+
Sbjct: 302 LEGTQIQNSPRTVMYGSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNWM 361

Query: 372 VY--RPHGKPIWHVN---DTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSG 426
           +   R  G+ +   N   + E   +R+GDTIRL H   G NLHSH + + ++K +YEVSG
Sbjct: 362 IKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVSG 421

Query: 427 YGNLTIGDLKDHWVVEIIK-------DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479
           YG+  +GD KD W++EI++       + G ED  ++HPI+T  R RH  L CYLA +   
Sbjct: 422 YGSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGLS 481

Query: 480 LPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRM 539
            P WGF QAE+ C     K D  T W V+ H +  L   E ++ P+  FW+DF  +N  M
Sbjct: 482 YPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQLVVDEEYVPPKSKFWTDFILINFAM 541

Query: 540 MATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXX 599
            ++NNAL   +DK+DYL S++WEWP L++ LR+  W+    RY LLGSP +TW S+    
Sbjct: 542 ASSNNALVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALL 601

Query: 600 XXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYL 659
                       W RQ  I  NE          ++P L W  +F P+V+MGRV YVHHY+
Sbjct: 602 VNILLGMVVAIKWRRQ-SIVINEESCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYM 660

Query: 660 PALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFI--LFAPFSYGMTG 717
           PALYFA+     I +  L  Y   K         +  ++S+V   +I   FAP   G+ G
Sbjct: 661 PALYFAIIAFGSITEYLLADYCTVKA--------FLAFLSMVGCTYIYWYFAPICQGLHG 712

Query: 718 KLENY 722
              +Y
Sbjct: 713 IGSHY 717

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  342 bits (876), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 216/654 (33%), Positives = 321/654 (49%), Gaps = 30/654 (4%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDF-PSGQPYPDYVPF 130
            +DE HFG F S Y++  F+ DVHPPL KML    G LAGY G + F P G+ YPD VPF
Sbjct: 86  VFDEVHFGGFASKYIKGDFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPDTVPF 145

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
             MR+F  ++    V M Y   +A G  L   +L  ++   ENS+ T             
Sbjct: 146 YTMRLFSASLGVFTVLMLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDAPLIC 205

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A    ++K   Y     SF+    L  TG ++G A S K VGLF +  VG+  + +L
Sbjct: 206 FIAAAVYSYKKSELYPTN--SFRALKSLLATGIALGLASSSKWVGLFTVAWVGLLCVWKL 263

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W ++GD N +        I +++ L+  P L++   F +HF  L   G G    P  F+A
Sbjct: 264 WFMIGDLNKSPCTIVKAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEFRA 323

Query: 311 ALNGTNI-GQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L G  I      DV +GS +TL+++   G YLHSH   YP GS+Q+Q+T Y ++D NN 
Sbjct: 324 TLEGNQIPSDVVYDVGVGSIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNK 383

Query: 370 WIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL---DYEVSG 426
           W++ R H   +   +  +   ++NG++I L+H  TG  LHSH  + P+++      EVSG
Sbjct: 384 WVIERSH---LPGASLKDFIGLKNGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSG 440

Query: 427 YGNLTI-GDLKDHWVVEIIKDDGNED--KNLIHPITTHVRFRHAVLNCYLAQSNEHLPEW 483
           YG L   GD+ DHW +EI +        ++ +  I T  + RHA   CYL      LP+W
Sbjct: 441 YGYLGFTGDINDHWTIEIDQSSSKPGIAQHEVRAIDTKFKLRHAT-GCYLFSHEVKLPKW 499

Query: 484 GFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPEN---FIYPRRSFWSDFFELNKRMM 540
           GF Q EV C  + +   +  +W ++   +P L  PEN     Y   +F   F E +K+M 
Sbjct: 500 GFDQQEVTCATQGKPELL--LWYIEGSENPQL--PENTPRISYKPMNFIEKFIENHKKMW 555

Query: 541 ATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXX 600
             N  LT +     Y  S ++EWP + R   I  W E+  +  LLG+  + W  +     
Sbjct: 556 KINKGLTGTH----YYESLAYEWPLMRRG--IGYWGEHHRKIYLLGNAVTWWAVSAFILV 609

Query: 601 XXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLP 660
                      +     I Q+++     +    Y LLG+ +H+ PF +MGR  ++HHYLP
Sbjct: 610 YAAILAFEAGSFLVGKPILQDKNVINFHVQVLHY-LLGFAIHYVPFFLMGRQLFLHHYLP 668

Query: 661 ALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYG 714
           A YF +  LA+ FD  + +  K + Q      I   + +  I  F   +P +YG
Sbjct: 669 AYYFGILALAHAFDIIITFVCKNRKQAAYALLIL--FTAASIYFFHAHSPIAYG 720

>Kwal_23.3623
          Length = 876

 Score =  321 bits (823), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 205/652 (31%), Positives = 319/652 (48%), Gaps = 25/652 (3%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DE HFG F + Y++  F+ DVHPPL KML    G +AG+ G +DF   GQ +P+  P+
Sbjct: 120 VFDEVHFGGFAAKYIKGIFFMDVHPPLAKMLFAAIGSIAGFTGDFDFEKIGQHFPESTPY 179

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
             MR+F   +  L V + Y   +  G  +P  ++ ++    ENS+ T            F
Sbjct: 180 YFMRLFPALLGTLTVLLMYLTLRCSGVRIPIAFIASLCFAIENSFVTISRYILLDAPLLF 239

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  +    F+K+  Y +   S+     L   G ++G A+S K VGLF I  VG+  I  L
Sbjct: 240 FIASAVYSFKKYEIYPQG--SWGSLKALLSGGLALGMALSSKWVGLFTIAWVGVLCIWRL 297

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W ++GD +            +++  +  P  ++A+ F +HF  L  +  G       F+ 
Sbjct: 298 WFMVGDLSKPLSSTLKEASRKLMFFLALPLALYAVFFYVHFETLTINSDGAGFFSSAFRT 357

Query: 311 ALNGTNIGQGP-RDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L+G  I +    DV IGSTI+++++   G YLHSH+  Y +GS+Q+QVT Y ++DGNND
Sbjct: 358 TLHGNTIPKDILADVGIGSTISMRHVATMGGYLHSHNHMYEKGSQQQQVTLYPHLDGNND 417

Query: 370 WIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL---DYEVSG 426
           W++  P  +P   V  T  E +++G  IRL H  T   LHSH  +AP+++      EVS 
Sbjct: 418 WVIELPD-QPNKAV--TSFEGLKDGTVIRLKHAITQRRLHSHDHKAPVSESADWQKEVSC 474

Query: 427 YGNLTI-GDLKDHWVVEIIKD--DGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEW 483
           YG     GD  D W +EI +D  +  E +  +  + T  R +H ++NC+L      LP+W
Sbjct: 475 YGFEDFEGDGNDDWTIEIDQDASEPGEAQKRVKALDTKFRLKHNIMNCHLFSHEVKLPKW 534

Query: 484 GFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRMMAT 542
           GF Q EV C  + +     T+W ++ ++HP L    E   Y + +F+    E ++RM   
Sbjct: 535 GFEQQEVTCASQGKP--YLTLWYIEGNSHPLLTGDQERVSYKKPNFFEKLIESHQRMWHI 592

Query: 543 NNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXX 602
           N  L    + H Y  S+   WP L R   IN W EN  +  LLG+    W  T       
Sbjct: 593 NKNLV---EPHIY-ESKPHSWPFLLRG--INYWGENHKQVYLLGNAIVWWSVTAFIALFA 646

Query: 603 XXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPAL 662
                    W     I Q+       +   ++ LLG+ LH+ P  +MGR  ++HHYLPA 
Sbjct: 647 TIVVFELFAWQLGKPILQDSKVVNFHVQ-VIHYLLGYGLHYIPSFLMGRQLFLHHYLPAY 705

Query: 663 YFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYG 714
           YF +   A+  D  + Y  + +   +I + +   + S V+  F+ +    YG
Sbjct: 706 YFGILAFAHALDITVTYVFRKR--EVIGYAVIGVFFSAVVYFFVSYRALIYG 755

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  319 bits (818), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 217/655 (33%), Positives = 315/655 (48%), Gaps = 31/655 (4%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DE HFG F S Y+R T++ DVHPPL KML      L G+ G +DF + G  +P   P+
Sbjct: 75  VFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFDFENIGDSFPSTTPY 134

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
           V MR F  ++ AL V + Y   +  G  +    ++ I    ENSY T            F
Sbjct: 135 VLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYVTISRYILLDAPLMF 194

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A    F+K+  Y     S      L  TG ++G A S K VGLF +T VG+  I  L
Sbjct: 195 FIAAAVYSFKKYEMYPAN--SLNAYKSLLATGIALGMASSSKWVGLFTVTWVGLLCIWRL 252

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W ++GD   + K       A++  L+  PF ++ + F IHF  L   G G     P F++
Sbjct: 253 WFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASFFSPEFRS 312

Query: 311 ALNGTNIGQGP-RDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L    I Q    DV IGS I+L+++   G YLHSH   YP GS+Q+Q T Y ++D NND
Sbjct: 313 TLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANND 372

Query: 370 WI--VYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLD---YEV 424
           W+  +Y   G+ +     T  + + +G  +RL H  T   LHSH  + P+++      EV
Sbjct: 373 WLLELYNAPGESL-----TTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEV 427

Query: 425 SGYGNLTI-GDLKDHWVVEIIKDD---GNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL 480
           S YG     GD  D WVVEI K +   G   + +I  + T  R RHA+  CYL      L
Sbjct: 428 SCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVI-ALDTKFRLRHAMTGCYLFSHEVKL 486

Query: 481 PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNL-EAPENFIYPRRSFWSDFFELNKRM 539
           P WGF Q EV C     ++D+ T+W V+ +++P L E  +   Y   SF S F E +K+M
Sbjct: 487 PAWGFEQQEVTCASS-GRHDL-TLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKM 544

Query: 540 MATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXX 599
              N  L    + H Y  S+   WP L R   I+ W EN+    LLG+    W  T    
Sbjct: 545 WHINKNLV---EPHVY-ESQPTSWPFLLRG--ISYWGENNRNVYLLGNAIVWWAVTAFIG 598

Query: 600 XXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYL 659
                       W     I ++       +   ++ LLG+ +H+ P  +M R  ++HHYL
Sbjct: 599 IFGLIVITELFSWQLGKPILKDSKVVNFHV-QVIHYLLGFAVHYAPSFLMQRQMFLHHYL 657

Query: 660 PALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYG 714
           PA YF +  L +  D  + Y  ++K Q  + + +   +++  +  F  F+P  YG
Sbjct: 658 PAYYFGILALGHALDIIVSYVFRSKRQ--MGYAVVITFLAASVYFFKSFSPIIYG 710

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  315 bits (806), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 207/656 (31%), Positives = 315/656 (48%), Gaps = 32/656 (4%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G + F   G  YP  VP+
Sbjct: 74  VFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGGEFGFEDIGIDYPATVPY 133

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
             MR    A+  L V + +   +A G      +  +++   ENS+ T            F
Sbjct: 134 QVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVENSFVTISRYILLDSPLLF 193

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A    F++   +      +  CL    TG ++G A+S K VG F    VG+ ++++L
Sbjct: 194 FIAAAVYSFKRLELHQTGSLQYYKCL--AATGMALGLAMSSKWVGFFTFAWVGVVSVMQL 251

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W  +GD N            +   L V P  ++ L F+IHF  L             F+ 
Sbjct: 252 WFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQSLPNVTDAAGNFSSAFRT 311

Query: 311 ALNG----TNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDG 366
            L+G     NI  G   V IGST+T++++   G YLHSH+  Y  GS+Q+QVT Y ++D 
Sbjct: 312 TLHGHTIPANIYAG---VGIGSTVTIRHIGTMGGYLHSHNHMYQGGSEQQQVTLYPHLDQ 368

Query: 367 NNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPL---NKLDYE 423
           NN W +   +     +   T  E + +G  IRL H  TG  LHSH  + P+   +    E
Sbjct: 369 NNHWYIEHYNAS---NTVPTTFEGLEHGTKIRLKHVLTGHRLHSHDHKPPVSVSSDWQKE 425

Query: 424 VSGYGNLTI-GDLKDHWVVEIIKDDGN--EDKNLIHPITTHVRFRHAVLNCYLAQSNEHL 480
           VSGYG     GD  D W+VEI ++     E +  +  I T  R RHA+  C L      L
Sbjct: 426 VSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFRLRHAMTGCMLFSHQVKL 485

Query: 481 PEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNL-EAPENFIYPRRSFWSDFFELNKRM 539
           P+WGF Q EV C  +   +   T+W ++ +T+P L E  E   Y   +FW    E++++M
Sbjct: 486 PKWGFEQQEVTCATQGRPD--LTLWYIEENTNPLLSEDSEKISYKTPNFWEKLVEIHRKM 543

Query: 540 MATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXX 599
              N +LT   D H Y +S+  +WP L R   I+ W+++  +  LLG+    +  T    
Sbjct: 544 WHINKSLT---DAHMY-QSDPIQWPFLLRG--ISYWSKDSRQVYLLGNAVVWYSVTLFVV 597

Query: 600 XXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYL 659
                       W     I  +       I   ++ LLG+F+H+ P  +MGR  ++HHYL
Sbjct: 598 IFGLICVGELFVWQLGKPILSDTKILNFHIQ-TIHYLLGYFIHYLPSFLMGRQMFLHHYL 656

Query: 660 PALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGM 715
           PA YF +  LA+  D  + + N+   +R I + + A ++   I  F+ ++P  YG+
Sbjct: 657 PAYYFGILALAHGLDGLVTFLNR---KRPIAYGLVAMFVLGSIAFFVTYSPLVYGL 709

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  313 bits (802), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 209/654 (31%), Positives = 317/654 (48%), Gaps = 27/654 (4%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DE HFGKF + Y++  F+ DVHPPL KML    G LAG+ G ++F   G  +P   P+
Sbjct: 79  VFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLAGFTGDFEFKDIGLAFPASTPY 138

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
             MR F   +    V + YF  +A G  +   ++ +++   ENS+ T            F
Sbjct: 139 FAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMFALENSFVTISRYILLDAPLIF 198

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A    ++K+  +  +  SF     L  TG S+G A+S K VGLF I  VG  ++ +L
Sbjct: 199 FIAAAAYSYKKYEIHPSE--SFNSYKALLATGLSLGLAVSSKWVGLFTIAWVGALSLFKL 256

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W  +GD     +    H + +   L+  P  ++   F IHF  L  +  G       F++
Sbjct: 257 WFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFFFYIHFQTLIYNSDGAGFFSSAFRS 316

Query: 311 ALNGTNIGQG-PRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L G NI    P DV +GS++++++    G YLHSH   Y  GSKQ+QVT Y+++D NND
Sbjct: 317 TLIGNNIPSNIPYDVGVGSSVSIRHTGTMGGYLHSHKHIYETGSKQQQVTLYSHLDANND 376

Query: 370 WIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL---DYEVSG 426
           W++   + +P   V     E +++G  IRL H+ T   LHSH  + P+++      EVS 
Sbjct: 377 WVI-ELYDQP--EVIPETFEGLKDGTKIRLRHRLTDRRLHSHDHKPPVSESSDWQKEVSA 433

Query: 427 YG--NLTIGDLKDHWVVEIIKDDG--NEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPE 482
           YG  N T GD  D WV+EI  +     E +  +  + T  R RHA+  C L      LP+
Sbjct: 434 YGADNFT-GDANDDWVIEIDHEASAPGEAQEYVKALDTKFRLRHAMTGCRLFSHEVKLPK 492

Query: 483 WGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNL-EAPENFIYPRRSFWSDFFELNKRMMA 541
           WGF Q EV C      +   T+W V+ +++P L E      Y   +F   F E ++RM  
Sbjct: 493 WGFEQQEVTCASSGVPS--LTLWYVEHNSNPLLPEDAAKISYQTPTFLEKFIESHQRMWH 550

Query: 542 TNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXX 601
            N  L   K+ H Y +S+   WP L R   I+ W+++  +  LLG+    W  T      
Sbjct: 551 INKNL---KEHHVY-QSDPATWPLLLRG--ISYWSQDHKQIYLLGNAVVWWSVTAFIGVF 604

Query: 602 XXXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPA 661
                     W     I Q++H     I    Y LLGW LH+ P  +MGR  ++HHYLPA
Sbjct: 605 VLVIVAELLAWQLGKSILQDKHVLNFHIQTFQY-LLGWGLHYAPSFLMGRQLFLHHYLPA 663

Query: 662 LYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGM 715
            YF +   A+  +  + Y  K K  + + + +   +++     F ++ P  YG+
Sbjct: 664 YYFGILAFAHALEIIVSYVFKNK--KTVGYGVVITFLAAATAFFYVYKPLIYGL 715

>Scas_408.1*
          Length = 391

 Score =  300 bits (767), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 220/376 (58%), Gaps = 8/376 (2%)

Query: 2   DSELRARKAPSVSEVKVEHDHGHDLANDNKEQKA-----SNKQFWLRLERVAMPIVFTXX 56
           DS LR RKA  V++   E D      +D+K+ K+     +  +    +     P++ T  
Sbjct: 16  DSSLRERKA--VTQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSSMRSYIGPLLLTIL 73

Query: 57  XXXXXXXXXXXXXXXTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSW 116
                           WDEAHFGKFGSYY+ H FYHDVHPPLGKML+  S YLAG++G +
Sbjct: 74  SFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLIALSEYLAGFDGHF 133

Query: 117 DFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYT 176
           +F S + YP+ V ++ MR F     ALCVP+T F  +++GF+  T +L T++V  E+SY 
Sbjct: 134 NFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSYLVTLMVTLEHSYI 193

Query: 177 TXXXXXXXXXXXXFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGL 236
                        FFT+ TF C  K ++  ++  + QW LW+ LTG S+GC  SVK VGL
Sbjct: 194 VLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGLSVGCVCSVKWVGL 253

Query: 237 FVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWG 296
           F+  +VG+ TI+EL+T   DK +   +Y  HW+ RII LI+ PFLI+  CFKIHF LL+ 
Sbjct: 254 FITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIYMFCFKIHFTLLYK 313

Query: 297 SGPGDHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQR 356
           SG GD      FQ  L GT I  GPRDV  GS +T+++       LHSH Q YP+GS+QR
Sbjct: 314 SGTGDSATNTLFQVNLEGTTIENGPRDVMYGSEVTIRSHGLSPNLLHSHVQLYPDGSRQR 373

Query: 357 QVTCYNYVDGNNDWIV 372
           Q+T Y + D ++ W++
Sbjct: 374 QITGYGHSDSSS-WLM 388

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  279 bits (713), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 192/624 (30%), Positives = 299/624 (47%), Gaps = 41/624 (6%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDY-VP 129
            +DE HFGKF SYYL  TF+ DVHPPL KM++ F G+L  Y+GS+ F   G  Y  +  P
Sbjct: 84  VFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAP 143

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           F+  R F   +  L V + + + K + F   T +L ++LV  +N++ T            
Sbjct: 144 FLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILL 203

Query: 190 FFTVATFMCFQKFHSYH-RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
               AT   + +F+    ++PFS+ W +WL+LTG S+ C IS K +G+     +GI  +V
Sbjct: 204 ISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVV 263

Query: 249 ELWTLLG-DKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  +  ++ +    H   R+  LI+ PF+I+   F +HFA+L  SGPGD  M   
Sbjct: 264 NLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSE 323

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYP-------EGSKQRQVTC 360
           FQ  L+ +   +  ++V     +T +N +  GA+LHSH   YP         S+ +QVTC
Sbjct: 324 FQDTLHDSEATKLSKEVQFFDIVTFEN-QDTGAFLHSHLARYPLRYEDDRVSSQGQQVTC 382

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y + D NN W +      P+   +  + + IR GD  RL H GT S L +H V +PL   
Sbjct: 383 YTHEDVNNQWEIL-----PV--ADKAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPT 435

Query: 421 DYEVSG-YGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYL-AQSNE 478
           + E++  + +  +G   +  +      +  ++ ++I      +R  H      L + ++E
Sbjct: 436 NEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDE 495

Query: 479 HLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRR----SFWSDFFE 534
            LP+WGF Q EV   +  +  D    W +D+    NL+   +   P+      F++ + E
Sbjct: 496 LLPDWGFGQQEVNGNK--KMTDSGNAWTIDSIM--NLDEKRSAYAPKEIKSMPFFNKWLE 551

Query: 535 LNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPS 594
           L K M   NN LT    +H +  S+   WP     +   + NE   +   +G+    W  
Sbjct: 552 LQKLMFEQNNKLT---SEHPF-ASQPESWPGSMSGVSFWTKNEERRQIYFIGNIIGFWFQ 607

Query: 595 TXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGV-YPLLGWFLHFFPFVIMGRVK 653
                              R          E+L  YG + Y   GW  H+FPF +MGR K
Sbjct: 608 VISFAVYVGIIIADQITRQRGYFALNKVTREKL--YGPLAYLFCGWACHYFPFFLMGRQK 665

Query: 654 YVHHYLPALYFALFVLAYIFDAGL 677
           ++HHYLPA      ++A +F AGL
Sbjct: 666 FLHHYLPA-----HLIAALFAAGL 684

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  270 bits (689), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 190/649 (29%), Positives = 285/649 (43%), Gaps = 29/649 (4%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            + E   G F S Y+ + F+ DVHPPL  ML      + GY G +++ + G  Y   VP+
Sbjct: 71  VFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVFGYKGLFNYGNIGTEYTANVPY 130

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
           V MR F   +  + V + Y   +  G  +    +  +    ENS+ T            F
Sbjct: 131 VAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSRFTLIEGPFVF 190

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F       F++   Y   P S +    L     ++G A+S K  GLF I   GI  +  +
Sbjct: 191 FMACAVYFFRRSELY--LPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWAGIIVLWRV 248

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W ++GD +        +   +  CL+  P  I+ L F +H   L  +G      P  F+ 
Sbjct: 249 WFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSSFFPAEFRK 308

Query: 311 ALNGTN-IGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L   N I +   +V++GS ++L ++   G YLHSH   YP GS Q+QVT Y ++D NN 
Sbjct: 309 TLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNK 368

Query: 370 WIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK---LDYEVSG 426
           WI+         + N T  + + +G  I+L     G  LHSH  + P+++      EVS 
Sbjct: 369 WIIELAEHP---NENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSC 425

Query: 427 YGNLTI-GDLKDHWVVEIIK--DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEW 483
           YG     GD+ D W++EI K   +    +  I  I T  R +H +  CYL    E LPEW
Sbjct: 426 YGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEW 485

Query: 484 GFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATN 543
           GF Q EV C     + D+ + +I +     +L  PE   Y + SFW  F  ++K M   N
Sbjct: 486 GFGQQEVTCAYFA-REDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLN 544

Query: 544 NALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXXX 603
           N +  S   H Y  SE   WP + R   I+ WNEN      LG+    W  T        
Sbjct: 545 NYMDTS---HAY-SSEPKTWPLMLRG--IDFWNENGREVYFLGNAVLWWSVTAFICTFII 598

Query: 604 XXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALY 663
                   W   + I +++H    F Y     LLG+  H+FP+  +G+  +++ YLPA Y
Sbjct: 599 GVAVELLAWKLGVNILRDKHIIN-FHYQVFQYLLGFAAHYFPYFFVGQKLFLYDYLPAYY 657

Query: 664 FALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFS 712
           F +    +  D    Y +  +           GY+ V I   + F  FS
Sbjct: 658 FGILAFGHALDLISTYISNKRNN--------TGYIVVAIFMVVCFYFFS 698

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  255 bits (652), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 197/686 (28%), Positives = 311/686 (45%), Gaps = 67/686 (9%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDY-VP 129
            +DE HFGK  SYYL  T++ DVHPP  KML+ F G+L GY+G++ F   G  Y  + VP
Sbjct: 73  VFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYDGAFKFDDIGYSYETHQVP 132

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           ++  R     +  L VP+ +   + + F   T     +LV  +N++              
Sbjct: 133 YIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAVDNAHVIDSRLILLDATLV 192

Query: 190 FFTVATFMCFQKFHSYH-RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
                +   + +F+    R P S +W  WL+ TG S+   IS K VG+F   ++G   IV
Sbjct: 193 ISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVISTKYVGVFTFAMIGTAVIV 252

Query: 249 ELWTLLGDK-NITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  +  ++ + +  H++ R   L+  PF ++   F +HFA+L  SGPGD  M   
Sbjct: 253 NLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYVHFAILTKSGPGDDFMSSA 312

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYP-------EGSKQRQVTC 360
           FQ  L  + + +  +DV     +T Q+ +  GA LHSH+  YP         S+ +QVT 
Sbjct: 313 FQETLADSPLAKDSKDVHYYDIVTFQH-RDTGALLHSHNAYYPLRYEDGRVSSQGQQVTG 371

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y++ D NN W +      P   ++    + +   D +RL H  TG+ L +H V +P    
Sbjct: 372 YSHEDINNQWEIL-----PTKELSSRTGQPVLLDDVLRLRHIATGTYLLTHDVASPYYPT 426

Query: 421 DYEVSGYG-NLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNE- 478
           + EV+     L  G+     + ++   +  +  + +   T+  R  H      L   N+ 
Sbjct: 427 NEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTSMFRMFHVDTAVALWTHNDV 486

Query: 479 HLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRR----SFWSDFFE 534
            LPEWGF Q EV   +  +  D   +W V++    NL        P++     F+S + E
Sbjct: 487 FLPEWGFKQQEVNGNK--KVTDPANIWTVNSIL--NLSEERKVYIPKKVTKMPFFSKWLE 542

Query: 535 LNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDT---RYLLLGSPAST 591
           L + M   NN L+    +H +  S+   WP    SL   S+  NDT   +    G+    
Sbjct: 543 LQRSMFEHNNKLS---SEHPF-ASQPESWPG---SLSGVSFWTNDTERRQIYFTGNIIGW 595

Query: 592 WPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGV-YPLLGWFLHFFPFVIMG 650
           W                     R   +      E+  IYG + +  +GW +H+FPF +MG
Sbjct: 596 WIELISLALFVGILLADAITRQRSFFVLGKLAREK--IYGPLCFLYIGWAIHYFPFFLMG 653

Query: 651 RVKYVHHYLPALYFALFVLAYIFDAGLRYY----NKTKTQR---------------IIKF 691
           R K++HHYLPA      ++A +F AGL       N+  T R               + ++
Sbjct: 654 RQKFLHHYLPA-----HLIAAMFTAGLWEVIFTDNRALTTRKDESEPAAPHNTNPIVYEY 708

Query: 692 CIYA--GYMSV-VIGGFILFAPFSYG 714
            + A  G +S+ V+G FI F+P  YG
Sbjct: 709 FLLAFLGLLSIAVVGFFIYFSPIVYG 734

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  253 bits (647), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 195/688 (28%), Positives = 298/688 (43%), Gaps = 55/688 (7%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPD-YVP 129
            +DE HFGKF SYYL  T++ DVHPP+ KML+   G+L GYNGS+ F   G  Y   Y P
Sbjct: 87  VFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIGWLTGYNGSFKFDDIGYSYDTYYAP 146

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           FV  R     +  L V + +   K + F   T ++   L+  +N++ T            
Sbjct: 147 FVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIAAFLIAVDNAHVTDTRLILLDAMLI 206

Query: 190 FFTVATFMCFQKFHSYH-RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
           F    +  C+ +F+      PFS +W LWL+LTG S+   +S K VGL     +G+  +V
Sbjct: 207 FSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFSLSMVMSTKYVGLLTYCTIGLAVVV 266

Query: 249 ELWTLLGDKN-ITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  ++ ++ ++   H + RI  LI+ PF+++   F  HFA+L  SGPGD  M   
Sbjct: 267 NLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVYLFWFWCHFAILNQSGPGDAFMSSD 326

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPE-------GSKQRQVTC 360
           FQ  L         + ++    IT+++ K   A+LHSH   YP         S  +QVTC
Sbjct: 327 FQDTLLDAPGAVEIKSINYHDIITIKH-KATDAFLHSHLAKYPVRYEDGRISSNGQQVTC 385

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y++ D NN W +  P G         +   ++    IRL H GT + L +H V +P    
Sbjct: 386 YSHEDINNQWEILPPSGSKF-----KKGAPVKLDADIRLRHVGTNTYLLAHDVASPYYPT 440

Query: 421 DYEVSGYGNLTI-GDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479
           + EV+        G+  D  +             +     +  R  H      L   N+ 
Sbjct: 441 NEEVTTVSEEEANGESYDFTLFRFQPILPKNSGRVAKTKNSAFRIFHVQTAVALWTHNDK 500

Query: 480 -LPEWGFSQAEV---RCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPR----RSFWSD 531
            LPEWGFSQ EV   + +++PE N     W VD+  +           P+      F+  
Sbjct: 501 LLPEWGFSQQEVNGNKKVQDPENN-----WFVDSIVNMPENDSRRIYTPKVPTSMPFFQK 555

Query: 532 FFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPAST 591
           ++EL   M   NN L+    +H +  S    WP     +   +  E   +    G+    
Sbjct: 556 WYELQFLMFEHNNKLS---SEHPF-ASNPQSWPLSLSGVSFWTKEEGRKQIFFTGNIVGW 611

Query: 592 WPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGV-YPLLGWFLHFFPFVIMG 650
           W                     RQ  ++         +YG + + + GW +H+FPF +M 
Sbjct: 612 WFEIVSVALYLGLVVADLI--TRQRAVYALNKMARQKLYGPMAFLIFGWCIHYFPFFLMA 669

Query: 651 RVKYVHHYLPA-LYFALFVLA-------------YIFDAGLRYYNKTKTQRIIKFCIYAG 696
           R K++HHYLPA L  A+F  A             +  D            ++     Y  
Sbjct: 670 RQKFLHHYLPAHLILAMFSAALWEIVFTDNQSLDFDLDEEDSKNPHDAEPKVYTIAYYLF 729

Query: 697 YMSVVI---GGFILFAPFSYGMTGKLEN 721
            +SV++   G FI FAP  YG++  ++ 
Sbjct: 730 CLSVIVNVGGCFIYFAPLVYGLSMTVDQ 757

>Scas_710.1
          Length = 919

 Score =  251 bits (640), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 186/654 (28%), Positives = 302/654 (46%), Gaps = 26/654 (3%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DEA +G   S YL++  + DVHPPL K+L     +  G+ G ++F   G P+P   P+
Sbjct: 77  VFDEAVYGNIVSKYLKNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTTTPY 136

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
             MR+F   + +L V + Y   +A G  +      +I ++ ENS+ T            F
Sbjct: 137 YAMRLFSATLGSLTVLLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGPLMF 196

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A     +K   +  K  S    + + +   ++G AIS K VG+  +   G+  +  L
Sbjct: 197 FIAAAVYFTKKSDLF--KADSCNSYINIGIAAVALGLAISSKWVGVATLIWAGLICVWRL 254

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W ++G+ ++         + +   LI  P +++ L F  HF     +        P F+ 
Sbjct: 255 WFMVGNLSMPVCGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQLFTPEFRT 314

Query: 311 AL-NGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L N + +     ++++GS ITL++    G YLHSH   Y +GS Q+Q+TCY YVD N++
Sbjct: 315 TLANNSVVNNVVAEIAVGSMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPYVDKNDN 374

Query: 370 WIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK---LDYEVSG 426
           W V   +  P+ ++  T  + + +G  IRL+H  TG  LHSH  + P+++      EVS 
Sbjct: 375 WTV-ELYDVPLENI--TSFQNLTDGTKIRLLHN-TGCRLHSHDHKPPVSENSDWQKEVSC 430

Query: 427 YGNLTI-GDLKDHWVVEIIKDDG--NEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEW 483
           YG     GD  D W++EI KD     E +  +  I T  R +HA++ CYL   N  LP+ 
Sbjct: 431 YGYPGFEGDANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKL 490

Query: 484 GFSQAEVRCIREPEKNDIKTMWIVDTHTHPNL-EAPENFIYPRRSFWSDFFELNKRMMAT 542
           GF Q EV C       D  T+W V+ + +P + +  E   Y   SFW  F E +KRM+  
Sbjct: 491 GFEQQEVTCAY--SGIDSLTLWSVENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEI 548

Query: 543 NNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXX 602
            + +    D      S+   WP + R   I+ W+E      LLG+    W  T       
Sbjct: 549 ASGM----DNTHMYESKPATWPFMLRG--IDFWSEQHQDIYLLGNAVLWWSVTAFIVGFA 602

Query: 603 XXXXXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPAL 662
                         +  ++ H     I    Y LLG+ L+F P +++    +++HYLPA 
Sbjct: 603 GIVVWELVSLQLGYEFSKDPHVINFHIQVIQY-LLGFLLNFIPSLLLENQIFLYHYLPAY 661

Query: 663 YFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMT 716
           YF +  L +  D  + Y  + +  R I + I   + ++ +  F   +   YG +
Sbjct: 662 YFGILALTHGLDILVSYIFRRR--RSIGYTIVFLFATLCVYFFRDRSALVYGTS 713

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  246 bits (629), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 174/614 (28%), Positives = 283/614 (46%), Gaps = 46/614 (7%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDY-VP 129
            +DE HFGKF SYYL  +++ DVHPP  KM++ F G+L GY+GS+ F   G  Y  +  P
Sbjct: 78  VFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCGYDGSFKFDEIGYSYETHPAP 137

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           ++  R F   +  L VP+ +   K + F   T    ++LV  + ++ T            
Sbjct: 138 YIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLLVAIDTAHVTETRLILLDAILI 197

Query: 190 FFTVATFMCFQKFHSYH-RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
               AT  C+ +F+    R+PF++ W +WL  TG S+   IS K VG+   + +G   +V
Sbjct: 198 ISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLSFVISTKYVGVMTYSAIGFAAVV 257

Query: 249 ELWTLLGDK-NITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  K  ++ +++  H+  R+  L++ PF+I+   F +HF +L  SGPGD  M   
Sbjct: 258 NLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLFWFWVHFTVLNTSGPGDAFMSAE 317

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPE-------GSKQRQVTC 360
           FQ  L  + +    + V+    IT+++ +   A+LHSH   YP+        S  +QVT 
Sbjct: 318 FQETLKDSPLSVDSKTVNYFDIITIKH-QDTDAFLHSHLARYPQRYEDGRISSAGQQVTG 376

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y + D NN W V  PHG  +      + +A+     IRL H  T + L +H V +P    
Sbjct: 377 YTHPDFNNQWEVLPPHGSDV-----GKGQAVLLNQHIRLRHVATDTYLLAHDVASPFYPT 431

Query: 421 DYEVSGYGNLTI----GDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYL-AQ 475
           + E++    +T+    G+L    +        +++ +++   T   R  H   +  L   
Sbjct: 432 NEEIT---TVTLEEGDGELYPETLFAFQPLKKSDEGHVLKSKTVSFRLFHVDTSVALWTH 488

Query: 476 SNEHLPEWGFSQAEV---RCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPR----RSF 528
           ++E LP+WGF Q E+   + + +P  N     W+VD     NL+       P+      F
Sbjct: 489 NDELLPDWGFQQQEINGNKKVIDPSNN-----WVVDEIV--NLDEVRKVYIPKVVKPLPF 541

Query: 529 WSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSP 588
              + E  K M   NN L+    +H +  SE + WP     +   +  +   +   +G+ 
Sbjct: 542 LKKWIETQKSMFEHNNKLS---SEHPF-ASEPYSWPGSLSGVSFWTNGDEKKQIYFIGNI 597

Query: 589 ASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGV-YPLLGWFLHFFPFV 647
              W                    +R          E+L  YG + +  + W  H+FPF 
Sbjct: 598 IGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTREKL--YGPLMFFFVSWCCHYFPFF 655

Query: 648 IMGRVKYVHHYLPA 661
           +M R K++HHYLPA
Sbjct: 656 LMARQKFLHHYLPA 669

>Kwal_47.16734
          Length = 792

 Score =  246 bits (629), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 181/627 (28%), Positives = 283/627 (45%), Gaps = 45/627 (7%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPY-PDYVP 129
            +DE HFGKF SYYL  T++ DVHPP  KML+ F G+L GYNG++ F   G  Y  +  P
Sbjct: 108 VFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYNGTFKFDDIGLSYDSNPAP 167

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           FV  R     +  L VP+ +   K + F   T  L  +LV  + ++              
Sbjct: 168 FVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAIDCAHVIDSRLILLDATLL 227

Query: 190 FFTVATFMCFQKFHSYHRK-PFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
                +  C+ +F+    K PFS  W LWL+LTG S+   +S K +G+     +G    V
Sbjct: 228 IAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMSTKYIGVMTYATIGSAVAV 287

Query: 249 ELWTLLGDK-NITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  +  +T +++  H + R+  LI  PF+++   F +HFA+L  SGPGD  M  +
Sbjct: 288 NLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWVHFAILIRSGPGDDFMSSQ 347

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYP-------EGSKQRQVTC 360
           FQ  L+ + + +  R V+    ITL++ K   AYLHSH + YP         S  +QVT 
Sbjct: 348 FQETLSDSPLAREARQVNYFDIITLKH-KVTDAYLHSHLERYPIRYEDGRVSSNGQQVTG 406

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           Y   D NN W V      P   +   E + +   D +R  H  T + L +H V +PL   
Sbjct: 407 YTLEDVNNQWEVL-----PTKQLPAREGQPVHLDDVVRFRHVVTNTFLLAHDVASPLYPT 461

Query: 421 DYEVSGY-GNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNE- 478
           + E++     +  G      +  +   +  + ++++    +  R  H      L   N+ 
Sbjct: 462 NEEITTVEEEMANGANYPETLFRLQSVNKGDSEDVLKSKASVFRIVHIDTTVALWTHNDV 521

Query: 479 HLPEWGFSQAEV---RCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRS----FWSD 531
            LPEWGF Q EV   + I +PE +     W  +T    N++   +   P+      F++ 
Sbjct: 522 LLPEWGFKQQEVNGNKKIIDPENS-----WFAETIV--NIDEARSVYVPKTRKKLPFFTK 574

Query: 532 FFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPAST 591
           + EL + M   NN L+ S   H +  S    WP     +   + +    +   +G+    
Sbjct: 575 WMELQRLMFEHNNKLSSS---HPFASSPE-SWPGSLSGVSFWTKDSERIQIYFIGNIIGW 630

Query: 592 WPSTXXXXXXXXXXXXXXXXWNRQMQIFQ-NEHDEELFIYGGVYPLLGWFLHFFPFVIMG 650
           W                     R+  IF  N+  ++       +  +GW  HF PF +MG
Sbjct: 631 WFQVVSIALFCGVTAADLLV--RRRGIFPLNKMAKQKLNAPLSFLFVGWLCHFVPFFLMG 688

Query: 651 RVKYVHHYLPALYFALFVLAYIFDAGL 677
           R K++HHYLPA      ++A +F A +
Sbjct: 689 RQKFLHHYLPA-----HLIASMFSAAM 710

>Scas_442.1
          Length = 309

 Score =  231 bits (588), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 164/297 (55%), Gaps = 13/297 (4%)

Query: 433 GDLKDHWVVEIIK--DDGN-----EDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGF 485
           GD+ D W++EI+   D GN     ED+N++HP++T  R RH VL CYLA +    P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 486 SQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNA 545
            QAE+ C +     D  T W V+ H +  L   E+++ P+  FW+DF  +N  M ++N+A
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIEEDYVPPKSKFWTDFILINFAMASSNSA 125

Query: 546 LTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXXXXXXXXXX 605
           L    DK D L S+ WEWPTL+R LR+ SW+ +  +Y LLGSP +TW ST          
Sbjct: 126 LVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFII 185

Query: 606 XXXXXXWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFA 665
                 W RQ    Q +    L I  G++P L W  HFFPFV+MGRV YVHHYLPALYFA
Sbjct: 186 SKIAYQWRRQHLNLQEDQLWRLGI-QGIFPFLAWITHFFPFVMMGRVTYVHHYLPALYFA 244

Query: 666 LFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENY 722
           +    ++ D     Y+  +    IK+ IY          ++LFAP   G+ G +  Y
Sbjct: 245 ILTFGFVLD-----YSIGRANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKY 296

>Scas_719.80
          Length = 762

 Score =  237 bits (604), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 186/634 (29%), Positives = 280/634 (44%), Gaps = 59/634 (9%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPY-PDYVP 129
            +DE HFGKF SYYL  T++ DVHPP  KM + F G+L GYNGS+ F   G  Y  +  P
Sbjct: 78  VFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYNGSFKFDEIGSSYQTNPAP 137

Query: 130 FVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXX 189
           ++  R F   +  L V + +   K + F   T +   +LV  +N++ T            
Sbjct: 138 YIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAVDNAHVTETRLILLDAILL 197

Query: 190 FFTVATFMCFQKFHSYH-RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIV 248
               A+F  F +F+    R PFS QW +WL LTG S+   IS K +G+     +G   IV
Sbjct: 198 ISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVISTKYIGVMTYAAIGTGVIV 257

Query: 249 ELWTLLGDK-NITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPR 307
            LW LL  + N+T + +  H++ R+  L+  PF I+   F +HFA+L  SGPGD  M   
Sbjct: 258 NLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWVHFAILSKSGPGDAFMSAE 317

Query: 308 FQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPE-------GSKQRQVTC 360
           FQ  L  + +    ++V     ITL++ K   A+LHSH   YP         S+ +QVT 
Sbjct: 318 FQETLGDSPMSILSKEVHFYDIITLKH-KDTEAFLHSHQAFYPLRYEDGRISSEGQQVTG 376

Query: 361 YNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKL 420
           +   D +NDW V      P   ++  +   +   + IRL H  + + L +H V +P    
Sbjct: 377 FTGTDISNDWEVL-----PTRELDSHKGVPVVLNEPIRLRHVASNTYLLAHDVASPFYPT 431

Query: 421 DYEVSGYGN------------LTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAV 468
           + E++                 T   LK      ++K  G + K + HP T  V + H  
Sbjct: 432 NEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGVQFK-IYHPNTDVVLWTH-- 488

Query: 469 LNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPR--- 525
                  ++  LP+WGF Q EV   +     D    W VD  T  NL+       P+   
Sbjct: 489 -------NDVLLPDWGFEQQEVNGSK--NFGDPTNAWSVDEIT--NLDEDRKKFTPKVVK 537

Query: 526 -RSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLL 584
             SF+  + EL K M   NN L+    +H +  S+   WP     +   + +E   +   
Sbjct: 538 PMSFFRKWSELQKSMFEQNNKLSA---EHPF-ASQPQSWPAGLCGVSFWTKSEERKQIFF 593

Query: 585 LGSPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFIYGGV-YPLLGWFLHF 643
             +    W                     R   +      E+L  YG + +  + W  H+
Sbjct: 594 TANIIGWWFQVISMSVFIGILLADQISRKRGYFVLGKITREKL--YGPLAFLFISWGCHY 651

Query: 644 FPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGL 677
            PF +M R K++HHYLPA      ++  +F AGL
Sbjct: 652 APFFLMHRQKFLHHYLPA-----HLIISLFTAGL 680

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  195 bits (496), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 173/635 (27%), Positives = 271/635 (42%), Gaps = 41/635 (6%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDF-PSGQPYPDYVPF 130
            +DE       S Y   TF  DV PPLGKM+  F G   G++ S+ + P G  + +   +
Sbjct: 86  VYDEGFVIAEVSKYFNKTFSIDVFPPLGKMIYYFVGKYTGFDTSYKYHPVGTQFENASVY 145

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
           +  R     + A  V   +   +A G S P   + ++ +  ENS+ T            F
Sbjct: 146 LPERYLAAGLGACVVVFFFMTLRASGVSRPIAGIFSVALSLENSFITASRYVHLDAPFLF 205

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A     +K  S + +  S ++          +G AIS K  GLFV+  V I T+  L
Sbjct: 206 FVAAAIYFTKK--SDNLRAGSGRYIFTFTHAACLLGLAISTKWAGLFVLAWVAIVTLWRL 263

Query: 251 WTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQA 310
           W L GD ++   R    +I  ++ L + P +I+   F  H       G     M P F++
Sbjct: 264 WLLAGDLSVPICRTVKVFIFNLLVLSLVPAVIYFSIFSWHIGSRTVDGNDSILMKPEFRS 323

Query: 311 AL-NGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNND 369
            L N T I +   DV +G T+ L N+   G ++ +    Y  GSKQRQ+          D
Sbjct: 324 ELYNNTVIKESFADVVVGGTVRLNNIGMDGGFVEAAPAYYEAGSKQRQIDLRKNESVTTD 383

Query: 370 WIV--YRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK-LDY--EV 424
           W+V  Y   G           E ++N + IRL        LHSH  +AP+++ +D+  EV
Sbjct: 384 WVVEYYNRSGS-----TPKSFENLKNHEKIRLYSPKYKCRLHSHDHKAPISQHVDWQKEV 438

Query: 425 SGYG-NLTIGDLKDHWVVEIIKD--DGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHL- 480
           S YG    +GD  D W+VEI +D  +  E +  +  I T  R +HA+  CYL   +  + 
Sbjct: 439 SCYGYEGFMGDPNDDWIVEIDQDLSEPGEAREFVKAIDTKFRLKHAMSGCYLFTHDVRMR 498

Query: 481 -PEWGFSQAEVRCIREPEKNDIKTMW-IVDTHTHPNL-EAPENFIYPRRSFWSDFFELNK 537
            PE+     E+ C    +     T+W I     HPN  + P+   Y   S      +L+ 
Sbjct: 499 TPEF-VMDYEIACAHSGKYE--LTLWNIEQDQPHPNSPKNPKRVSYKPMSLKDKILDLHA 555

Query: 538 RMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTXX 597
           +M+       V  DK   +   +  WP L +   I  WN    +   LG+PA  W  +  
Sbjct: 556 KMIEKAK---VRTDKSSLITFPT-TWPLLEKG--IPFWNGFARQIYFLGNPAMWWSVSAF 609

Query: 598 XXXXXXXXXXXXXXWNRQMQIFQNEH----DEELFIYGGVYPLLGWFLHFFPFVIMGRVK 653
                         W    +I  N        ++  YG     +G+ L++ P+++     
Sbjct: 610 IVLFVVAFVGELIFWQMGFEISSNPQFINFHIQVLQYG-----IGFALNYVPYILTTDRH 664

Query: 654 YVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQRI 688
           +++ YLPA YF L  LA++F+  L Y    K +R+
Sbjct: 665 HLYQYLPAYYFGLLALAHVFE--LVYSFAFKNKRV 697

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  147 bits (371), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 119/440 (27%), Positives = 193/440 (43%), Gaps = 48/440 (10%)

Query: 84  YYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSAL 143
           +YL H FY D  PPL   L     ++ G                +    +R    +   +
Sbjct: 70  HYLSHEFYLDSRPPLSVQLFSLLTFVYGE---------------LSVELLRAATTSCGGI 114

Query: 144 CVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXFFTVATFMCFQKFH 203
            + + Y   +    +     + +++ +   SY               F V    CF    
Sbjct: 115 ALVLLYLGLRKSSVNR----VISVIAVVSFSYLKVFREETLRVSTDIFQV----CFLAMS 166

Query: 204 SYH------RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDK 257
            Y        KPFS  W  +L     S+G +IS K VG    + +   +IV+LW ++ D 
Sbjct: 167 LYSWKSFKAAKPFSKTWHKYLLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADV 226

Query: 258 NITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHE--MPPRFQAAL--N 313
            +T K+   H + R + L++ P ++F L +  H + L      D    M P ++  L  N
Sbjct: 227 RLTGKQVFTHCVLRFMALVLVPAIVFLLSYYAHISTL-TQDLTDFSTFMSPYYKHTLENN 285

Query: 314 GTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIV- 372
             N    P  V  GSTIT+++    G YLHSH   Y  GS ++QVT Y++ D NN+WIV 
Sbjct: 286 PLNKIVPPGRVYYGSTITIRHKDSLGGYLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVE 345

Query: 373 YRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDY--EVSGYGNL 430
           ++   K +     ++  A++NG+ IRL H+ TG  L +   + P+++ DY  EVS  G+ 
Sbjct: 346 HKKENKDV----SSKAVAVKNGENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDA 401

Query: 431 T-IGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAE 489
              G   + W    I+  G   + L+ P+ T  +  +    C L   +  LPEW   Q E
Sbjct: 402 NYTGQSDELWK---IRFSGRLLEGLV-PLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQE 457

Query: 490 VRCIREPEKNDIKTMWIVDT 509
           V C+  P K   +T++ V++
Sbjct: 458 VLCLDPPTKE--RTLFYVES 475

>Scas_30.1
          Length = 128

 Score =  117 bits (292), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 70/104 (67%)

Query: 619 FQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLR 678
           F N  D   F+ G  YPLLGW LH+ PFVIM RV YVHHYLPALYFAL +LAY+FD  ++
Sbjct: 13  FANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFMK 72

Query: 679 YYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENY 722
            + K+K   I K  IY  Y +V+I GF  F+P S+GM G  +NY
Sbjct: 73  KWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNY 116

>Scas_329.1
          Length = 273

 Score =  121 bits (304), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 100/192 (52%), Gaps = 3/192 (1%)

Query: 72  TWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GQPYPDYVPF 130
            +DE HFGKF SYY++  F+ DVHPPL KML      LAG+ G++ F + G  +P  VP+
Sbjct: 83  VFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALAGFRGNFMFENIGDVFPADVPY 142

Query: 131 VKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTXXXXXXXXXXXXF 190
           V MR F   + AL V + Y   ++ G      +++      ENSY T            F
Sbjct: 143 VLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACFAIENSYVTISRYILLDAPLIF 202

Query: 191 FTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVEL 250
           F  A    F+K+ +Y  K FS      LF+ G ++G A S K VGLF I  VG+  I  L
Sbjct: 203 FIAAAVYSFKKYENY--KSFSIGSIKSLFVAGVALGMAASAKWVGLFTIAWVGLLCIWRL 260

Query: 251 WTLLGDKNITWK 262
           W ++GD + + K
Sbjct: 261 WFMIGDLSKSTK 272

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  120 bits (300), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 151/341 (44%), Gaps = 13/341 (3%)

Query: 207 RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYAN 266
           ++PF   W L L       G A   K VGL     V +     ++ L+GD  ++ +    
Sbjct: 192 QEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLIGDLEVSTRTVWK 251

Query: 267 HWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSI 326
           H + R+  L + P  I  L +  H      S      MP  F+A L+G  + Q P  V  
Sbjct: 252 HVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQLDGYQVLQ-PASVYY 310

Query: 327 GSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDT 386
           GS + +++    G YLHSH  TYP GS+++Q+T Y++ D NN W V   + + +  + ++
Sbjct: 311 GSGVVIRHSSSIGGYLHSHELTYPGGSEEQQITLYDFEDANNKWTVEPVYNEAMDDIINS 370

Query: 387 EHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDY--EVSGYGNLTI-GDLKDHWVVEI 443
             + +RNGD I+L H  TG  L +   + P+++ DY  EVS  G+    GD  + W V+I
Sbjct: 371 T-QPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTGDSGYSGDSDETWRVDI 429

Query: 444 IKDDGNEDKNLIHPITTHVRF-RHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKN--- 499
              + +ED      I    R  +  VL   L+   +       ++ EV C+  P      
Sbjct: 430 QDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPCTRQEVICLASPVHKYSL 489

Query: 500 ---DIKTMWIVDTHTHPNLEAPENF-IYPRRSFWSDFFELN 536
              D   M   +T   P L  P  F  Y    +  D+F  N
Sbjct: 490 FYVDSSEMMHNETMQLPRLSFPAKFWAYIHAQYKYDYFVKN 530

>Kwal_33.14357
          Length = 657

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 139/274 (50%), Gaps = 20/274 (7%)

Query: 244 IHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGS-GPG-D 301
           I  I ++W+++GD +++  +   H   R++ +I  PF    L    +F  L  S G G +
Sbjct: 213 ILMIKQMWSIVGDVDVSMWKILKHTFWRVLMIICVPF---GLMLSSYFVFLLNSRGAGMN 269

Query: 302 HE--MPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVT 359
           H   + P F+       + Q P  V  GS + +++ +  G YLHSH+ TY  GS ++QVT
Sbjct: 270 HSSLVSPYFKTWFLPQGLPQ-PDAVYYGSNLLIRHAESLGGYLHSHNYTYESGSLEQQVT 328

Query: 360 CYNYV-DGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLN 418
             ++  D +N+WI+   +        D   + +RNGD ++L H+ +G  L +   +AP++
Sbjct: 329 LVDFSNDADNEWIIEAQNENLKL---DKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVS 385

Query: 419 KLDY--EVSGYGNLT-IGDLKDHWVVEIIKDDGNE-DKNLIHPITTHVRFRHAVLNCYLA 474
           + DY  EVS  G+    GD  + W +    + GN  ++ ++ P T +    +   +C L 
Sbjct: 386 EQDYDHEVSCTGDHDYTGDSDETWRIRF--ERGNTPNEGILCPFTMYFSLENKGHDCKLL 443

Query: 475 QSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVD 508
             +  LP+WGF Q EV C+     +  ++++ VD
Sbjct: 444 SHDLRLPDWGFGQQEVLCVDSASPS--RSLFFVD 475

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score =  100 bits (249), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 139/309 (44%), Gaps = 29/309 (9%)

Query: 224 SMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIF 283
           S+G AIS K +G+     V +  + +   L+ D  +T  +     I  ++ +++ P  IF
Sbjct: 193 SLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLLFVLIIPGSIF 252

Query: 284 ALCFKIHFALLWGSGPG-DHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQNMKPRGAYL 342
            + +    +      P     M   F++ L G  +   P  +  GSTITL+++     YL
Sbjct: 253 IISYSNLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGSTITLRHLDSMVGYL 310

Query: 343 HSHHQTYPEGSKQRQVT-CYNYVDGNNDWIVYRP----HGKPIWHVNDTEHEAIRNGDTI 397
            SH  +YP    ++ V   +     +N+W++  P        ++H +  +   +  G +I
Sbjct: 311 ASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHAD--QLIPVEFGQSI 368

Query: 398 RLVHKGTGSNLHSHQVEAPLNKLDYEV-------SGYGNLTIGDLKDHWVVEIIKDDGNE 450
           +L HK TG  L +   + P+++ DY+        S Y     G + + W V +IKD+ N 
Sbjct: 369 KLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYE----GGMDERWDVLLIKDEINN 424

Query: 451 DKN------LIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTM 504
           DK        I P+ + +RF +    C L   +  LPEWG  + EV C+  P     +T 
Sbjct: 425 DKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPVIP--RTT 482

Query: 505 WIVDTHTHP 513
           +++D+   P
Sbjct: 483 FLIDSVQLP 491

>Scas_588.7
          Length = 726

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 99/435 (22%), Positives = 182/435 (41%), Gaps = 62/435 (14%)

Query: 84  YYLRHTFYHDVHPPLGKMLVGF---SGYLAGYNGSWDFPSGQPYPDYVPFVKMRI--FQG 138
           YY +  F  +  PPLG  L        Y A    S    S      Y+ F ++ +     
Sbjct: 142 YYQKDKFILNSFPPLGIQLYSLLPVGSYSAMRLMSLSASSFSLLFLYLAFRRVNVPYLIA 201

Query: 139 AVSALCV-PMTYFAAKAIGFSLPTV---WLTTILVLCENSYTTXXXXXXXXXXXXFFTVA 194
            VS +C+  +  F  ++   SL T+   WL+                         ++ A
Sbjct: 202 LVSTVCILSIPLFRKESTRISLDTLQWFWLSI----------------------SIYSWA 239

Query: 195 TFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLL 254
           +  CF  F        S +W +   +   S+GC+++ K +G        + + +  W ++
Sbjct: 240 SLKCFSHF--------SIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIYFWQMI 291

Query: 255 GDKNITWKRYANHWIARIICLIVTPFLIFA--LCFKIHFALLWGSGPGDHEMPPRFQAAL 312
           GD  ++      H   +I CL+V P  IFA  L  +I+ + +  S      M   ++  L
Sbjct: 292 GDVRLSTSHIVKHTTFQIFCLLVIPMTIFATTLYLQINHSRI-DSPEYSQYMSSYYKIFL 350

Query: 313 NGTNIGQGPRDVSIGSTITLQNMKPRGAYLHS-HHQTYPEGSKQRQVTCYNYVDG-NNDW 370
              +    P +++ GS IT++++   G YL S  +++YPEGS ++ V+  +     +N W
Sbjct: 351 RSKSPILQPMEITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQW 410

Query: 371 IVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDY--EVSGYG 428
           I+         +V+D     + +   I+L H+ TG  L +   + P+++ +Y  EVS  G
Sbjct: 411 ILE--------YVDDYNKGPLIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTG 462

Query: 429 NLTI-GDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQ 487
           +    GD  + W +++++         + P    +   +    C L   +  LP+WG  +
Sbjct: 463 DWDYHGDSDEFWKIDLVEGS-------LIPCWNIMELDNVGQMCTLISHDTRLPDWGEFE 515

Query: 488 AEVRCIREPEKNDIK 502
            EV CI+ P+    K
Sbjct: 516 QEVFCIQSPDPQRAK 530

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 190/488 (38%), Gaps = 52/488 (10%)

Query: 200 QKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNI 259
           +KF +   K FS  W + + L   S+   IS K +GL     + I ++  LW ++GD ++
Sbjct: 172 RKFQA--SKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDV 229

Query: 260 TWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQ 319
             ++       R++  +V P +     +         S      M   FQ   + +    
Sbjct: 230 KNRQLFAIMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQ-HYSMSQHND 288

Query: 320 GPRDVSIGSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKP 379
            P  +  GS+I L+++   G YL +    YP+ +        +  D  N WI+    G+ 
Sbjct: 289 IPSSIIYGSSIRLRHVNSLGGYLSALEIPYPKSNDTLVTVSDDPDDEANFWIIESNKGR- 347

Query: 380 IWHVNDTEHEA-IRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYE----VSGYGNLTIGD 434
             +   T   A ++  D ++L +K TG  L + + + P++  +Y+    V+G  +   GD
Sbjct: 348 --NTEQTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQ-GD 404

Query: 435 LKDHWVVEIIKDDGNED-KNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCI 493
             + W +EI    G    + ++ P    +  ++    C L      +P WG  + EV C+
Sbjct: 405 QDELWKIEI---QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV 461

Query: 494 REPEKNDIKTMWIVDTHTHPNLEAPENFIY-PRRSFWSDFFE-------LNKRMMATNNA 545
                N  + ++ +D  + P     E + + P   F+   FE       LNKR    N +
Sbjct: 462 DPARVN--RALFYIDFVSSPEAGVVEKYKWAPEYPFYKLAFEYVVGQFRLNKRQNIDNTS 519

Query: 546 LTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTW-PSTXXXXXXXXX 604
           ++           +   WP L+        N N    +L       W  ST         
Sbjct: 520 MS---------PPDCLSWPILFD-------NNNQIGKIL-------WITSTVSVGVYTFM 556

Query: 605 XXXXXXXWNRQMQIFQNEHDEELFIYG-GVYPLLGWFLHFFPFVI-MGRVKYVHHYLPAL 662
                  WN       N    +L      +   LGW LH + F   + R   V+ Y+P+L
Sbjct: 557 EAYSWLSWNIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSL 616

Query: 663 YFALFVLA 670
            FA+ +L+
Sbjct: 617 LFAVIILS 624

>Scas_710.0d
          Length = 271

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 59/145 (40%), Gaps = 5/145 (3%)

Query: 572 INSWNENDTRY--LLLGSPASTWPSTXXXXXXXXXXXXXXXXWNRQMQIFQNEHDEELFI 629
           I+ W E+D      LLG+    W  T                W     + Q++ D   F 
Sbjct: 3   ISYWGEHDQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDK-DVINFH 61

Query: 630 YGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQRII 689
              ++ LLG+ +H  P  +MGR  ++HHYLPA YF +    +  D    Y  + K     
Sbjct: 62  IQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRKKN--F 119

Query: 690 KFCIYAGYMSVVIGGFILFAPFSYG 714
            + + A + ++    F   +P  YG
Sbjct: 120 AYTLLAVFFALSYYFFKDHSPIIYG 144

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 12/120 (10%)

Query: 328 STITLQNMKPRGAYLHS-HHQTYPEGSKQRQVTCYNYVDGN-NDWIVYRPHGKPIWHVND 385
           ST+ +++++  G YL +  +  Y  GS ++      + D   N+WI+  P  +       
Sbjct: 325 STVRIRHVESLGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWII-EPSTEA------ 377

Query: 386 TEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDY--EVSGYGNLTI-GDLKDHWVVE 442
             ++ +R+G  IRL +  TG  L +     P++  +Y  EVS  G+    GD  + W+++
Sbjct: 378 QNNKEVRSGSRIRLRNVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDADETWLID 437

>CAGL0D04356g 426132..427307 highly similar to sp|P48015
           Saccharomyces cerevisiae YDR019c GCV1, hypothetical
           start
          Length = 391

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 80  KFGSYYLRHTFYHDVHPPLGKMLVGFSGY 108
           +F S  L+ T  HD+H  LG  +V F+GY
Sbjct: 7   RFNSTALKKTALHDLHVSLGGTMVEFAGY 35

>CAGL0D00572g complement(72970..76083) similar to sp|Q07468
           Saccharomyces cerevisiae YDL077c VAM6 Vacuolar
           carboxypeptidase Y, start by similarity
          Length = 1037

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%)

Query: 417 LNKLDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQS 476
           L+K+ Y     G +TI D+K+H +V++   + NE   LI+  + + R+ + V + +   S
Sbjct: 274 LDKVLYSAGKSGGITIMDMKNHSIVQLKTSESNEPFLLINKTSENFRWHNGVRDVHYLSS 333

Query: 477 NEHL 480
            + L
Sbjct: 334 IDSL 337

>CAGL0B03817g 378159..379157 highly similar to sp|P47085
           Saccharomyces cerevisiae YJR008w, hypothetical start
          Length = 332

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 514 NLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLYRSLRIN 573
           N ++PEN      S W  + E++   +     ++V       +  + +EWP   +S  +N
Sbjct: 261 NAKSPENLY----SEWKQYLEISGNTICGEKPISVIACALASVGYKDFEWPAYSQSSNVN 316

Query: 574 SWNENDTRY 582
           S NE+   Y
Sbjct: 317 SINESSVSY 325

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,615,765
Number of extensions: 1081277
Number of successful extensions: 3142
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3000
Number of HSP's successfully gapped: 48
Length of query: 722
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 613
Effective length of database: 12,822,747
Effective search space: 7860343911
Effective search space used: 7860343911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)