Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00737g79578239340.0
YOR322C81882816080.0
Scas_643.24d78469714690.0
KLLA0A04103g78580611831e-151
ACR291C68468911621e-149
Kwal_26.71001781611382e-09
Scas_30.1d72501101e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00737g
         (782 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...  1519   0.0  
YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...   624   0.0  
Scas_643.24d                                                          570   0.0  
KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...   460   e-151
ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...   452   e-149
Kwal_26.7100                                                           58   2e-09
Scas_30.1d                                                             47   1e-06

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 795

 Score = 1519 bits (3934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/782 (94%), Positives = 742/782 (94%)

Query: 1   MLNFQRLGRIQSNDNSNSTAQSQSKFGSPVKLRRGSEVHTPGKPEDVSGRPPCKLPIDLE 60
           MLNFQRLGRIQSNDNSNSTAQSQSKFGSPVKLRRGSEVHTPGKPEDVSGRPPCKLPIDLE
Sbjct: 1   MLNFQRLGRIQSNDNSNSTAQSQSKFGSPVKLRRGSEVHTPGKPEDVSGRPPCKLPIDLE 60

Query: 61  LNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQHETGYN 120
           LNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQHETGYN
Sbjct: 61  LNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQHETGYN 120

Query: 121 NITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSW 180
           NITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSW
Sbjct: 121 NITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSW 180

Query: 181 NIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKDKEY 240
           NIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKDKEY
Sbjct: 181 NIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKDKEY 240

Query: 241 MLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPS 300
           MLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPS
Sbjct: 241 MLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPS 300

Query: 301 TGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPVPIKR 360
           TGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPVPIKR
Sbjct: 301 TGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPVPIKR 360

Query: 361 YGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDENET 420
           YGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDENET
Sbjct: 361 YGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDENET 420

Query: 421 TDQFVHPSDDAMXXXXXXXXXXXXXXXXXXXXXNSSALFSEEVRIISKGEMKSGWKTDFD 480
           TDQFVHPSDDAM                     NSSALFSEEVRIISKGEMKSGWKTDFD
Sbjct: 421 TDQFVHPSDDAMRQELLQQQQRQREQQLKQELKNSSALFSEEVRIISKGEMKSGWKTDFD 480

Query: 481 SDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLGIYVNH 540
           SDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLGIYVNH
Sbjct: 481 SDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLGIYVNH 540

Query: 541 TLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNXXXXXSREMDQRLL 600
           TLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMN     SREMDQRLL
Sbjct: 541 TLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNDDDDDSREMDQRLL 600

Query: 601 ELSPMFANRNAQRAKPVEYNDLSPVXXXXXXXXXXXXXXITPHMSSTPRIVSVPTGAARV 660
           ELSPMFANRNAQRAKPVEYNDLSPV              ITPHMSSTPRIVSVPTGAARV
Sbjct: 601 ELSPMFANRNAQRAKPVEYNDLSPVNSRSSTRSGNNTGRITPHMSSTPRIVSVPTGAARV 660

Query: 661 LRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAALKDSGGVQIVDNSEDLGEE 720
           LRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAALKDSGGVQIVDNSEDLGEE
Sbjct: 661 LRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAALKDSGGVQIVDNSEDLGEE 720

Query: 721 PEHQTPIIAFPPMAHHNNSNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMG 780
           PEHQTPIIAFPPMAHHNNSNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMG
Sbjct: 721 PEHQTPIIAFPPMAHHNNSNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMG 780

Query: 781 IR 782
           IR
Sbjct: 781 IR 782

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/828 (45%), Positives = 488/828 (58%), Gaps = 149/828 (17%)

Query: 55  LPIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQ 114
           LP+ L +++ESPPCVLYGSA +S+GAVL G F + V DP S     S+ N E      ++
Sbjct: 27  LPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVDPYSSAEDKSLKNTESNVSTTSK 86

Query: 115 H---------------------------------------------ETGYNNITITSVHL 129
                                                           GY  ITITSV L
Sbjct: 87  SLKRKSTFGSALSSRLSSLSASTSNISPSTSSTSISHSPTPANLRIMAGYTKITITSVTL 146

Query: 130 KFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSWNIQSTKKLI 189
             VQK+ ++KPF+P+  IS+  T              C NCK K T++KSW IQS  + +
Sbjct: 147 SLVQKIHFHKPFVPN--ISSMQT--------------CMNCKTKITNMKSWEIQSNTQDL 190

Query: 190 TIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKD------------ 237
           ++G H+YPFSYL+PGSVP +S+LG +A T+++YEL+  V+Y DP H++            
Sbjct: 191 SVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDP-HRNSFSSGHSTPRKE 249

Query: 238 ----KEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKL 293
               K+ +L + MPI VTRSI RGPDKNSLRVFPPT+LTAAAVLPNVVYPKSTFPLEMKL
Sbjct: 250 GSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKL 309

Query: 294 NGISSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKK 353
           +G+SS       D+RWRMRKL+WR+EETTRVK + C  HK +L++LE+QVK+KE E+SKK
Sbjct: 310 DGVSS------GDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKK 363

Query: 354 PPVPIKRYGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNI 413
           P   IKRYG++GPQIR+A++S  NMP     S   P     E+APNS+  +S     GN+
Sbjct: 364 PRSHIKRYGELGPQIRVAVNSLENMP-----SQRLPGEPGREQAPNSSGPAS----TGNV 414

Query: 414 DTD---------ENETTDQFVHPSDDAMXXXXXXXXXXXXXXXXXXXXXNSSALFSEEVR 464
             D         E++   +F+HPSDDA+                     N+S+LF+EEVR
Sbjct: 415 GLDDENPVNEDEEDQPGSEFIHPSDDALRQELLMQQQRARQQQLQQELKNNSSLFTEEVR 474

Query: 465 IISKGEMKSGWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVT 524
           IISKGEMKSGWKTDFD +NGK+ELVT+ID +  NSGVSNP+MH ST          P + 
Sbjct: 475 IISKGEMKSGWKTDFD-NNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSIN 533

Query: 525 IACDIQDPNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTEN 584
           +ACDIQDPNLG+YV+H LA+EIVVAEE LQYANGQPIR   S+        +K E     
Sbjct: 534 VACDIQDPNLGLYVSHILAVEIVVAEETLQYANGQPIRKPNSK--------NKKETNNNT 585

Query: 585 MNXXXXXSREMDQRLLELSPMFANRNAQRAKPVEYNDLSPVXXXXXXXXXXXXXXITPHM 644
           MN         DQRL ELSP+FANRN  + + +   D++PV                 + 
Sbjct: 586 MNVHNP-----DQRLAELSPIFANRNTPKVRRMGPEDITPVNSNKSNHSTNKEK--ASNG 638

Query: 645 SSTPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAALKD 704
           +S   IVSVPTGAARVLRMQFR+ VTERSGLGISWDEEVPP+Y +++  +PP YE ++ +
Sbjct: 639 ASNSNIVSVPTGAARVLRMQFRLTVTERSGLGISWDEEVPPIYQDVELLSPPCYELSINN 698

Query: 705 ---------------------SGGVQIVDNSEDLGEEPE---HQTPI----IAFPPMAHH 736
                                 G  + + N E  G EP     +  I    +  PP AHH
Sbjct: 699 GIKNKLYSTMSTPVRSEDDFVGGSDEDIGNYESQGLEPGPNVQEVTITQNKLTIPPTAHH 758

Query: 737 NN--SNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMGIR 782
               S+ + +LTTVQSP LE+++S+QG+VP+ RG  LTP++T ++ I+
Sbjct: 759 YQPASSSQRSLTTVQSPPLESVVSVQGSVPF-RGHVLTPHSTRDIRIQ 805

>Scas_643.24d
          Length = 784

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/697 (46%), Positives = 412/697 (59%), Gaps = 111/697 (15%)

Query: 56  PIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQE--------- 106
           PI+L +N+ESPPCVLYGSA DS G++L G   L VKDP ++  I + D+ +         
Sbjct: 129 PIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKS 188

Query: 107 -HGGR-----------------------NATQHET-------------GYNNITITSVHL 129
              GR                        A+  +T             GY  I++TSV L
Sbjct: 189 PRPGRRKSAIGSTLSTTFSQLAVAQSQATASSQKTTPSPSPSNTKIMNGYTKISVTSVSL 248

Query: 130 KFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSWNIQSTKKLI 189
            FVQK+ ++KPF PD+S                +I +C NC+ K T +KSW IQ   +  
Sbjct: 249 TFVQKIHFHKPFTPDTS----------------SIQSCTNCRTKLTDMKSWPIQKAPQDK 292

Query: 190 TIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVH----KDKEYMLNIK 245
            +G H YPFSYL+PGSVPSTS LG +A T+I+YEL+   +Y +P      K KE ML + 
Sbjct: 293 PVGAHTYPFSYLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLV 352

Query: 246 MPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPSTGKGS 305
           MP+ VTRSI RGPDKNSLRVFPPT+LTAAAVLPNV+YPKSTFPLEMKL+G+S        
Sbjct: 353 MPVAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSL------Q 406

Query: 306 DKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPVPIKRYGDIG 365
           D+RWRMRKL+WRVEETTRV++  C  H+ +L+KLE  VK +E ER+KKP   IKRYGDIG
Sbjct: 407 DRRWRMRKLSWRVEETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIG 466

Query: 366 PQIRIALSSPSNMPLS-----GGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDENE- 419
           PQ+R+A+SSP N+PL      G  +        S   P   + SS  G  G+ D  E+  
Sbjct: 467 PQVRVAVSSPENLPLQRLRNHGDLNSNSSRNNPSMRTPQDGSASSGNGHNGSNDIPEDRD 526

Query: 420 -----TTDQFVHPSDDAMXXXXXXXXXXXXXXXXXXX-XXNSSALFSEEVRIISKGEMKS 473
                + D+F+HPSDDA+                      N S LF+EEVRII+KG+MKS
Sbjct: 527 DQDDVSVDEFIHPSDDALRQELLQQQQRLREQQLQQEIAKNDSTLFTEEVRIIAKGDMKS 586

Query: 474 GWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPY--KKKPDLPPVTIACDIQD 531
           GWKTDF+ +NGK+ELVT+ID +  NSGV NP+   ST+ P+    K D     I+CDIQD
Sbjct: 587 GWKTDFE-NNGKIELVTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQD---ANISCDIQD 642

Query: 532 PNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNXXXXX 591
           PNLGIYVNH LA+EIVVAEE LQY+NGQPIR+               +  ++        
Sbjct: 643 PNLGIYVNHILAVEIVVAEETLQYSNGQPIRS---------------KSRSDKSKNSSNS 687

Query: 592 SREMDQRLLELSPMFANRNAQRAKPVEYNDLSPVXXXXXXXXXXXXXXITPHMS------ 645
               DQRL ELSPMFANRNA R +PV  N ++PV                 +        
Sbjct: 688 GSSADQRLAELSPMFANRNAPRTRPVSNNSITPVNSRTTNGETSSGNNDENNSENAGLPI 747

Query: 646 STPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEE 682
           ++ ++VSVPTGAARVLRMQFR+NVTERSGLGISWDEE
Sbjct: 748 NSSKVVSVPTGAARVLRMQFRLNVTERSGLGISWDEE 784

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 5/40 (12%)

Query: 745 LTTVQSPQLENIISIQGAVPYGRGSP-----LTPNNTIEM 779
           L TV SP LENIISIQG VP    S      LTPNNT E+
Sbjct: 44  LNTVVSPPLENIISIQGNVPLLNQSNSSTQILTPNNTREV 83

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score =  460 bits (1183), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/806 (36%), Positives = 417/806 (51%), Gaps = 154/806 (19%)

Query: 56  PIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKD------PQSENFIYSVDN----- 104
           PI+L +N+ESPPCVLYGSAT+S+GA+L G   + + D      P     +  V++     
Sbjct: 30  PIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPVNSGQRKQ 89

Query: 105 ---------------------QEHGGRNATQHETGYNNIT---------ITSVHLKFVQK 134
                                 +  G N  +  +  N IT         + SV L  +QK
Sbjct: 90  LTNSLTTSLSHLSLSHAHHAHHQKSGDNLKRLASMSNLITPPKAITSVSLNSVELSLIQK 149

Query: 135 VTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSWNIQSTKKLITIGKH 194
           V Y KPF P +++                +  C NCK K T    W I +    + +G+H
Sbjct: 150 VHYEKPFRPSAAV----------------LNTCTNCKTKITEFHRWTIMNKPTELAVGQH 193

Query: 195 AYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKDKE---YMLNIKMPIPVT 251
           ++PFS+L+PG++P T+ LG ++++ I+YEL+   +Y  P     E    +L + +PI +T
Sbjct: 194 SFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESAKRVLQLNLPISIT 253

Query: 252 RSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPSTGKGSDKRWRM 311
           RSI RG DK SLRVFPPT+LTA AVLPNVVYPKSTF +E+KL+GI S       D+RWRM
Sbjct: 254 RSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICS------DDRRWRM 307

Query: 312 RKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERS---KKPPVPIKRYGDIGPQI 368
           RKL WR+EE  +V+ + C  HK  LK+LE++VK ++EER    +K   PIKR  D+GPQ+
Sbjct: 308 RKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVK-QDEERDRQIRKSSKPIKRSVDMGPQV 366

Query: 369 RIALSSPSNMPLSG-GRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDEN---ETTDQF 424
           ++ +++  ++ L    R+      T +E+  N    ++   +    D D +   +T   F
Sbjct: 367 KMTVNTFHDVLLQQLSRAN-----TEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTDF 421

Query: 425 VHPSDDAMXXXXXXXXXXXXXXXXXXXXXNSSALFSEEVRIISKGEMKSGWKTDFDSDNG 484
           +HP+DDAM                       SAL++EEVR I+ GE+KSGWK+DF SD G
Sbjct: 422 IHPNDDAMRQEIMQQQQRVRQQQIEEELKQESALYTEEVRTIANGEIKSGWKSDF-SDKG 480

Query: 485 KVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLGIYVNHTLAI 544
            +ELVTDID +  NSGV+NPI H ST +P    P+   V ++CD++D NLG+YV+H L +
Sbjct: 481 TIELVTDIDCMRLNSGVTNPISHASTRNPC-VLPNQDNVNVSCDMEDTNLGVYVSHLLFV 539

Query: 545 EIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNXXXXXSREMDQRLLELSP 604
           E++VAEE LQ  NG      GS  S      SKP+                DQRL ELSP
Sbjct: 540 EVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNA-------------DQRLAELSP 586

Query: 605 MFANRNAQRAKPVEYNDLSPVXXXXXXXXXXXXXXITPHMSSTPRIVSVPTGAARVLRMQ 664
           +FA+R   + +PV  N                     P  +  P+IV VPTGAARVLRMQ
Sbjct: 587 IFADRE-NKPQPVIDNQ--------------------PGNNVGPKIVGVPTGAARVLRMQ 625

Query: 665 FRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAA----------------------- 701
           FR+ +TERSGLGISWD+EVPP Y +I+   PP Y+                         
Sbjct: 626 FRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQDVSTTLLHSTLSSPTITPPGESSLF 685

Query: 702 -LKDSGGVQIVDNSEDLGEEPEHQT----------PIIAFPPMAHHNNSNIRNNLTTVQS 750
            L+   G +        G  PE ++               PP A H+++N  +     Q 
Sbjct: 686 TLETGNGAE----RAVTGSAPETRSNSSVRLNVNNAEYIRPPPALHHSANTSSTSIAFQF 741

Query: 751 PQLENIISIQGAVPYGRGSPLTPNNT 776
             L++++S QGA P G  S LTP  T
Sbjct: 742 SDLDHVMSTQGAEP-GFNSALTPQTT 766

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
           [2055 bp, 684 aa]
          Length = 684

 Score =  452 bits (1162), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/689 (37%), Positives = 370/689 (53%), Gaps = 110/689 (15%)

Query: 57  IDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQHE 116
           ++L L +ESPPCVLYG  T+SAGA+L G   + V+   +E                    
Sbjct: 22  VELGLEIESPPCVLYGPPTESAGALLSGLVTVHVQGAGAEA------------------- 62

Query: 117 TGYNNITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTS 176
                  +  + L   Q+VTY +PF+                   G + +C  C+ +   
Sbjct: 63  ---GGCVVARLTLVLEQQVTYGRPFV------------------AGPLGSCAACRERRRE 101

Query: 177 LKSWNIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHK 236
           L  W + +    +  G+HAYPFS+L+ G +P+TS LG +  T+I+YELV +  Y      
Sbjct: 102 LARWEVVAQAAELAGGRHAYPFSHLLAGELPATSTLGSAGATQIRYELVADAVYR--AGG 159

Query: 237 DKEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGI 296
            +E    +++P+ VTRSI RGPD+NSLRVFPPT +TA AVLP+V+YP+ST PLE++L G+
Sbjct: 160 GEERRRELRLPVLVTRSILRGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGV 219

Query: 297 SSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPV 356
                   +D+RWRMR+L WR++E  RV+++ C  H+  L+ LE++V+ K     KKP  
Sbjct: 220 CC------ADRRWRMRRLTWRIDEKVRVRSHACAAHRARLRALEEEVRAKTARNLKKPAK 273

Query: 357 PIKRYGDIGPQIRIALSSPSN-MPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDT 415
           PIKR  D+GPQ+ +++++  + +P   G +                  + +E + GN+D 
Sbjct: 274 PIKRTPDMGPQVTVSVATVEDPLPFDAGSAA-----------------ARQEADVGNMD- 315

Query: 416 DENETTDQFVHPSDDAMXXXXXXXXXXXXXXXXXXXXXNSSALFSEEVRIISKGEMKSGW 475
           D+ +T   F+HPSD AM                       ++ + EEVR I+  +++SGW
Sbjct: 316 DDADTQSAFIHPSDHAMQQELQELQARIRQQQLEEERKQETSHYIEEVRTIAGTDIRSGW 375

Query: 476 KTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLG 535
           K+DF S +GK+ELV +ID +  NSGV+NP+   STT PY  +    PV + CD++DP LG
Sbjct: 376 KSDF-SGSGKIELVMEIDCMKLNSGVTNPVNMVSTTSPYLARGQ-APVNVTCDVEDPTLG 433

Query: 536 IYVNHTLAIEIVVAEEALQYANGQPIRNG-----GSRRSSVIPEGSKPEGTTENMNXXXX 590
           I VNH L +EI+VAEE L Y NGQ +  G     G  +   + E +KP G   +      
Sbjct: 434 ISVNHLLLVEIIVAEEMLHYTNGQLLSKGEAQGEGEGQGEALAE-AKPAGLAGS------ 486

Query: 591 XSREMDQRLLELSPMFANRNAQ--RAKPVEYN-DLSPVXXXXXXXXXXXXXXITPHMSST 647
                DQRL ELSPMFANRN    RA   E++  L P                     + 
Sbjct: 487 ---HADQRLAELSPMFANRNNSMFRASAEEHSPGLEPDGSTA---------------GAD 528

Query: 648 PRIVSVPTGAARVLRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAALKD--- 704
            RIV  PTGAARVLRMQF++ +TERSGLGISWD+EVPP Y +++   PPSY+ A+     
Sbjct: 529 KRIVGTPTGAARVLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDEAVSASVS 588

Query: 705 --SGGVQIVDNSEDLGEEPEHQTPIIAFP 731
             SG  ++V   E     P  + P+ A P
Sbjct: 589 EVSGSSRVVSGPES---NPAVRAPVAASP 614

>Kwal_26.7100
          Length = 178

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 67/161 (41%), Gaps = 57/161 (35%)

Query: 57  IDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVD----NQEHGGRNA 112
           ++L +++ESPPCVLYG+AT+S GA+L G   +RVK P  +  I S +       HG +  
Sbjct: 33  VELLIDIESPPCVLYGTATESTGALLSGLLKVRVKQPGDK--ISSSEPLSPVNSHGRKK- 89

Query: 113 TQHETGYNNIT---------------------------------ITSVHLKFVQKVTYNK 139
            +  TG N I+                                 + SV L  VQKV Y K
Sbjct: 90  -KSSTGLNAISQTLSNLSLANANVSPVASPGISRTPSVIFTKALVKSVSLSLVQKVRYAK 148

Query: 140 PFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSW 180
           PF       A   ++Q          +C NC+ K T    W
Sbjct: 149 PF------DAQCNSIQ----------SCLNCRSKDTERARW 173

>Scas_30.1d
          Length = 72

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 732 PMAHHNNSNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMGI 781
           P+AH +  +  + L +VQSPQLEN++SIQG  P G G  LTP+ T ++GI
Sbjct: 11  PVAHXHQDSF-HGLASVQSPQLENVVSIQGNAP-GHGYILTPHTTRDIGI 58

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,181,602
Number of extensions: 1177752
Number of successful extensions: 3048
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3094
Number of HSP's successfully gapped: 33
Length of query: 782
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 672
Effective length of database: 12,788,129
Effective search space: 8593622688
Effective search space used: 8593622688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)