Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00715g31029111691e-162
Scas_663.23042047315e-96
YAL025C (MAK16)3062487072e-92
CAGL0G06248g2972046932e-90
KLLA0A04037g3022046724e-87
ADR349W3202066622e-85
Kwal_26.70822992046298e-81
KLLA0A01133g277121710.56
KLLA0E23166g72692644.9
Sklu_2280.684978629.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00715g
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   454   e-162
Scas_663.2                                                            286   5e-96
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   276   2e-92
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   271   2e-90
KLLA0A04037g complement(359981..360889) some similarities with s...   263   4e-87
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   259   2e-85
Kwal_26.7082                                                          246   8e-81
KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces c...    32   0.56 
KLLA0E23166g complement(2056949..2059129) some similarities with...    29   4.9  
Sklu_2280.6 YFR002W, Contig c2280 8908-11457 reverse complement        28   9.6  

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  454 bits (1169), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/291 (79%), Positives = 230/291 (79%)

Query: 1   MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGD 60
           MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGD
Sbjct: 1   MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGD 60

Query: 61  KGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLS 120
           KGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLS
Sbjct: 61  KGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLS 120

Query: 121 QIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSG 180
           QIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSG
Sbjct: 121 QIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSG 180

Query: 181 AYSNADKTLTPLNVDENIWNKIMGKLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           AYSNADKTLTPLNVDENIWNKIMGKLG                                 
Sbjct: 181 AYSNADKTLTPLNVDENIWNKIMGKLGEEDMEGVSADEEEEESDVEREIEYIEDTEEEEE 240

Query: 241 VDLDNLEKWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQRKLKDIKKKSI 291
           VDLDNLEKWL                            YQRKLKDIKKKSI
Sbjct: 241 VDLDNLEKWLEDKSDHSDKDEDDSDFSSTDDEGDDDESYQRKLKDIKKKSI 291

>Scas_663.2
          Length = 304

 Score =  286 bits (731), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (80%), Gaps = 10/204 (4%)

Query: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62
           +SD+++W +IN  FC+ +IK+  GQTF RDPYNVTGL TRQSCPLANSKYATVR   DKG
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVR--ADKG 58

Query: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122
           R+YL +KTPERAHTPAK+W+RI+LS NYSKALKQIDEHL++W  FF+H+CKQR+ KL+Q+
Sbjct: 59  RIYLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQV 118

Query: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182
            + ERR   L M  E++  VG+APKVKRRE NRERKAL AAKIE++I KELL+RLKSGAY
Sbjct: 119 AITERR---LAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAY 175

Query: 183 SNADKTLTPLNVDENIWNKIMGKL 206
            +      PLNVDE IW K++G L
Sbjct: 176 GD-----KPLNVDEKIWKKVLGHL 194

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  276 bits (707), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 174/248 (70%), Gaps = 10/248 (4%)

Query: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62
           +SD+++W +IN  FC+ +IK   GQ F R+ YNVTGL TRQSCPLANSKYATV+   D G
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVK--CDNG 58

Query: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122
           +LYL +KTPERAHTPAK+W+RI+LS NY+KAL+QIDEHL++W+KFF H+CKQR+ KL+Q+
Sbjct: 59  KLYLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQV 118

Query: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182
            + ERR   L +  E++  VG+APKVKRRE NRERKALVAAKIE++I KEL++RLKSGAY
Sbjct: 119 MITERR---LALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAY 175

Query: 183 SNADKTLTPLNVDENIWNKIMGKLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVD 242
            +      PLNVDE +W KIMG++                                  VD
Sbjct: 176 GD-----KPLNVDEKVWKKIMGQMEEENSQDEEEDWDEEEESDDGEVEYVADDGEGEYVD 230

Query: 243 LDNLEKWL 250
           +D+LEKWL
Sbjct: 231 VDDLEKWL 238

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  271 bits (693), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 132/204 (64%), Positives = 161/204 (78%), Gaps = 10/204 (4%)

Query: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62
           +SD+++W +IN  FCA K+KT  GQTF R+ YNVTGL +RQSCPLANSKYATV+   + G
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVK--SENG 58

Query: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122
           RLYL I+T ERAHTPAK W++IRLS NYSKALKQID+HL+YWNKF +H+CKQR+ KL+Q+
Sbjct: 59  RLYLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQV 118

Query: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182
            + ERR   L M   ++  VG+APKVKRRE NRERKAL AAKIE+SI KELL+RLKSGAY
Sbjct: 119 AITERR---LAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAY 175

Query: 183 SNADKTLTPLNVDENIWNKIMGKL 206
            +      P+NVDE IW K+MG L
Sbjct: 176 GD-----KPMNVDEKIWKKVMGHL 194

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  263 bits (672), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 157/204 (76%), Gaps = 10/204 (4%)

Query: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62
           +SD++IW +IN  FCA K+KT  GQ F R+ YNVTGL +RQ+CPLANSKYATV+     G
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVD--G 58

Query: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122
            LYL +KT ERAHTPAK+W+R++LS NY+KAL QIDEHL+YWNKF +H+CKQR  KL+Q+
Sbjct: 59  TLYLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQV 118

Query: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182
            + ERR   L +  E++  VGIAPKVKRRE NRERKAL AAKIE++I KELL RLKSG Y
Sbjct: 119 MITERR---LALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVY 175

Query: 183 SNADKTLTPLNVDENIWNKIMGKL 206
            +      PLNVDE IW K+MG++
Sbjct: 176 GD-----KPLNVDEKIWKKVMGRV 194

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  259 bits (662), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 158/206 (76%), Gaps = 10/206 (4%)

Query: 1   MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGD 60
           + +SD++IW +IN  FCA KIKT  GQ F R+ YNVTG   R SCPLAN+KYATV++   
Sbjct: 20  LPMSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVD- 78

Query: 61  KGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLS 120
            G+LYL +KT ERAHTPAK+W+RIRLS NYS ALKQIDEHL++WNKF +H+CKQR  KL+
Sbjct: 79  -GKLYLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLT 137

Query: 121 QIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSG 180
           Q+ + ERR   + +  E++  VG+APKVKRR+ NRERKAL AAKIE++I KELL+RLKSG
Sbjct: 138 QVMITERR---MALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSG 194

Query: 181 AYSNADKTLTPLNVDENIWNKIMGKL 206
           AY +      PLNVDE IW ++MG +
Sbjct: 195 AYGD-----KPLNVDEKIWKRVMGHV 215

>Kwal_26.7082
          Length = 299

 Score =  246 bits (629), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 124/204 (60%), Positives = 155/204 (75%), Gaps = 10/204 (4%)

Query: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62
           +SD++IW +IN  FCA K+KT  GQ F R+ YNVTGL  RQSCPLAN+KYATV+     G
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVD--G 58

Query: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122
           RLYL +KT ERAHTPAK+W+RIRLS NY+KAL Q+D+HL+YWNKF +H+CKQR  +L+QI
Sbjct: 59  RLYLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQI 118

Query: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182
            + ERR    +    ++  VG+APKVKRR+ NRERKAL AAKIE++I KELL RLKSGAY
Sbjct: 119 AVTERRMELREE---ERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAY 175

Query: 183 SNADKTLTPLNVDENIWNKIMGKL 206
            +      PLNVDE IW K++G +
Sbjct: 176 GD-----KPLNVDEKIWKKVLGHV 194

>KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c singleton, start by similarity
          Length = 277

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 47/121 (38%), Gaps = 26/121 (21%)

Query: 104 WNKFFLHRCKQRYVKLSQIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRE--RKALV 161
           W  FF       YV    I LV    LKL  N  +KR+     KV+ ++         LV
Sbjct: 135 WFTFFF-----LYVLAGVIHLV---LLKLHNNANKKRIENFVAKVREQDTTNSLGESKLV 186

Query: 162 AAKIEESISKELLNRLKSGAYSNADKTLTPLNVDEN----------------IWNKIMGK 205
             + E+S  K+LL R         D++L  ++ D+                 IWNK +GK
Sbjct: 187 FKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGK 246

Query: 206 L 206
            
Sbjct: 247 F 247

>KLLA0E23166g complement(2056949..2059129) some similarities with
           sp|P38308 Saccharomyces cerevisiae YBR203w hypothetical
           protein singleton, hypothetical start
          Length = 726

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 100 HLMYWNKFFLHRCKQRYVKLSQIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKA 159
           HL + NKFFL     R + L  I  +    L + +       + ++P  +  E+  +R  
Sbjct: 375 HLPFTNKFFLKYAHLRDLPLGYI--IHLLTLCVNLKSINLSNLSLSPDFEIEELEYKRNG 432

Query: 160 LVAAKIEESISKELLNRLKSGAYSNADKTLTP 191
            V+   EE+  +E LN L +    N D+ LTP
Sbjct: 433 YVSFFPEET-EEENLNGLNT---FNGDRELTP 460

>Sklu_2280.6 YFR002W, Contig c2280 8908-11457 reverse complement
          Length = 849

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 124 LVERRQLKLQMNGEQKRLVGIAPKVKRR--EMNRERKALVAAKIEES--ISKELLNRLKS 179
           ++E RQ  L +N E++ L  I  +  RR  E  R   +L+  ++ E   I   ++N+L  
Sbjct: 613 IIEERQSLLYLNDEKEFLHKITEQAARRADEDGRIYDSLLLYQLSEEYDIVIFIVNKLLG 672

Query: 180 GAYSNADKTLTPLNVDEN 197
              SN D     LN+D+N
Sbjct: 673 ELLSNTDLDQPLLNIDDN 690

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,718,345
Number of extensions: 287378
Number of successful extensions: 913
Number of sequences better than 10.0: 23
Number of HSP's gapped: 890
Number of HSP's successfully gapped: 23
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)