Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00693g45544822720.0
YOR323C (PRO2)45644918070.0
Scas_663.345744917670.0
Sklu_2164.250844817700.0
KLLA0A03982g44744816650.0
Kwal_26.706745744816560.0
ADR351C45244516360.0
Scas_701.6551123770.20
KLLA0C08107g542211770.21
ADL066C560118760.29
Scas_717.74522141730.63
CAGL0H04477g1626113701.5
AGR112C62345691.9
YFR025C (HIS2)33584673.0
Sklu_1839.246871656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00693g
         (448 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   879   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   700   0.0  
Scas_663.3                                                            685   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         686   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   645   0.0  
Kwal_26.7067                                                          642   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   634   0.0  
Scas_701.6                                                             34   0.20 
KLLA0C08107g 710617..712245 gi|21724727|gb|AAM75421.1 Kluyveromy...    34   0.21 
ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH] (563788..56...    34   0.29 
Scas_717.74                                                            33   0.63 
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    32   1.5  
AGR112C [4423] [Homologous to ScYER173W (RAD24) - SH] (948295..9...    31   1.9  
YFR025C (HIS2) [1705] chr6 complement(203731..204738) Histidinol...    30   3.0  
Sklu_1839.2 YDR190C, Contig c1839 2207-3613 reverse complement         30   6.4  

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/448 (96%), Positives = 434/448 (96%)

Query: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60
           MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL
Sbjct: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60

Query: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120
           ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV
Sbjct: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180
           IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180

Query: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240
           QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL
Sbjct: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240

Query: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300
           EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK
Sbjct: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300

Query: 301 KLQDSGKLNXXXXXXXXXXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360
           KLQDSGKLN              FDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII
Sbjct: 301 KLQDSGKLNDDIKAKIVDAKDGDFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360

Query: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420
           TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY
Sbjct: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420

Query: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           QYQIRGDGQVASDYLGAGGNKAFVHKDI
Sbjct: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDI 448

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/449 (76%), Positives = 383/449 (85%), Gaps = 1/449 (0%)

Query: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60
           MSS+++IAK AR AGN+LKTIS+E RS ILY+I DAL      IE ANK DL  A+  GL
Sbjct: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60

Query: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120
           ADSL+KRLDLFKGDKF+VMLQGI DVA+LEDPVGKVKMARE+D+GL LYQVTAPVGV+LV
Sbjct: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKESVNTF+ MAK+VN TI Q++ ETGVPVG+V
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180

Query: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240
           QLIETRQDVSDLL QDEYIDLVVPRGSN+LVR+IKD+TKIPVLGHADGICSIY+D DADL
Sbjct: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240

Query: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300
            KAKRI LDAKTNYPAGCNAME LL+NP FS+W +VL +L  EGGVTIHAT D+K A+  
Sbjct: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300

Query: 301 KLQDSGKLNXXXXXXXX-XXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAI 359
           KL + GKL                FDKEFLSLD A KF+ +T  AI HIN HSS+HTDAI
Sbjct: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360

Query: 360 ITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 419
           +TE+K +AEKF+KG+DSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+
Sbjct: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420

Query: 420 YQYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           YQYQIRGDGQVASDYLGAGGNKAFVHKD+
Sbjct: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449

>Scas_663.3
          Length = 457

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/449 (73%), Positives = 384/449 (85%), Gaps = 1/449 (0%)

Query: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60
           MSSA++IA++AR+AGN LKTIS++NRS ILY+IRDAL     +IE+ANK DL+ A+   L
Sbjct: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60

Query: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120
           +DSL+KRLDLFKGDKF+ MLQGI DVADLEDPVGK+KMARE+D GL LYQVTAPVGV+LV
Sbjct: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180
           IFESRPEVIANITALCIKSGNAGILKGGKESVNTF+ M++++N TIE+ + ETGVPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180

Query: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240
           QLIETRQDV+DLL QDEYIDLVVPRGSN+LVR IK+STKIPVLGHADGICS+Y+D +ADL
Sbjct: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240

Query: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300
           EKAKRIV DAKTNYPAGCNAME LL+NP    W +VL ++  +G VT+H   DVK+A+L 
Sbjct: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300

Query: 301 KLQDSGKL-NXXXXXXXXXXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAI 359
           KL   G   +              FDKEFLSLDCAVKF+ +T +AI HIN HSS+HTDAI
Sbjct: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360

Query: 360 ITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 419
           +TE+K+ AE FLKG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+
Sbjct: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420

Query: 420 YQYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           YQYQIRG+GQ+A DYLGAGGN+AF+HKD+
Sbjct: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDL 449

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/448 (74%), Positives = 378/448 (84%), Gaps = 1/448 (0%)

Query: 2   SSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLA 61
           S+AEKIA++AR+AGN+LKT+SDE RSKILY I D L    + IE ANK DL+ A+   L+
Sbjct: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113

Query: 62  DSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVI 121
           DSL+KRLDLFKGDKF+ MLQGI DVA+LEDPVGK+KMARE+D  L LYQVTAPVGV+LVI
Sbjct: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173

Query: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQ 181
           FESRPEVIANITAL IKSGNA ILKGGKESVNTF+ M++++N  I + +  TGVP GAVQ
Sbjct: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233

Query: 182 LIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLE 241
           LIETRQDVSDLL QD YIDLVVPRGSN+LVRQIK STKIPVLGHADGICSIY+D DADLE
Sbjct: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293

Query: 242 KAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKK 301
           KAKRI LDAKTNYPAGCNA+E +L+NP    W +VL +L  EG V +H T DVKEA++ K
Sbjct: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353

Query: 302 LQDSGKLNXXXXXXXXXXXXXX-FDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360
           L+++GKL+               FDKEFLSLDCAVKF+ +T +A+ HIN HSSKHTDAII
Sbjct: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413

Query: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420
           TE+KEDAE FLKG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473

Query: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           QYQIRG GQVASDYLGAGGNKAF+HKD+
Sbjct: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDL 501

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/448 (70%), Positives = 363/448 (81%), Gaps = 8/448 (1%)

Query: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60
           MS +E IAK AR AGN+LKT+SDE RS ILY+I D L      IE+ANK DLEQA++  L
Sbjct: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60

Query: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120
           +DSLVKRLDLFKGDKF+ MLQGI DVA+L+DPVGKV  AREID  L LYQ+TAPVGV+LV
Sbjct: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKES+NTFK M+++VN  +EQ +  T VPVGAV
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180

Query: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240
           QLIETR+DVSDLL QDEYIDLV+PRGSN+LVRQIK STKIPVLGHADGICSIYVD  AD+
Sbjct: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240

Query: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300
            KAKRI++DAKTNYPAGCNA+E LL+NP    W +VL+ LI E GVT+H + +VK+ + +
Sbjct: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLI-ENGVTLHVSKEVKKQYKE 299

Query: 301 KLQDSGKLNXXXXXXXXXXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360
                   N              FDKEFLSLD AV F+ +T  A+ HIN HSSKHTDAI+
Sbjct: 300 H-------NSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIV 352

Query: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420
           TE+ E+AE FLK +DSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY
Sbjct: 353 TENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 412

Query: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           QYQ+RG+GQ+ASDYLGAGG KAFVHKD+
Sbjct: 413 QYQLRGNGQIASDYLGAGGKKAFVHKDL 440

>Kwal_26.7067
          Length = 457

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/448 (68%), Positives = 366/448 (81%), Gaps = 1/448 (0%)

Query: 2   SSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLA 61
           S++E IAK AR+ GNVLKTIS+E RS +LY+I D L    + I+ ANK+DLE A+   LA
Sbjct: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62

Query: 62  DSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVI 121
           DSL +RLDLFKGDKFD ML GI DVA+LEDPVGK+K+ARE+D  L LYQVTAPVG +LVI
Sbjct: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122

Query: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQ 181
           FESRPEVIANIT+L IKSGNA ILKGGKESV+TF+ +++++N  I + +  +G+P   +Q
Sbjct: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182

Query: 182 LIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLE 241
           LIETRQDVSDLL QD YIDLVVPRGSN LVR+IK STKIPVLGHADGICSIY+D +ADL+
Sbjct: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242

Query: 242 KAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKK 301
           KA RI +DAKT+YPAGCNAME LL+NP  SQW  VL +L   G VT+H T DVK ++  K
Sbjct: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302

Query: 302 LQDSGKL-NXXXXXXXXXXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360
           L +S +L +              FDKEFLSLDCAVKF+ +T DA++HIN HSSKHTDAII
Sbjct: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362

Query: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420
           TE+K +AE F+KG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422

Query: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDI 448
           QYQ+RGDGQ+ASDY+G+GG +AFVHK++
Sbjct: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNL 450

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/445 (69%), Positives = 362/445 (81%), Gaps = 4/445 (0%)

Query: 4   AEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLADS 63
           AE IAK+ARVAGNVLKT+S+E R+ +L RI D L   K++I  AN+ DLE A    LA +
Sbjct: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64

Query: 64  LVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVIFE 123
           LV+RL+LFKGDKF+ MLQGI DVA LEDPVGK++M RE+D GL LY+VTAPVGV+L+IFE
Sbjct: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124

Query: 124 SRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQLI 183
           SRPEVIANI+ALCIKSGNAGILKGGKE+VNTF+ +A V+N  + + + ETGVPV AVQL+
Sbjct: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184

Query: 184 ETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLEKA 243
           E+R +VSDLL QDEYIDLVVPRGSN+LV+QIK STKIPVLGHADGICSIY+D DADL KA
Sbjct: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADADLAKA 244

Query: 244 KRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKKLQ 303
           KRIVLD+KTNY A CNA E LL+NP  S W++VL HLI  G V +H T+DVKEAF     
Sbjct: 245 KRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAYAG 304

Query: 304 DSGKLNXXXXXXXXXXXXXXFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAIITES 363
           D   L               F +EFLSLD AVKFI +  +A+ HINEHSSKHTDAI+TE 
Sbjct: 305 DDAALK----GNVVDAEEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTEC 360

Query: 364 KEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 423
           K+ A+ FLKGIDS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ
Sbjct: 361 KQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 420

Query: 424 IRGDGQVASDYLGAGGNKAFVHKDI 448
           +RG GQVASDY+GAGG++AFVHKD+
Sbjct: 421 VRGTGQVASDYIGAGGDRAFVHKDL 445

>Scas_701.6
          Length = 551

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 159 AKVVNQTIEQYKDETGVPVGAVQLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDST 218
           A    + I ++  + G P+      E R     LLG D Y +   PR    L R  +  T
Sbjct: 328 AATKQEIINKFNAKVG-PLTETSNKEARAIAKQLLGHDIYFNWETPRVREGLYR-YRGGT 385

Query: 219 KIPVL---GHADGICSIYVDRD-ADLEKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWD 274
           +  V+     AD    ++++ +  D E+AK      K  YP   N      L+P F+ W 
Sbjct: 386 QCAVMRARAFADYADLVWMESNYPDYEQAKEFAEGVKAKYP---NQWLAYNLSPSFN-WT 441

Query: 275 DVL 277
           +V+
Sbjct: 442 NVM 444

>KLLA0C08107g 710617..712245 gi|21724727|gb|AAM75421.1 Kluyveromyces
           lactis isocitrate lyase 1, start by similarity
          Length = 542

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 80/211 (37%), Gaps = 37/211 (17%)

Query: 166 IEQYKDETGVPVGAVQLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVL-- 223
           I+Q+  +   P+    + E +    +LLG + + D  +PRG   L R  +  T+  V+  
Sbjct: 330 IDQFNSKVN-PLSETSIYEMQALAKELLGTELFFDWDLPRGREGLYR-YQGGTQCSVMRA 387

Query: 224 ----GHADGICSIYVDRDADLEKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHH 279
                +AD +C +  +   D E+AK         +P    A     L+P F+ W   +  
Sbjct: 388 RAFAPYAD-LCWMESNY-PDYEQAKEFAEGVTAKFPGKWMAYN---LSPSFN-WTKAM-- 439

Query: 280 LITEGGVTIHATTDVKEAFLKKLQDSG---KLNXXXXXXXXXXXXXXFDKEFLSL----- 331
                      + D +E F+++L D G   +                F K F  L     
Sbjct: 440 -----------SVDEQETFIQRLGDLGYIWQFITLAGLHTSGLAIEQFSKNFAKLGMKAY 488

Query: 332 --DCAVKFIPNTVDAINHINEHSSKHTDAII 360
             D   K + N +D + H     +++ D ++
Sbjct: 489 AQDIQKKELDNGIDMVKHQKWSGAEYIDGLL 519

>ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH]
           (563788..565470) [1683 bp, 560 aa]
          Length = 560

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 14/118 (11%)

Query: 166 IEQYKDETGVPVGAVQLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVL-- 223
           I ++  + G   GA  + E R+   +LLGQD Y D  +PR    L R  K  T+  ++  
Sbjct: 341 IAKFNSQIGPQTGA-SIREMRKLGRELLGQDVYFDWDLPRAREGLYR-YKGGTQCAIMRA 398

Query: 224 ----GHADGICSIYVDRDADLEKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVL 277
                +AD +   +     D ++AK      +  +P   N      L+P F+ W   +
Sbjct: 399 RAFAPYADLVW--FESNFPDFQQAKEFAQGVREKFP---NKWMAYNLSPSFN-WPKAM 450

>Scas_717.74
          Length = 522

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 15/141 (10%)

Query: 134 ALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQLIETRQDVSDLL 193
           A  I +GN+ ILK  + + +T   M +++        +E G P G VQ+++   D +  L
Sbjct: 145 AHAIGAGNSVILKPSERTAHTALVMQRII--------EEAGFPDGLVQVVQGAIDETQRL 196

Query: 194 GQDEYIDLVVPRGS---NSLVRQIKDSTKIPVLGHADGICSIYVDR---DADLEKA-KRI 246
              + +D++   GS    S++ Q       P +    G    ++     D +L+ A KRI
Sbjct: 197 ITSKDLDMIFYTGSPTVGSIIAQEAAKNLTPCVLELGGKSPTFITENFNDKNLKTALKRI 256

Query: 247 VLDAKTNYPAGCNAMEGLLLN 267
              A  N    C + + LL++
Sbjct: 257 FFGAFGNSGQICVSPDYLLVH 277

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 20/113 (17%)

Query: 41   KDEIESANKEDLEQARAGGLADSLVKRLDLFKGDKFDV---------MLQGISDVADL-- 89
            +D+++    E +E+ R  G+      ++ +  GDK +          ++   S V  L  
Sbjct: 1029 EDKLQEGVSEAIEKIRRAGI------KMWMLTGDKRETAINIGYSCKLIHDYSTVVILTT 1082

Query: 90   --EDPVGKVK-MAREIDNGLMLYQVTAPVGVILVIFESRPEVIANITALCIKS 139
              E+ + K+  +++E+D+G + + V    G  L +FE  P +++  T LC K+
Sbjct: 1083 SDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKT 1135

>AGR112C [4423] [Homologous to ScYER173W (RAD24) - SH]
           (948295..950166) [1872 bp, 623 aa]
          Length = 623

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 129 IANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDET 173
           IA +   C  +G++G+  G + S+N F A+ KV+  + +   DET
Sbjct: 288 IAALQFWCHSAGSSGLALGRESSLNYFHAIGKVIYGSKDTTDDET 332

>YFR025C (HIS2) [1705] chr6 complement(203731..204738) Histidinol
           phosphatase [1008 bp, 335 aa]
          Length = 335

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 118 ILVIFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPV 177
           +L  F+S+ E++ NI  L +  G+  + K        F     +VNQ      +ETGVPV
Sbjct: 159 LLSYFQSQYEMLINIKPLVV--GHFDLYK-------LFLPNDMLVNQKSGNCNEETGVPV 209

Query: 178 GAVQLIETRQDVSDLLGQD-EYID 200
            ++ +I    ++ D + ++ ++ID
Sbjct: 210 ASLDVISEWPEIYDAVVRNLQFID 233

>Sklu_1839.2 YDR190C, Contig c1839 2207-3613 reverse complement
          Length = 468

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 182 LIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQI-KDSTKIPVLGHADGICSIYVDRDADL 240
           +IE R  + +L  +   +DL+   G+ + +R + +  +   +L H  G   I V+   D+
Sbjct: 388 IIEKRSTIENLQLEPAALDLLATMGTETSLRYVLQLLSPSGILAHTAGRTGINVN---DV 444

Query: 241 EKAKRIVLDAK 251
           E+AK + LDAK
Sbjct: 445 EEAKMLFLDAK 455

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,673,474
Number of extensions: 591533
Number of successful extensions: 1706
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1734
Number of HSP's successfully gapped: 24
Length of query: 448
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 343
Effective length of database: 12,961,219
Effective search space: 4445698117
Effective search space used: 4445698117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)