Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0F00671g1566154279460.0
YOR326W (MYO2)1574155761190.0
Scas_663.261567155259990.0
Kwal_26.70551555154654030.0
ADR354W1558154652630.0
KLLA0A03905g1550154350570.0
Sklu_2164.51350136748050.0
Scas_592.13*1419150335020.0
YAL029C (MYO4)1471151334100.0
CAGL0G06336g141892128380.0
Scas_688.22187682113321e-155
Kwal_23.5534190775012851e-148
ACR068W180572712721e-147
YHR023W (MYO1)192876112741e-147
KLLA0E11572g184876112721e-147
CAGL0J00693g188479512131e-138
KLLA0B12562g126075011781e-138
Kwal_26.7587125075811541e-134
YMR109W (MYO5)121975711501e-134
Scas_721.119123273111341e-132
CAGL0K07590g125276111261e-130
CAGL0K03487g121775611151e-129
AEL306C129279611191e-129
YKL129C (MYO3)127175410991e-127
ABR111C78972910.025
KLLA0E17193g666102733.0
YDR303C (RSC3)88539723.8
Kwal_33.146591678105724.3
Kwal_23.384078471697.5
CAGL0K04037g189798698.3
AAL093C734112699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F00671g
         (1542 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  3065   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  2361   0.0  
Scas_663.26                                                          2315   0.0  
Kwal_26.7055                                                         2085   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2031   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1952   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1855   0.0  
Scas_592.13*                                                         1353   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1318   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1097   0.0  
Scas_688.22                                                           517   e-155
Kwal_23.5534                                                          499   e-148
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   494   e-147
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   495   e-147
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   494   e-147
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   471   e-138
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   458   e-138
Kwal_26.7587                                                          449   e-134
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   447   e-134
Scas_721.119                                                          441   e-132
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   438   e-130
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   434   e-129
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   435   e-129
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   427   e-127
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    40   0.025
KLLA0E17193g 1523750..1525750 gi|586045|sp|Q08400|ST12_KLULA Klu...    33   3.0  
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    32   3.8  
Kwal_33.14659                                                          32   4.3  
Kwal_23.3840                                                           31   7.5  
CAGL0K04037g 372546..378239 tr|Q9P8N8 Candida glabrata 1, 3-beta...    31   8.3  
AAL093C [94] [Homologous to ScYPL164C (MLH3) - SH] (177137..1793...    31   9.2  

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 3065 bits (7946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1487/1542 (96%), Positives = 1487/1542 (96%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD
Sbjct: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300
            TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG
Sbjct: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300

Query: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360
            GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS
Sbjct: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360

Query: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420
            DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF
Sbjct: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRST 660
            LINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRST
Sbjct: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRST 660

Query: 661  NAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 720
            NAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL
Sbjct: 661  NAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 720

Query: 721  LPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRS 780
            LPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRS
Sbjct: 721  LPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRS 780

Query: 781  DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQS 840
            DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQS
Sbjct: 781  DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQS 840

Query: 841  LLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFL 900
            LLRGY              CIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFL
Sbjct: 841  LLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFL 900

Query: 901  EDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAKVKEN 960
            EDRRKTVVVQSLIRRRF             SVNHLKEVSYKLENKVVELTQNLAAKVKEN
Sbjct: 901  EDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKVKEN 960

Query: 961  KSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQV 1020
            KSLSARVV                KQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQV
Sbjct: 961  KSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQV 1020

Query: 1021 EEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQ 1080
            EEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQ
Sbjct: 1021 EEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQ 1080

Query: 1081 TQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDSY 1140
            TQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDSY
Sbjct: 1081 TQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDSY 1140

Query: 1141 ASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARILI 1200
            ASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARILI
Sbjct: 1141 ASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARILI 1200

Query: 1201 IILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFAQ 1260
            IILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFAQ
Sbjct: 1201 IILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFAQ 1260

Query: 1261 HSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAVV 1320
            HSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAVV
Sbjct: 1261 HSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAVV 1320

Query: 1321 LSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTTL 1380
            LSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTTL
Sbjct: 1321 LSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTTL 1380

Query: 1381 LNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKLL 1440
            LNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKLL
Sbjct: 1381 LNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKLL 1440

Query: 1441 QVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVXXXXXXX 1500
            QVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIV       
Sbjct: 1441 QVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVKSEASLS 1500

Query: 1501 XXXXXPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
                 PTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA
Sbjct: 1501 ASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 2361 bits (6119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1164/1557 (74%), Positives = 1309/1557 (84%), Gaps = 21/1557 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            MSFEVGTRCWYP KELGWIGAEV KN+  DG YH+EL LED + V+++TKDL ++ D+SL
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAGK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEEENS TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD
Sbjct: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300
            TSIIGA+IRTYLLERSRLVYQP  ERNYHIFYQ+MAGL  + K ELHL  A DY+YMNQG
Sbjct: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300

Query: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360
            GD KI G+DD +EY  TVDALTLVGI+ ETQ  IFKILAALLHIGNIEIKKTRNDASLS+
Sbjct: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360

Query: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420
            DE NLK+ACELLGID++NFAKW+TKKQIITRSEKIVSNLNYSQALVA+DSVAKFIYSALF
Sbjct: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLVENINTVLCNPAV D+++SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDK PTNKVFSKPRFGQTKF+VSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINILDTLERNANKLEDAKKAE-QESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRS 659
            LINIL+ LE+ A KLE+AKK E +++   KPGP+RTV RKPTLGSMFKQSLIELM TI S
Sbjct: 601  LINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660

Query: 660  TNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYI 719
            TN HYIRCIKPN DKEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF EF+LRYYI
Sbjct: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720

Query: 720  LLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLR 779
            L+P  +W  IF KK+ TE+D+I +   IL  TVK+K KYQIGNTKIFFKAGMLA+LEKLR
Sbjct: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780

Query: 780  SDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQ 839
            S+KMH S V+IQK IRAKYYR+++L+I  AI  LQ  +KG + R  ++ E K   AT +Q
Sbjct: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840

Query: 840  SLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAF 899
            +  RG+               +Q K+RKEL ++  + +HE +AAV IQSKVR+F+PR  F
Sbjct: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900

Query: 900  LEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAKVKE 959
            L  ++ TVVVQSLIRRR              SVNHLKEVSYKLENKV+ELTQNLA+KVKE
Sbjct: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960

Query: 960  NKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQ 1019
            NK ++ R+                 + +K +H  ++  QK    E  K IE  L +    
Sbjct: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQT 1020

Query: 1020 VEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRL 1079
            +++ + +L D+ ++++E K  +K  LEELE+TK  L+E QT N DLQNEV SLKEE++RL
Sbjct: 1021 LKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEEIARL 1080

Query: 1080 QTQISLGTVTANVLPQTPSKDIHMQRNVTN-------GTDIGPGSELNVRPVNSKDAGSV 1132
            QT +SLGTVT +VLPQTP KD+ M    +N        +D+ P ++LN++   S+   S 
Sbjct: 1081 QTAMSLGTVTTSVLPQTPLKDV-MGGGASNFNNMMLENSDLSP-NDLNLK---SRSTPSS 1135

Query: 1133 SNMGMDSYASDS----NALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLS 1188
             N  +DS + D     NA TQINEEL+RLLED E+LN EIT+GLLK FEVP AGV +QLS
Sbjct: 1136 GNNHIDSLSVDRENGVNA-TQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLS 1194

Query: 1189 RRDVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLAN 1248
            +RDVVYPARILII+LSEMWRFGLTKQSE FLAQVLTTIQKVVT LKGNDLIP+G FWLAN
Sbjct: 1195 KRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLAN 1254

Query: 1249 VRELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQ 1308
            VRELYSFVVFA +SILTEE+FK+GMTD+EYKEYVSLVTELK+DFE+LSYNIYNIWLKKLQ
Sbjct: 1255 VRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQ 1314

Query: 1309 RELQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQI 1368
            ++LQKKA+NAVV+SE+LPGFSAG++ G LNKIF++ EEYTMDDILTFFNSIYW MKSF I
Sbjct: 1315 KQLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHI 1374

Query: 1369 ENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTD 1428
            ENEVFH VVTTLLNYVDAICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG+ DGT+
Sbjct: 1375 ENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTE 1434

Query: 1429 CLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKY 1488
            CLQHLIQT+KLLQVRKY+IEDIDILRGIC SLTPAQLQKLI+QYQVADYESPIPQEIL+Y
Sbjct: 1435 CLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRY 1494

Query: 1489 VADIVXXXXXXXXXXXXPT---HSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
            VADIV                 HS+ IFITPETGPF DPF+ I+T KFDQVEAYIPA
Sbjct: 1495 VADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEAYIPA 1551

>Scas_663.26
          Length = 1567

 Score = 2315 bits (5999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1139/1552 (73%), Positives = 1298/1552 (83%), Gaps = 18/1552 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            MSFEVGTRCWYPSKE GWIGAEVTKNDLKDGTY MEL LED + VN+ETKDLT+E D SL
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+GK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSMT---VQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FAS +EENS     +QH  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297
            DK+T+IIGAK+RTYLLERSRLVYQP+TERNYHIFYQ++AGL    K ELHL  A+DY+YM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357
            NQGG+ +I G+DD  EY  T+ ALTLVG++ ETQQHIFKILAALLHIGNIEIKKTRND+S
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417
            LSSDE NLKIACELLG+D  NFAKWITKKQI+TRSEKIVSNLNYSQALVARDSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLV NINTVLCNPAV+D++ SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEY+KE+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 598  NETLINILDTLERNANKLEDAKK--AEQESKP-AKPGPMRTVQRKPTLGSMFKQSLIELM 654
            N+TL  IL+++E +A K+E+AKK  A Q+ K   KP P+R VQRKPTLGSMFK SLIELM
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660

Query: 655  TTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 714
             TI STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI
Sbjct: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720

Query: 715  LRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF 774
            LRYYIL+P  EW+ IF K D+TE DVI LC KILA TV++KEKYQIGNTKIFFKAGMLA+
Sbjct: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780

Query: 775  LEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKA 834
             EKLRS KM+ + VLIQK+IR+KYYR++++ + ++++ L    KG V R  ++ E +  A
Sbjct: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840

Query: 835  ATEIQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFK 894
            AT IQ++ RGY               +Q ++R+EL ++  Q ++E++AA++IQS++R+F 
Sbjct: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900

Query: 895  PRKAFLEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLA 954
            PRKA+   RR T+VVQSLIRRR              SV+HLKEVSYKLENKV++LTQNLA
Sbjct: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960

Query: 955  AKVKENKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELN 1014
            AKVKEN+ LS R+                 +  K ++   L +QKD F    K ++++L 
Sbjct: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020

Query: 1015 AANLQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKE 1074
             AN  VE  K +L  LT +Y E +A +K+ L+ELE+TK  L E +T NSDL +E+ SLKE
Sbjct: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080

Query: 1075 ELSRLQTQISLGTVT--ANVLPQTPSKDIHMQRNVTNGTD--IGPGSELNVRPVNSKDAG 1130
            EL+ LQT I+LGTVT   N++P TPS++  M        +  I P    ++    + D  
Sbjct: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140

Query: 1131 SVSNMGMDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRR 1190
            SV+  GMD    ++N LTQINEEL+RLLE  +VLNNEIT+GLLK F+VP AGV +QLSRR
Sbjct: 1141 SVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSRR 1200

Query: 1191 DVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVR 1250
            DVVYPARILII+LSEMWRFGLTKQSE FLAQVLTTIQKVVTTLKG DLIP+GAFWLANVR
Sbjct: 1201 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANVR 1260

Query: 1251 ELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRE 1310
            ELYSFVVFAQHSILTEESFK GM D+EY EYVSLVTELKEDFESLSYNIYNIWLKKLQ++
Sbjct: 1261 ELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLKKLQKD 1320

Query: 1311 LQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIEN 1370
            LQKKA+NAVV+SE+LPGF+A +S G LNKIF+SGEEYTMDDILTFFN+I+W MKSF IEN
Sbjct: 1321 LQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIEN 1380

Query: 1371 EVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCL 1430
            EVF  V+ TLLNYVD ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG+PDG   L
Sbjct: 1381 EVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYL 1440

Query: 1431 QHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVA 1490
            QHLIQT+KLLQ+RKY+IEDID++RGICSSL+PAQLQKLI+QY VADYESPIPQ+ILKYVA
Sbjct: 1441 QHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVA 1500

Query: 1491 DIVXXXXXXXXXXXXPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
            DIV             +  NDIF+ PETGPFNDPF  ++T KFDQVEAYIP+
Sbjct: 1501 DIVKKEST--------SAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPS 1544

>Kwal_26.7055
          Length = 1555

 Score = 2085 bits (5403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1013/1546 (65%), Positives = 1223/1546 (79%), Gaps = 22/1546 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTK-NDLKDGTYHMELALEDGKSVNIETKDLTDESDES 59
            MSFEVGTRCWYP K+ GW+G+EVTK +  ++G + +EL LE+G++V IET+ L +  +E 
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMR 179
            YSQDMIQAYAG++RGE+EPHLFAIA+EAYRLMK +K+NQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVEEENS--MTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            YFASVE+ N+   +  H ++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297
            D+ TSIIGA+IRTYLLERSRLV+QP+ ERNYHIFYQ++ GLS  EK ELHL   EDY+Y+
Sbjct: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300

Query: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357
             QGGD +I+GVDD  EY  TVDAL +VG S +TQ  +FKILAALLHIGNIE+KKTRNDAS
Sbjct: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360

Query: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417
            LSSDE NLKIAC+LLGID+  F+KWITKKQI TRSEKIVSNL+++QALVARDSVAKFI+S
Sbjct: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420

Query: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLVENINTVLCNP V D+++SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYV EQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYALDVAYDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600

Query: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTI 657
            N+TL++ILDT+++NA  L     AE++    KPGP R V +KPTLGSMFKQSLIELM TI
Sbjct: 601  NDTLLSILDTIDKNAAAL-----AEKQDANKKPGPARMV-KKPTLGSMFKQSLIELMNTI 654

Query: 658  RSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRY 717
             STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+LRY
Sbjct: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714

Query: 718  YILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEK 777
            +IL+P+  W+ IFT  + +EDD+  LC +IL  TV +  KYQ+GNTKIFFKAGMLA+LEK
Sbjct: 715  HILIPSDNWTKIFT-SEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEK 773

Query: 778  LRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATE 837
            LRS KMH S VLIQK I+  YYR+++L I +AI ++Q  + G   R  +D EFK  AA  
Sbjct: 774  LRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAIS 833

Query: 838  IQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRK 897
            +Q++ RG                +Q  VRK++ +K    + +++AAV IQ K+R F PR+
Sbjct: 834  LQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQ 893

Query: 898  AFLEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAKV 957
            ++   R  +V +QSL+RR+              SVNHL+EVSYKLENKV++LTQ+LA KV
Sbjct: 894  SYNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKV 953

Query: 958  KENKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAAN 1017
            KEN+ ++A++                    K  H  +L EQK     +    + EL+ A 
Sbjct: 954  KENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNAK 1013

Query: 1018 LQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELS 1077
             +VE  K ++ DL  + E+ KA  ++ +EEL   + E  + +T NSDL+NEV SLK+E++
Sbjct: 1014 AEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEIN 1073

Query: 1078 RLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGM 1137
            RLQT I  G  +  +L  TP+K      + ++ TD  P  +LNV  +N+         GM
Sbjct: 1074 RLQTSIRSGANSNTILAHTPTKSRRFSAH-SSLTDASP-RQLNVISMNN---------GM 1122

Query: 1138 -DSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPA 1196
             D   S ++AL+QIN+EL+++LED + LN EI +GLLK F++P  GV  +L+R++V+YPA
Sbjct: 1123 EDDARSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPA 1182

Query: 1197 RILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFV 1256
            RI+II+LS+MWR GLTKQSE FLA+ ++TIQK+V+ LKG+D+I  GAFWL NVRELYSFV
Sbjct: 1183 RIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFV 1242

Query: 1257 VFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAV 1316
            VFAQ SIL ++S+ SG+ +DEYKEY++LVTELK+DFESLSYNIYNIWLKKLQ++L+KKAV
Sbjct: 1243 VFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAV 1302

Query: 1317 NAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKV 1376
            +AVV+S++LPGF A +S   L K+FS    Y MDDILTFFN+IYWSMK++ +E EVF +V
Sbjct: 1303 SAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREV 1362

Query: 1377 VTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQT 1436
            + TLL YVD+ICFNDLIM+RNFLSWKRGLQLNYNVTRLEEWCK+H +P+GTDCLQH++Q 
Sbjct: 1363 IITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQA 1422

Query: 1437 SKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVXXX 1496
            SKLLQ++K +++DIDI+  ICSSL PAQ+QKLITQY VADYE PIPQEIL +VA+ V   
Sbjct: 1423 SKLLQLKKANLDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSE 1482

Query: 1497 XXXXXXXXXPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
                      THS DIF+  E GPF DPF  IET +F ++EAYIPA
Sbjct: 1483 SSLSSNGKSQTHSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPA 1528

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2031 bits (5263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 994/1546 (64%), Positives = 1203/1546 (77%), Gaps = 21/1546 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            MS+EVGTRCWYP KE GWIG E+TK+ L    Y ++L LE+G+ V I    + + S E L
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAG++RGE+EPHLFAIAEEAY LMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEEN---SMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FA+VE+ N   S    H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297
            DKD SIIGA+IRTYLLERSRLV+QP +ERNYHIFYQ++AGL  + K EL L G E+Y+YM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357
            NQGG  +I+GVDD++EY  T  AL+LV I+  TQ  +FK+LAALLHIGNI++KKTRNDAS
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417
            +S+ + +L+IACELLGID++NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLVENIN VLCNPAV++++ASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYVKE+I+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGP-MRTVQRKPTLGSMFKQSLIELMTT 656
            NETL+ IL+T++RNA KL     AE+     KPGP  RTV RKPTLGS+FKQSL+ELM+T
Sbjct: 601  NETLLAILETIDRNAAKL-----AEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMST 655

Query: 657  IRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILR 716
            I STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF LR
Sbjct: 656  INSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALR 715

Query: 717  YYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLE 776
            Y+IL+P++ W+ IF     TE+++  LC  IL  TV +KEKYQ+GNTKIFFKAGMLAFLE
Sbjct: 716  YHILVPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLE 774

Query: 777  KLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAAT 836
            K R+DK++ SS +IQK I+  YYRR +L I +AI       KG + R+ ID EFK  AA 
Sbjct: 775  KKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAI 834

Query: 837  EIQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPR 896
             IQSL RG                 Q  +R+ L RK  + + ETDAA+ IQ  +R+FKPR
Sbjct: 835  TIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPR 894

Query: 897  KAFLEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAK 956
             +++ +RR T+VVQSL+RRRF             SV+HLKEVSYKLENKV+ELT++LAAK
Sbjct: 895  TSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAK 954

Query: 957  VKENKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAA 1016
            VKENK L++R+                 K  + ++   + +QKD  A   +++   L  A
Sbjct: 955  VKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLA 1014

Query: 1017 NLQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEEL 1076
              +V++ + ++  L  + E+ K   K+ +EEL K + +L + +T NSDL NEV+SLKEE+
Sbjct: 1015 MKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEI 1074

Query: 1077 SRLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMG 1136
            +RL   I     T  + P T SK I     + N   IG   + NV  +N       + + 
Sbjct: 1075 ARLHNAIRNAPATGTLSP-TRSKRISSYSGLDN---IGSPKQWNVVSLN-------NGLM 1123

Query: 1137 MDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPA 1196
             +   S  + L+QIN+EL++LL D   L +EI +GLLK  ++P  G    L+R++V+YPA
Sbjct: 1124 EEETRSIMSQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPA 1183

Query: 1197 RILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFV 1256
            R+LIIILS+MWR GLT+QSE FLA+VL+TIQ +VT LKG+++I  GAFWL NVRELYSF 
Sbjct: 1184 RVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFA 1243

Query: 1257 VFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAV 1316
            ++A  SIL + ++   + +DEYK+YV+LV+ LK+DFESLSYNIYNIWLKKLQ+EL+K+AV
Sbjct: 1244 IYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAV 1303

Query: 1317 NAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKV 1376
            +AVV+S++LPGF   +S   L KIFSS   Y MDDILTFFN+IYWSMK++ +E EV+ +V
Sbjct: 1304 SAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREV 1363

Query: 1377 VTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQT 1436
            + +LL YVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCK H +P+G+DCL+H++Q 
Sbjct: 1364 IMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQA 1423

Query: 1437 SKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVXXX 1496
            SKLLQ++K ++EDI+I+  ICSSL PAQ+QKLI+QY  ADYE PIPQEIL +VAD V   
Sbjct: 1424 SKLLQLKKANMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKE 1483

Query: 1497 XXXXXXXXXPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
                      +HS+DIF+   TG F DPF+ IE  + +++EA+IPA
Sbjct: 1484 SALSNDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1952 bits (5057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/1543 (62%), Positives = 1177/1543 (76%), Gaps = 19/1543 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            M +EVGTRCWYPSK+ GWIGAEVTK+ L+  +Y++EL LEDG+ V +    L +  + SL
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAGK RGE+EPHLFAIAEEAYRLMK   +NQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEE N     H +EMSETE+KILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD D
Sbjct: 181  FASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240

Query: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300
            TSIIGA++RTYLLERSRLV+QP+TERNYHIFYQ+++GLS  EK++L L   +DY+YMNQG
Sbjct: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300

Query: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360
            GD  IEGVDD  EY  TV+AL+LVGIS +TQ  +FKILAALLHIGNIE+KK RNDASLSS
Sbjct: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360

Query: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420
            DE NL+IA +LLGID+F+FAKW+TKKQI+TRSEKIVS+L Y QA+V+RDSVAKFIYSALF
Sbjct: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLV+NINTVLCNP VV ++ +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540

Query: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TL+KPPTN+VFSKPRFGQT+F+VSHYALDV YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600

Query: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPM-RTVQRKPTLGSMFKQSLIELMTTIRS 659
            L++IL+T+++NA KL + +  +QES+  KPGP  R + RKPTLGSMFKQSLI+LM TI S
Sbjct: 601  LLSILETVDKNAEKLAEKQAQKQESQ-KKPGPASRKIVRKPTLGSMFKQSLIDLMETINS 659

Query: 660  TNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYI 719
            TN HYIRCIKPN DKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF LRY+I
Sbjct: 660  TNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHI 719

Query: 720  LLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLR 779
            L+P+  WS I    D +E+DV  LC +IL  T+ +  KYQ GNTKIFFKAGMLA LEKLR
Sbjct: 720  LVPSELWSNILL-SDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLR 778

Query: 780  SDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQ 839
            +DK+  SSV+IQK I+  +YR+ +LR + AI  LQ  V G++ R   + EFKN AA  IQ
Sbjct: 779  TDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQ 838

Query: 840  SLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAF 899
            S  RG                IQ   RK++  K    +   DAAV IQ  VRSF+PRK+F
Sbjct: 839  SAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSF 898

Query: 900  LEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAKVKE 959
            L +++ TVV+QS IR+ +             SVNHL+EVSYKLENKV+ELT++LA+KVKE
Sbjct: 899  LHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKE 958

Query: 960  NKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQ 1019
            NK L +R+                 ++ K  H   L +QK +  E+  ++ ++L AA  +
Sbjct: 959  NKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKEE 1018

Query: 1020 VEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRL 1079
            +   K+++ +L  + +  K    S LEEL   + EL+  Q+ N+DL+ EV SLKEE++RL
Sbjct: 1019 IISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARL 1078

Query: 1080 QTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDS 1139
            Q+ +  G      +  TP K+     N T      P  +LNV  +N       +N   + 
Sbjct: 1079 QSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSP-KQLNVVSIN-------NNFNTED 1130

Query: 1140 YASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARIL 1199
             ++    ++QIN+EL+++ ED   LN EI +GLLK  +VP  GV + L+R++V+YP+R+L
Sbjct: 1131 VSA---LMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVL 1187

Query: 1200 IIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFA 1259
            IIILS+MWR GLT QSE FLA+VL  IQK+++ LK + +I  GAFW  NVREL+SFVV+A
Sbjct: 1188 IIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYA 1247

Query: 1260 QHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAV 1319
              SI T+E++ SGM ++EY  YV+LV ELK+DFE+LS+N+YN+W+KKL++ L+K AV AV
Sbjct: 1248 YESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAV 1307

Query: 1320 VLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTT 1379
            V+S++LPGF   +    L K   +   Y MDD+LTFFN+IYW+MKS+ IE EVF  V+T 
Sbjct: 1308 VVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITN 1367

Query: 1380 LLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKL 1439
            LL  +DA+CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK+H + + + CLQH++Q +KL
Sbjct: 1368 LLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKL 1427

Query: 1440 LQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVXXXXXX 1499
            LQ++K  + DIDI+  IC+ L P QL++LITQY VADYE PI  EIL+YVA+ V      
Sbjct: 1428 LQLKKRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTSK 1487

Query: 1500 XXXXXXPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542
                     +ND+F+  + GPF DP+  +E   F ++EAYIPA
Sbjct: 1488 AE-----VGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPA 1525

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1855 bits (4805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/1367 (67%), Positives = 1100/1367 (80%), Gaps = 19/1367 (1%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60
            MS+EVGTRCWYP K+ GWIG E+TK+      + +EL LED + V IE++ L +  D+ L
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAGK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVE+ N     H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK+
Sbjct: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240

Query: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300
             SIIGA+IRTYLLERSRLV+QP++ERNYHIFYQ++AGL+ +EK++L L G EDY+YMNQG
Sbjct: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300

Query: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360
            G+ +I+G+DD +EY TTV+AL+LVGIS +TQ  +FKILAALLHIGN+EIKKTRNDASLSS
Sbjct: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360

Query: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420
            DE NL IACELLGIDSFNFAKWITKKQI TRSEKIVSNLNY+QALVARDSVAKFIYSALF
Sbjct: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            +WLV+NINTVLCNP V  ++ SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540

Query: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDKPPTN VFSKPRFGQTKFVVSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRST 660
            L++IL+TL+++A KL     AE+E    KPGP R V RKPTLGS+FKQSLIELM TI ST
Sbjct: 601  LLSILETLDKHAAKL-----AEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINST 655

Query: 661  NAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 720
            N HYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+LRY+IL
Sbjct: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715

Query: 721  LPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRS 780
            +P+  WS +F+  D TE+D+  LC  IL   V++K+KYQ+GNTKIFFKAGMLA+LEKLRS
Sbjct: 716  IPSEHWSKMFS-SDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774

Query: 781  DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQS 840
            D++H SSVLIQK ++A YYR+++L I+S+I +   R +G + R  +D EFK +AA  IQS
Sbjct: 775  DRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834

Query: 841  LLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFL 900
            ++R                 +Q  VRK+L +K    + + DAAV+IQ K+R+F+PR++F 
Sbjct: 835  MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894

Query: 901  EDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQNLAAKVKEN 960
              RR TVVVQSL+R++F             SVNHLKEVSYKLENKV++LT++LA KVKEN
Sbjct: 895  TTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKEN 954

Query: 961  KSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQV 1020
            K ++AR+                    K +H   L +QKD    +  +++E+L  A  +V
Sbjct: 955  KGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEV 1014

Query: 1021 EEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQ 1080
            EE K ++  L  + +E KA  ++ +EEL K K    E QT NSDL+NEV SLK+E++RLQ
Sbjct: 1015 EEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQ 1074

Query: 1081 TQI-SLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGM-D 1138
              + S  T +      T S+      +V +GT   P  +LNV  +N        N G+ D
Sbjct: 1075 AAVRSGVTSSTITSTPTASRRFSAHSSVADGT--SP-RQLNVISMN--------NGGIED 1123

Query: 1139 SYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARI 1198
               S ++AL+QIN+EL++LLED + LN EI +GLLK F++P  GV ++L+R++V+YPARI
Sbjct: 1124 DARSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARI 1183

Query: 1199 LIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVF 1258
            LII+LS+MWR GLTKQSE FLA+VL+TIQK+VT LKG+D+I  GAFWL NVRELYSFVVF
Sbjct: 1184 LIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVF 1243

Query: 1259 AQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNA 1318
            AQ SIL ++S+ +G+ +DEYKEYV+LVTELK+DFESLSYNIYNIWLKKLQ++L++KA++A
Sbjct: 1244 AQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISA 1303

Query: 1319 VVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKS 1365
            VV+S++LPGF A +S   L K+FS    Y MDDI+TFFN+IYWS ++
Sbjct: 1304 VVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>Scas_592.13*
          Length = 1419

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1503 (47%), Positives = 957/1503 (63%), Gaps = 162/1503 (10%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDL-----TDE 55
            MSFEVGTRCWYP+ E GWIG EVTKND +DGTYH+EL  E G  + IETK L      + 
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 56   SDESLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115
            + E LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116  VDQLYSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAK 175
            V++LYS +MIQAYA K R EM PH+FAIAEEAYR M +N +NQTI+VSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176  YIMRYFASVEEEN---SMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKY 232
            YIMR+FASVEEE+       +HQ EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 233  LEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAE 292
            L+ILFD + +IIG+ I+TYLLERSRLV+QP +ERNYHIFYQM++GLS   K +L+L  AE
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 293  DYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKT 352
            D++Y+NQGG+  I G+DD  EY+TT+++L+ VGI  E Q  IFKILAALLHIGNIEIKKT
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 353  RNDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVA 412
            R DA+LSS + +L+ ACELLG+D   F+KWITKKQI TRSEKI+SNL+++QALVARDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 413  KFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472
            KFIYS+LFDWLV NIN VLC   V + + SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 473  QQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532
            QQEFN HVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 533  SWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 592
            SWT KLYQT +KPP+N VF KPRFGQ KF++SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 593  LKASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIE 652
            LKA+TN TL  I +          +A+     ++ A     +T+ RKPTLGS+FK+SL+E
Sbjct: 601  LKATTNPTLATIFE--------FSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVE 652

Query: 653  LMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNE 712
            LM TI STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW F E
Sbjct: 653  LMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEE 712

Query: 713  FILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGML 772
            FI RYY+L P  +W  +    +M+ +D++  C+ IL+  +  K+KYQIG TKIFFKAG+L
Sbjct: 713  FIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVL 772

Query: 773  AFLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKN 832
            A+LEK+RSDK+   +VLIQK+IRAKYYR  +L+ M +I + Q  ++G   R  +D E K 
Sbjct: 773  AYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKT 832

Query: 833  KAATEIQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRS 892
             AAT +Q+L R                 +Q  +R+ L     Q + E+ +A+ IQSK+R+
Sbjct: 833  DAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRA 892

Query: 893  FKPRKAFLEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSVNHLKEVSYKLENKVVELTQN 952
              P+  +   +  T+++Q+L+RR+              S   LK  +  ++ +++   + 
Sbjct: 893  NSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEE 952

Query: 953  LAAKVKENKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEE 1012
            L + +KEN +                         K+     LL+   +    G     E
Sbjct: 953  LISNIKENDA-------------------------KTTEYKSLLKHTSLPVVTGTN---E 984

Query: 1013 LNAANL----QVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNE 1068
              AA +    QVEE K  +  +  +YE  K   +  L+ LE  +   +  + F S LQ+ 
Sbjct: 985  RTAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKG-VNDEKFASSLQSS 1043

Query: 1069 VNSLKEELSRLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKD 1128
            +  +K ++S                      D+ +     +       SEL       KD
Sbjct: 1044 LELIKRDIS----------------------DLRINAIEKDNERTSTSSEL-------KD 1074

Query: 1129 AGSVSNMGMDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLS 1188
                ++          NA+ QI      L +    L N++ + +  +F++P  G      
Sbjct: 1075 GTDCTD----------NAVVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTKDCE 1118

Query: 1189 RRDVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLAN 1248
                 YP ++LI I++ M +FGL K S   L Q +  +   ++++     +  G +W+ +
Sbjct: 1119 H---FYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIIS 1175

Query: 1249 VRELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQ 1308
            + +L S         L +E               +++ +L++ F       Y  WLK+  
Sbjct: 1176 LHKLSS---------LPQEP--------------AVLNKLQDKF-------YKTWLKQCF 1205

Query: 1309 RELQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQI 1368
             +++                                   T+D IL  F++I      FQ 
Sbjct: 1206 NQMK-----------------------------------TVDSILILFDTISEFTLFFQG 1230

Query: 1369 ENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTD 1428
              E+   ++T LL +++A  FNDL++K+N LSW  GL+ +  + ++ +WC +H + + T+
Sbjct: 1231 TTELLTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTE 1290

Query: 1429 CLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKY 1488
             L+++ Q  KLLQ+R  +I D  ++   C  L+  Q+  L+T+Y+   +E PIP ++L +
Sbjct: 1291 YLRNVNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNH 1350

Query: 1489 VAD 1491
            +++
Sbjct: 1351 LSN 1353

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1318 bits (3410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1513 (47%), Positives = 975/1513 (64%), Gaps = 116/1513 (7%)

Query: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDE-S 59
            MSFEVGT+CWYP KE GWIG EVTKND  +GT+H+EL LEDG++V+IET    ++ D  +
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 120  YSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMR 179
            YS++MIQ Y+ K++ E+EPHLFAIAEEAYR M   K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 239
            YFASV+E N+   + +VEMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD+
Sbjct: 181  YFASVQESNNR--EGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238

Query: 240  DTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQ 299
            +T+I G+KIRTYLLE+SRLVYQPETERNYHIFYQ++ GL    K ELHL   +DY+Y NQ
Sbjct: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298

Query: 300  GGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLS 359
            GG   I G+D+ +EY  T DAL+LVGI++ETQ  IFKILA LLHIGNIE+K TRNDASLS
Sbjct: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358

Query: 360  SDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSAL 419
            S+E+NL+IACELLGID FNFAKWI KKQI+TRSEKIV+NLNY+QAL+ARDSVAKFIYS L
Sbjct: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418

Query: 420  FDWLVENINTVLCNPAV--VDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            FDWLV+NIN  L +P +   D V SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW  K
Sbjct: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538

Query: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LY   +KPP+N+VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+T
Sbjct: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598

Query: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTI 657
            N     ILD  E  +    D    EQ ++     P R  Q+KPTLGSMFK+SL ELM  I
Sbjct: 599  NPIFKQILDNRELRS----DDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAII 654

Query: 658  RSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRY 717
             STN HYIRCIKPN++K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF+EF+ RY
Sbjct: 655  NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714

Query: 718  YILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEK 777
            ++L   S WS I    D+ ++ ++  C  IL  T+ +  KYQIGNTKIFFKAGMLAFLEK
Sbjct: 715  FLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEK 774

Query: 778  LRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATE 837
            LR++KM+   ++IQK IRA+YYR ++L+ M +I                      K  ++
Sbjct: 775  LRTNKMNEICIIIQKKIRARYYRLQYLQTMESI---------------------KKCQSQ 813

Query: 838  IQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRK 897
            I+SLL                  ++ +V  EL         +T AA+ +Q+ +R+   R+
Sbjct: 814  IRSLL------------------VRTRVDHEL---------KTRAAILLQTNIRALWKRE 846

Query: 898  AFLEDRRKTVVVQSLIRRRFXXXXXXXXXXXXXSV---NHLKEVSYKLENKVVELTQNLA 954
             +     + + +Q   +R+              +V   ++++   +K + + ++ +  L 
Sbjct: 847  YYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLKRSSILV 906

Query: 955  AKVKENKSLSARVVXXXXXXXXXXXXXXXXKQIKSKHDAELLEQKDVFAEKGKQIEEELN 1014
                     SA  +                + I++ +   LLE+   F        E LN
Sbjct: 907  Q--------SAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLN 958

Query: 1015 AANLQVEEY-KSKLLDL-TQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSL 1072
             +  ++ +  +  L ++ +++ +E++     Y +++ K K   ++V+  N+   N+ N+L
Sbjct: 959  DSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKT--LQVEIMNT--LNKKNAL 1014

Query: 1073 KE----ELSRLQTQI-SLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSK 1127
            KE    + S +Q+ + SL  +  N   +   +   M++ +    ++           N  
Sbjct: 1015 KERKKKQSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKN 1074

Query: 1128 DAGSVSNMGMDSYASDSNALTQI-----NEELFRLLEDIEVLNNEITDGLLKDFEVPAAG 1182
            D   V  +G+         +  I     N +L  LL D+     E+T+G LK   V    
Sbjct: 1075 D--KVKGLGIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNV---- 1128

Query: 1183 VGMQLSRRDVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAG 1242
               +++  +V+ P  ++  ++S + R GL  QS  F+++VL T++ +V +L  ++ +  G
Sbjct: 1129 --TEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGG 1186

Query: 1243 AFWLANVRELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNI 1302
             FWL+N+  L +F   A    L    +++   D++ K  +  + +L+ +   +   IY+ 
Sbjct: 1187 IFWLSNLSRLPAFA--ANQKTL----YEANGGDEKDKLTLIYLNDLENETLKVFDKIYST 1240

Query: 1303 WLKKLQRELQKKA-VNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYW 1361
            WL K  +       +  +VL+E               K+F +  +     + TF N    
Sbjct: 1241 WLVKFMKHASAHIEIFDMVLNE---------------KLFKNSGDEKFAKLFTFLNEFDA 1285

Query: 1362 SMKSFQIENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTH 1421
             +  FQ+ + +  K+    L Y++ + FNDLI K   L+WK G +++ N+ RL  W +  
Sbjct: 1286 VLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPR 1345

Query: 1422 GVPDGTDCLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADY-ESP 1480
             + D    L  +IQ  K+LQ++  ++ +  +L     +L PAQ+Q ++ +Y+ A+  E+ 
Sbjct: 1346 -IEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAG 1404

Query: 1481 IPQEILKYVADIV 1493
            +P EIL Y+A+++
Sbjct: 1405 VPNEILNYLANVI 1417

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/921 (59%), Positives = 681/921 (73%), Gaps = 22/921 (2%)

Query: 1   MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDE-- 58
           M+FEVGTRCWYPS E GWI  EV+KN+ +DG YH++  LEDG  ++++T D  D +D   
Sbjct: 1   MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDT-DSIDYNDSLS 58

Query: 59  ----SLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFD 114
                +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 59  NEGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118

Query: 115 RVDQLYSQDMIQAYAG-KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVS 173
           ++++LYS DMI+ Y+    R E++PHLFAIA +AY  M     NQTIVVSGESGAGKTVS
Sbjct: 119 QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178

Query: 174 AKYIMRYFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYL 233
           AKYIMRYFAS+++ N+  V    EMS+ E+KILATNPIMEAFGNAKT RNDNSSRFGKYL
Sbjct: 179 AKYIMRYFASLDDNNAAVVS---EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYL 235

Query: 234 EILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAED 293
           +I+FD   +IIGA+IRTYLLERSRLV+Q ++ERNYHIFYQ++AGL    K EL +   E 
Sbjct: 236 QIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQ 295

Query: 294 YYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTR 353
           +YY+NQG D +I+GVDD QE+  T+ AL+++GI++  Q  +FKILA LLHIGNIEIK++ 
Sbjct: 296 FYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSS 355

Query: 354 NDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAK 413
             +S+S DE NLK+ACELLG+D + F+KW+TKK+I TRSEKIV+NL   QALV RDSV+K
Sbjct: 356 TSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSK 415

Query: 414 FIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQ 473
           FIYS LFDWLV  INT+L    V D+V SFIGVLDIYGFEHFE NSFEQFCINYANEKLQ
Sbjct: 416 FIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQ 475

Query: 474 QEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDES 533
           QEFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DES
Sbjct: 476 QEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDES 535

Query: 534 WTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 593
           WTQKLYQTLDKPP N+VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  + VL
Sbjct: 536 WTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVL 595

Query: 594 KASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIEL 653
           K S N+TLI++    E      E +    Q +  ++P   + + +KPTLG MFK+SL EL
Sbjct: 596 KNSQNDTLISLTKPTE------ETSTPPPQTASISRP---KLINKKPTLGFMFKKSLGEL 646

Query: 654 MTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 713
           M  I +TN HYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW+F EF
Sbjct: 647 MEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEF 706

Query: 714 ILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLA 773
           I RYY+L+  + WS +    +   +  I  C +IL  T    EK QIG TKIFFK+G+LA
Sbjct: 707 IDRYYMLVDTTLWSDV-ASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLA 765

Query: 774 FLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNK 833
            LE LR  KM   ++ IQK IRA   R  +L I++ +  LQ R++ ++ R  ++ + K K
Sbjct: 766 ELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTK 825

Query: 834 AATEIQSLLRGYXXXXXXXXXXXXXXCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSF 893
            A  +Q+ LR Y               +Q K R  L +++ Q      A++ IQS +R +
Sbjct: 826 LALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGY 885

Query: 894 KPRKAFLEDRRKTVVVQSLIR 914
           K +  +   R+    +Q+L R
Sbjct: 886 KHKTQYRYFRKNYQAIQALSR 906

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 69/127 (54%)

Query: 1363 MKSFQIENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG 1422
            M +  IE  +F K++ TL+ Y++    N +++K   + ++ G+ L  N+  L E+C+   
Sbjct: 1234 MGTSAIEKSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELK 1293

Query: 1423 VPDGTDCLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIP 1482
            + +  +  +   Q SKLLQ+   S+E++ ++   C +L   Q+  L+ + + +  E P+P
Sbjct: 1294 LSNCRNSTRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMP 1353

Query: 1483 QEILKYV 1489
              ++K V
Sbjct: 1354 YIVVKKV 1360

>Scas_688.22
          Length = 1876

 Score =  517 bits (1332), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 305/821 (37%), Positives = 479/821 (58%), Gaps = 84/821 (10%)

Query: 9   CWYPSKELGWIGAEVTK-NDLKDGTYHME------LALEDGKSVNIETKDLTDESDESLP 61
            W P  +  +  AEV +   +K+   ++E        +E G+ + IE  +L+       P
Sbjct: 8   VWIPDPDKIFTLAEVARIESVKNARTNVEEEMATVRIMETGEELQIEKSNLS-------P 60

Query: 62  LLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYS 121
              NP   +  ++++ L++LNE +VLH +++RY    IYTYSG+ L+A NP+  + ++Y+
Sbjct: 61  --SNPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYT 117

Query: 122 QDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYF 181
           Q+ I  Y G  + + +PH++AIAEEAY+ +   K++Q+++V+GESGAGKT + K I++Y 
Sbjct: 118 QEYINLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYL 177

Query: 182 ASV-------EEENSMTVQHQVEMSETEQ---KILATNPIMEAFGNAKTTRNDNSSRFGK 231
           AS+        E + +  Q+  E+++ E    KIL +NPI+E+FGNA+T RN+NSSRFGK
Sbjct: 178 ASITSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGK 237

Query: 232 YLEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKE--KAELHLK 289
           +++I FD+   I GA I  YLLE+SR++ Q   ERNYHIFYQ++AGLS +E  K EL  K
Sbjct: 238 FIKIEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSK 297

Query: 290 GAEDYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEI 349
              DY Y+++  +  I GV+D Q++   + A T VG ++E   +I+++L+ +LHIGN++ 
Sbjct: 298 SVSDYKYLSK-SNPSIPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDF 356

Query: 350 KKTRN-DASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVAR 408
              ++  A+  +D   L    +LLG+    F   +   +     E +  + N SQA    
Sbjct: 357 TSEKSQQATFKNDPSTL---AKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFIL 413

Query: 409 DSVAKFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYA 468
           +S+++ +Y  LF ++VE IN  L + ++    A++IG+LDI GFE F+ NSFEQ CINY 
Sbjct: 414 NSLSRTLYEKLFSFIVERINNSLDHSSM---TANYIGLLDIAGFEIFKHNSFEQLCINYT 470

Query: 469 NEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEES 524
           NEKLQQ FN H+F LEQ EY+KE I+W+F++F  D Q  IDLIENK    G+L LLDEES
Sbjct: 471 NEKLQQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEES 530

Query: 525 RLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTK----FVVSHYALDVAYDVEGFIEK 580
            LP  SD+S+  KL  T D+         P+F ++K    FV+ HYA +V Y++EG++ K
Sbjct: 531 ILPNSSDDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSK 583

Query: 581 NRDTVSDGHLEVLKASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKP 640
           N+D +S+  + +L +STNE + +  +                + +K  +    RT   + 
Sbjct: 584 NKDPLSECMISMLSSSTNEIVTSFFN----------------ESNKNVRGSSFRTASARH 627

Query: 641 TLGSMFKQSLIELMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRIS 700
               M       L+  + +T+ H++RCI PNN K+A  FD  ++L QLR  GVLE IRI+
Sbjct: 628 REQQML------LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIA 681

Query: 701 CAGFPSRWTFNEFILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQI 760
             G+P+R  F EF  RY +L   + ++  F K           C  +L+    +   Y+I
Sbjct: 682 REGYPNRIFFKEFFQRYRLLSDENHFATGFKKN----------CEILLSSLHLDPSLYKI 731

Query: 761 GNTKIFFKAGMLAFLEKLRSDKMHISSVLIQKNIRAKYYRR 801
           G +K+FFKAG+LA LE  +  ++    +    ++R +  R+
Sbjct: 732 GTSKLFFKAGVLAELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>Kwal_23.5534
          Length = 1907

 Score =  499 bits (1285), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 291/750 (38%), Positives = 441/750 (58%), Gaps = 66/750 (8%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  +D++ L++LNEP+VLH ++ RY+  NIYTYSG+ L+A NP+  + ++YSQD 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 125 IQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASV 184
           +  Y G  + + +PH+FAIAEEAY+ +   + +Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 185 EEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSII 244
             ++ ++     E    E+KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I 
Sbjct: 174 TSDDKLSPDTSQE--SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKIN 231

Query: 245 GAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKE--KAELHLKGAEDYYYMNQGGD 302
           GA +  YLLE+SR++ Q   ERNYHIFYQM++G+S +E  +  L     +DY Y+ +  +
Sbjct: 232 GAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYL-RNSN 290

Query: 303 VKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDE 362
             I GVDD Q++ T + +  +VG S +  Q +   ++ +LHIGNIE    R  A  +S +
Sbjct: 291 PSIPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQASFD 348

Query: 363 ENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALFDW 422
            +++  C LLG+   +F   + K +     + +    N  QA    +S+++ +Y  LF  
Sbjct: 349 GSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAH 408

Query: 423 LVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFK 482
           +V+ IN  L + ++ +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F 
Sbjct: 409 IVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFV 465

Query: 483 LEQEEYVKEQIEWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDESWTQKL 538
           LEQ EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+  KL
Sbjct: 466 LEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL 525

Query: 539 YQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTN 598
            +T           K    Q  FV+ HYA DV Y+V+G++ KN+D + +  L++L  S+N
Sbjct: 526 -ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSN 582

Query: 599 ETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIE------ 652
           E +                   +E++S+                GS FK + I       
Sbjct: 583 ELIRGFY---------------SEKDSR----------------GSSFKTTSIRHRDQLK 611

Query: 653 -LMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFN 711
            L+  + ST  H++RCI PN+ K+A  F+  ++L QLR  GVLE IRI+  G+P+R  F 
Sbjct: 612 SLLDRLSSTEPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFK 671

Query: 712 EFILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGM 771
           EF  RY IL  + E+ F  T K          C  +L+    +   +++GN+K+FFKAG+
Sbjct: 672 EFFQRYKIL--SDEYRFSNTSKKN--------CEIVLSSLRLDPSVFKVGNSKLFFKAGV 721

Query: 772 LAFLEKLRSDKMHISSVLIQKNIRAKYYRR 801
           LA LE  +  ++   +  +   I     RR
Sbjct: 722 LASLEAKKEGRISDMASKLNARINGNAVRR 751

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  494 bits (1272), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 282/727 (38%), Positives = 429/727 (59%), Gaps = 58/727 (7%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  +D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  + ++Y+QD 
Sbjct: 59  NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQDY 117

Query: 125 IQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASV 184
           +  Y G  + + EPH+FA+AE+AYR +   +++Q+++V+GESGAGKT + K I++Y AS+
Sbjct: 118 VNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLASI 177

Query: 185 EEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSII 244
             +  +       +   E+KIL  NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I 
Sbjct: 178 TSDEKLA---HTNLESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKIN 234

Query: 245 GAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHL--KGAEDYYYMNQGGD 302
           GA I  YLLE+SR++ Q   ERNYH+FYQ+++G+   +   L L      DY Y+ +  +
Sbjct: 235 GAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYL-RDSN 293

Query: 303 VKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRND-ASLSSD 361
             I GVDD  ++++ + A  +VG   +    IF+ +A +LHIGN+E   TR + A++ +D
Sbjct: 294 PSIPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIKND 353

Query: 362 EENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALFD 421
              L   C+L+G+D   F   + K +     E +  + N +Q+    +S+++ +Y  LF 
Sbjct: 354 VAPL---CKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFA 410

Query: 422 WLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 481
            +V  IN  L + ++ +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F
Sbjct: 411 HIVRRINRSLDHGSMTE---NYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMF 467

Query: 482 KLEQEEYVKEQIEWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDESWTQK 537
            LEQ EYVKE I+W FI++  D +  I+LIE   N  GILS+LDEES LP  +DES+  K
Sbjct: 468 VLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFYSK 527

Query: 538 LYQTLD-KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAS 596
           L    D K P    F + +  Q  FV+ HYA DV Y+V+ ++ KN+D ++D  L +L  S
Sbjct: 528 LMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLSES 583

Query: 597 TNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTT 656
           +N+ +        R                              T  +  K+ L  L+  
Sbjct: 584 SNKLISEFYTEQSRG-------------------------HFSKTASNRHKEQLTLLLDQ 618

Query: 657 IRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILR 716
           + ST+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  F EF  R
Sbjct: 619 LSSTDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQR 678

Query: 717 YYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLE 776
           Y IL    ++S   +KK+         C  +L+    +   Y++GNTK+FFKAG+LA LE
Sbjct: 679 YKILGADPKFSN-NSKKN---------CEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLE 728

Query: 777 KLRSDKM 783
             + +K+
Sbjct: 729 TQKEEKI 735

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  495 bits (1274), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 298/761 (39%), Positives = 450/761 (59%), Gaps = 38/761 (4%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  E+++ L++LNEP+VL+ +++RY    IYTYSG+ L+A NP+  ++ LYS+D 
Sbjct: 70  NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LYSEDH 128

Query: 125 IQAYAGKQ------------RGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTV 172
           I  Y  K               ++ PH+FAIAEEAY  +    ++Q+I+V+GESGAGKT 
Sbjct: 129 INLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTE 188

Query: 173 SAKYIMRYFASVEE---ENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRF 229
           + K I++Y AS+      N   V     +   E KIL +NPI+E+FGNA+T RN+NSSRF
Sbjct: 189 NTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRF 248

Query: 230 GKYLEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLK 289
           GK+++I F++   I GA I  YLLE+SR+V+Q   ERNYHIFYQ+++GL   E   L LK
Sbjct: 249 GKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLK 308

Query: 290 G--AEDYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNI 347
               +DY  ++      I G++D + +   + AL ++G S +  + IF+++A +L IGNI
Sbjct: 309 SRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNI 368

Query: 348 EIKKTRNDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVA 407
           E    R  A  +S + ++   C  LG+D  +F   I + +     E +  + N  QA   
Sbjct: 369 EFVSDR--AEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFI 426

Query: 408 RDSVAKFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINY 467
            +++++ +Y  LF ++V+ IN  L + +      ++IG+LDI GFE FE NSFEQ CINY
Sbjct: 427 LNALSRNLYERLFGYIVDMINKNLDHGSA---TLNYIGLLDIAGFEIFENNSFEQLCINY 483

Query: 468 ANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEE 523
            NEKLQQ FN H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+L LLDEE
Sbjct: 484 TNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEE 543

Query: 524 SRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRD 583
           + LP  +DES+  KL  T D+  +   F + R  +  F++ HYA DV Y VEG++ KN+D
Sbjct: 544 AVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEGWLSKNKD 600

Query: 584 TVSDGHLEVLKASTNETLINILDTL-ERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTL 642
            ++D  L +L +S N+ +  +     E++++   +A  + QE K +     RT   K T 
Sbjct: 601 PLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKS----ARTSTFKTT- 655

Query: 643 GSMFKQSLIELMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCA 702
            S  ++  I L+  + ST+ H++RCI PNN K+   F+  ++L QLR  GVLE IR++  
Sbjct: 656 SSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLARE 715

Query: 703 GFPSRWTFNEFILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGN 762
           G+P+R  F EF  RY IL P +  +  F+ K   +      C  +L     + + Y+IGN
Sbjct: 716 GYPNRIAFQEFFQRYRILYPENSTTTTFSSK--LKASTKQNCEFLLTSLQLDTKVYKIGN 773

Query: 763 TKIFFKAGMLAFLEKLRSDKMHISSVLIQKNIRAKYYRREF 803
           TK+FFKAG+LA LEK +  K++   + +   IR    R+E 
Sbjct: 774 TKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEI 814

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  494 bits (1272), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 300/761 (39%), Positives = 442/761 (58%), Gaps = 65/761 (8%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  +DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS   
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSY 117

Query: 125 IQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASV 184
           I+ Y G  + + +PH+FA+AE+AY+ +   K++Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 118 IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 185 EEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSII 244
             ++ + +    E    E+KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I 
Sbjct: 178 TTDDKILLNQTNE--SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYGKIN 235

Query: 245 GAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAE-----DYYYMNQ 299
           GA I  YLLE+SR++     ERNYHIFYQ+++G+S   K EL   G E     DY Y+ +
Sbjct: 236 GAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMS---KQELRAIGLESNSIVDYQYL-R 291

Query: 300 GGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRND-ASL 358
             +  I G+DD Q Y   V A   VG + +  Q I K ++ +LHIGN+E    R++ AS+
Sbjct: 292 HSNPSIPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQASI 351

Query: 359 SSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSA 418
            +D   +K  C+LLG+   +F   + K +     E +    N SQA    +S+++ +Y  
Sbjct: 352 KND---IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLYEK 408

Query: 419 LFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQ 478
           LF+++V  IN  L + ++ +    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ FN 
Sbjct: 409 LFEYIVNQINKSLEHGSMTE---YFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNH 465

Query: 479 HVFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK----LGILSLLDEESRLPAGSDES 533
           H+F LEQ EY KE I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  SD S
Sbjct: 466 HMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSDAS 525

Query: 534 WTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 593
           +  KL  + D   T   F + +     F++ HYA DV Y+V  ++ KN+D +++  L+VL
Sbjct: 526 FYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLLQVL 582

Query: 594 KASTNETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIEL 653
               N  +          A+++             +    RT   K       ++ L  L
Sbjct: 583 NDCANPLVSQFF------ADRI-------------RGSSFRTSSNK------HREQLHTL 617

Query: 654 MTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 713
           +  + +T+ H++RCI PNN K+A  FD  ++L QLR  GVLE IRI+  G+P+R  F EF
Sbjct: 618 IEQLGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEF 677

Query: 714 ILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLA 773
             RY IL  + E  F    K   E   I L +  L  T+     Y++GNTK+FFKAG+LA
Sbjct: 678 FQRYKIL--SDECRFTNNSKKNCE---ILLSSLHLDPTI-----YKVGNTKLFFKAGVLA 727

Query: 774 FLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQ 814
            LE L+  ++  +   +   I A   R+E   I S +  LQ
Sbjct: 728 NLELLKEQRLSAAVTRLNAIISANSVRKE---IRSHLKKLQ 765

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  471 bits (1213), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 298/795 (37%), Positives = 444/795 (55%), Gaps = 63/795 (7%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS   
Sbjct: 61  NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSNST 120

Query: 125 IQAY-AGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFAS 183
           I++Y +  +    +PH+F +AE AYR +K  K++Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 121 IKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYLAS 180

Query: 184 VEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSI 243
           +   +S  V +  EM     KIL +NP++E+FGNA+T RN+NSSRFGK+++I FD+   I
Sbjct: 181 ITS-DSFEVSNNFEM-----KILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSGKI 234

Query: 244 IGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDY--YYMNQGG 301
            GA I  YLLE+SR+  +   ERNYHIFYQ++ G S K+   ++   + D+  Y +    
Sbjct: 235 NGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILANS 294

Query: 302 DVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIE-IKKTRNDASLSS 360
           +  I GVDD  E+   + AL  VG   +    IFKI+A +LH GNIE + +    AS  S
Sbjct: 295 NHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASFKS 354

Query: 361 DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420
           D   +     LLG+   +F   I K +     E +    N +QA    +S+ + +Y  LF
Sbjct: 355 D---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEHLF 411

Query: 421 DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            ++V+ IN  L + ++    A++IG+LDI GFE FE NSFEQ CINY NEKLQQ FN H+
Sbjct: 412 GYIVDTINMSLNHGSM---TANYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNHHM 468

Query: 481 FKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDESWTQ 536
           F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D S+  
Sbjct: 469 FVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSFYS 528

Query: 537 KLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAS 596
           KL  T  +  T   F + +     FV+ HYA DV Y V G++ KN+D +++  + +L  S
Sbjct: 529 KLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNILSVS 585

Query: 597 TNETLINILDTLERNANKLEDAKKAEQESKPAKP---GPMRTVQRKPTLGSMFKQSLIEL 653
           +N  +       E  ++      +    S  A     G  RT  +  T  S  ++    L
Sbjct: 586 SNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLK--TALSRHREQQSSL 643

Query: 654 MTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 713
           ++ +  TN H++RCI PNN K +  FD  ++L QLR  GVLE IRI+  G+P+R  F EF
Sbjct: 644 LSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILFKEF 703

Query: 714 ILRYYILLPASEWSFIFTKKDMTEDDVIGL--CNKILAVTVK-EKEKYQIGNTKIFFKAG 770
             RY IL    + S           D I     ++IL   +  +   Y++G +K+FFKAG
Sbjct: 704 YERYRILSEHLDKS----------SDAINYKQSSQILISELHLDPTTYKVGTSKLFFKAG 753

Query: 771 MLAFLEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREF 830
            LA LE  +       S+L +  +R       F  I+    S ++R KGE++        
Sbjct: 754 TLAELESKK------ESILFEITVR-------FNSIIRGW-SQRKRTKGEIQ-------- 791

Query: 831 KNKAATEIQSLLRGY 845
           K +A+  I ++ R Y
Sbjct: 792 KMRASEMIGNVFRKY 806

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  458 bits (1178), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 280/750 (37%), Positives = 407/750 (54%), Gaps = 55/750 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 35  GVSDLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPF-RDLGIYTDAVLESYKG 93

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E+ PH+FAIAE  Y  +K   ENQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 94  KNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASST--- 150

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
              H+  + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F++       +I  
Sbjct: 151 ---HEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITN 207

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G S   +    +   + Y Y +  G   ++ +DD
Sbjct: 208 YLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDD 267

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACE 370
             +Y  T+ A+ ++G+S E Q  IF++L+A+L IGN+   +     +   D         
Sbjct: 268 LHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFVAY 327

Query: 371 LLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVE 425
           L+ +DS    K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V+
Sbjct: 328 LMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIVD 387

Query: 426 NINTVL-CNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P  V      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 388 RVNVSLKAFPGAVKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 443

Query: 485 QEEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           QEEY KEQI+W+ I++ DN+   DLIE+K   GI + LD+          +  Q   Q L
Sbjct: 444 QEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRL 503

Query: 543 DKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   TN  F       +KFV+ HYA DV YD+ G  +KN+D +     E+++ +TN  L 
Sbjct: 504 NLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLS 560

Query: 603 NIL-DTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTN 661
            I  DT+++++ +                       R PT G+   +S  EL+ T+    
Sbjct: 561 TIFPDTIDKSSKR-----------------------RPPTAGNKIIKSANELVETLSKAQ 597

Query: 662 AHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILL 721
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R+Y+L 
Sbjct: 598 PSYIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLS 657

Query: 722 PASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRS 780
           P   ++  +T     + D +G   +IL        +YQ+G TK+F K     F LE +R 
Sbjct: 658 PKCSYAGDYT----WQGDTLGAVKQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRD 713

Query: 781 DKMHISSVLIQKNIRAKYYRREFLRIMSAI 810
              +  +  IQ+  R ++ +R   RI SAI
Sbjct: 714 RYWYNMAARIQRAWR-RFIQR---RIDSAI 739

>Kwal_26.7587
          Length = 1250

 Score =  449 bits (1154), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 275/758 (36%), Positives = 411/758 (54%), Gaps = 56/758 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVG 95

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E+ PH+FAIAE  Y  MK   ENQ +++SGESGAGKT +AK IM+Y A+  E +S 
Sbjct: 96  KNRLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSD 155

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 156 SIGKIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q + ERN+HIFYQ   G S   +    ++  E Y Y +  G   ++ +DD
Sbjct: 210 YLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDD 269

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACE 370
             ++  T++A++++GI+   Q  +F+ LAA+L IGNI   +     +   D         
Sbjct: 270 LSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVE 425
           LL +DS    + + ++ + T     R       LN  QA   +D++AK IY+ LFDW V+
Sbjct: 330 LLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVD 389

Query: 426 NINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L      +K    IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNLSLQALPGANKS---IGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 543
           EEY +EQIEW+ I++ DN+   DLIE +   GI++ +++         ++  Q   Q L 
Sbjct: 447 EEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL- 505

Query: 544 KPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETL 601
               N   S P F    +KF++ HYA DV YD+ G  +KN+D +    +E++K S+NE L
Sbjct: 506 ----NLFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFL 561

Query: 602 INILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTN 661
            ++  T+             ++ SK          +R P+ G    +S  EL+ T+    
Sbjct: 562 CSLFPTV------------VDKNSK----------RRPPSAGDKIIKSANELVETLSKAQ 599

Query: 662 AHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILL 721
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F++F+ R+Y+L 
Sbjct: 600 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLS 659

Query: 722 PASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRS 780
           P   ++  +T     + D +     IL        +YQ+G +K+F K     F LE +R 
Sbjct: 660 PQCSYAGDYT----WQGDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRD 715

Query: 781 DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVK 818
              H  +  IQ+      +RR  LR + A + +Q+ ++
Sbjct: 716 KYWHNMAARIQRA-----WRRFLLRRIDAASRIQRAIR 748

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  447 bits (1150), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 279/757 (36%), Positives = 402/757 (53%), Gaps = 54/757 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +Y+  ++  Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKG 95

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E+ PH+FAIAE  Y  MK   ENQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAA------ 149

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           +  H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 150 SSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q + ERN+HIFYQ   G S   +    ++  E Y Y    G +  E +DD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDD 269

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACE 370
            Q+Y  T+ A+ ++G+  E Q  IF++LAA+L IGN+   +     +   D         
Sbjct: 270 LQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVE 425
           LL IDS    K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V 
Sbjct: 330 LLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVS 389

Query: 426 NINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L      +K    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNKSLQAFPGAEKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 543
           E Y +E+I+W+ I++ DN+   DLIE +   GI + +++          +  Q   Q L+
Sbjct: 447 ETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLN 506

Query: 544 KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLIN 603
              TN  F        KFV+ HYA DV YD++G  +KN+D +    +E++  +TN  L  
Sbjct: 507 LFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLAT 563

Query: 604 IL-DTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTNA 662
           I  DT++R             ESK          +R PT G    +S  +L+ T+     
Sbjct: 564 IFPDTVDR-------------ESK----------RRPPTAGDKIIKSANDLVETLSKAQP 600

Query: 663 HYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILLP 722
            YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+L P
Sbjct: 601 SYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSP 660

Query: 723 ASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRSD 781
              ++  +T     + D +     IL  +   +++YQ+G T +F K     F LE +R  
Sbjct: 661 HCSYAGDYT----WQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDR 716

Query: 782 KMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVK 818
             H  +  IQ+      +RR   R + A T +Q+ ++
Sbjct: 717 YWHNMAARIQRA-----WRRFLQRRIDAATKIQRTIR 748

>Scas_721.119
          Length = 1232

 Score =  441 bits (1134), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 273/731 (37%), Positives = 388/731 (53%), Gaps = 51/731 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++  +   +K+R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPF-RDLGIYTDAIVESYKG 95

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E+ PH+FAIAE  Y  MK   ENQ +++SGESGAGKT +AK IM+Y AS       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASA------ 149

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           +  H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 150 STTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q + ERN+HIFYQ   G S   +    ++  E Y Y +  G   ++ +DD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDD 269

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACE 370
             +Y  T+ A+ ++G+  E Q  IF++LAA+L IGN+   +     +   D         
Sbjct: 270 VNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVE 425
           LL ID+    K + ++ + T     R       LN  QA   RD++AK IY+ LF+W+V 
Sbjct: 330 LLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVG 389

Query: 426 NINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L      D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNVSLQAYPGADRS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 543
           E Y +E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L 
Sbjct: 447 ETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRL- 505

Query: 544 KPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETL 601
               N   S P F     KFV+ HYA DV YDV G  +KN+D +    +E++  +TN  L
Sbjct: 506 ----NMFSSNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFL 561

Query: 602 INILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTN 661
             I               + ++ESK          +R PT G    +S  EL+ T+    
Sbjct: 562 SGIFPV------------EVDKESK----------RRPPTAGDKIIKSANELVETLSKAQ 599

Query: 662 AHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILL 721
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R+Y+L 
Sbjct: 600 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLS 659

Query: 722 PASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRS 780
           P   ++  +T +  T D V  + N     ++   E YQ+G T +F K     F LE +R 
Sbjct: 660 PHCSYAGDYTWQGETLDAVQHILND---ASIPASE-YQLGTTSVFIKTPETLFALEHMRD 715

Query: 781 DKMHISSVLIQ 791
              H  +  IQ
Sbjct: 716 RYWHNMAARIQ 726

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  438 bits (1126), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 283/761 (37%), Positives = 402/761 (52%), Gaps = 64/761 (8%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF R   +Y+ D +++Y G
Sbjct: 37  GVSDLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQG 95

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E  PH+FAIAE  Y  +K   ENQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAT------ 149

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           +  H   +S+ +  +LATNP++E+FG AKT RN+NSSR GKYLEI FD         I  
Sbjct: 150 SSTHSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITN 209

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELH-LKGAEDYYYMNQGGDVKIEGVD 309
           YLLE+ R+V Q + ERN+HIFYQ   G +P+E  +L  ++  E Y Y +      +E +D
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKG-APEEYRQLFGVQQPEQYIYTSASQCTAVENMD 268

Query: 310 DKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIAC 369
           D +E+N T++A+  +G++   Q  IF+ LAA+L IGNI   +     +   D+       
Sbjct: 269 DVEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVA 328

Query: 370 ELLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLV 424
            LL +      K + ++ I T     R     S LN  QA   RD++AK IY+ LF+W+V
Sbjct: 329 YLLEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIV 388

Query: 425 ENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
           E +N  L      DK    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 389 ERVNNSLQAFPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 485 QEEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           Q+ Y KEQI W+ IE+ DN+   DLIE K   GI + +++         ++  Q   Q L
Sbjct: 446 QDTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRL 505

Query: 543 DKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   TN  F      Q KFVV HYA DV YD+ G  +KN+D +    +E+L  ++N  + 
Sbjct: 506 NLFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVR 562

Query: 603 NILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTNA 662
            I                      P +P    + +R PT G    +S  EL+ T+     
Sbjct: 563 EIF---------------------PDQPQ-TDSRRRPPTSGDKIIKSANELVETLSKAQP 600

Query: 663 HYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILLP 722
            YIR IKPN+ K +  +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+L P
Sbjct: 601 SYIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSP 660

Query: 723 ASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRSDK 782
              ++  +     T D V      IL        +Y+IG T+IF K              
Sbjct: 661 QCSYAGDYVWDGETLDAV----KLILQDASIPTTEYEIGVTQIFIK-------------- 702

Query: 783 MHISSVLIQKNIRAKYYRREFLRIMSAITS-LQQRVKGEVR 822
            H  ++   +N+R KY+     RI  A    LQ+R+   +R
Sbjct: 703 -HPETLFALENMRDKYWYNMAARIQRAWRRYLQKRIDAAIR 742

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  434 bits (1115), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 268/756 (35%), Positives = 400/756 (52%), Gaps = 52/756 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT L+ +++ ++   +K+R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 38  GVSDLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQG 96

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           K R E+ PH++AI+E  Y  +K   ENQ +++SGESGAGKT +AK IM Y A+    +S 
Sbjct: 97  KNRLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSE 156

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 157 SIGKIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 210

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G S   +    ++  E Y Y +      ++ +DD
Sbjct: 211 YLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDD 270

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACE 370
            +++  T+ A+ ++G++ E Q  IF++LAA+L IGNI   +     +   D         
Sbjct: 271 VKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAY 330

Query: 371 LLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVE 425
           LL +DS +  K + ++ + T     R       LN  QA   RD++AK IY+ LF+W+V+
Sbjct: 331 LLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVD 390

Query: 426 NINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L      DK    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 391 RVNKSLHAYPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 447

Query: 486 EEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 543
           + Y +E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L 
Sbjct: 448 DTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLS 507

Query: 544 KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLIN 603
              +N  F +    Q KFV+ HYA DV YDV G  +KN+D +    +E++  +TN  L  
Sbjct: 508 LFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTT 564

Query: 604 ILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTNAH 663
           +        NK                      +R PT G    +S  EL+ T+      
Sbjct: 565 LFPNQVDKDNK----------------------RRPPTAGDKIIKSANELVETLSKAQPS 602

Query: 664 YIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILLPA 723
           YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+L P 
Sbjct: 603 YIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPR 662

Query: 724 SEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRSDK 782
             ++  +T       D++     IL   +  +++YQ+G T++F K     F LE +R   
Sbjct: 663 CSYAGDYT----WTGDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKF 718

Query: 783 MHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVK 818
            H  +  IQ     + +RR   R + A   +Q+ +K
Sbjct: 719 WHNMAARIQ-----RAWRRYLQRRIDAAVKIQRTIK 749

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  435 bits (1119), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 286/796 (35%), Positives = 419/796 (52%), Gaps = 72/796 (9%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++  +   +K+R+   +IYTY G VLI+ NPF R   +Y+  +++ Y G
Sbjct: 36  GVSDLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKG 94

Query: 131 KQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSM 190
           + R E+ PH+FAIAE  Y  +K   ENQ +++SGESGAGKT +AK IM+Y A+    +  
Sbjct: 95  RNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEA 154

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+        +I  
Sbjct: 155 SIGRIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITN 208

Query: 251 YLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDD 310
           YLLE+ R+V Q + ERN+HIFYQ   G S + +    ++  E Y Y +  G   ++ +DD
Sbjct: 209 YLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDD 268

Query: 311 KQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIA-- 368
             +Y  T++A+ ++G+S   Q  IF++L+A+L IGN+          +  DE N KIA  
Sbjct: 269 LNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIADT 320

Query: 369 ------CELLGIDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYS 417
                   LL +D+    K + ++ I T     R       LN  QA   RD++AK IY+
Sbjct: 321 SITDFVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYN 380

Query: 418 ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            LF+W+V+ +N  L     +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F 
Sbjct: 381 NLFEWIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFI 437

Query: 478 QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWT 535
           Q   K EQEEY KEQI+W+ I++ DN+   +LIE K   GI + L++          +  
Sbjct: 438 QLTLKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAAD 497

Query: 536 QKLYQTLDKPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 593
           Q   Q L     N   S P F    +KFV+ HYA DV YD+ G  +KN+D +    +E+L
Sbjct: 498 QAFAQRL-----NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELL 552

Query: 594 KASTNETLINIL-DTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIE 652
            +++N  L  I  DT ++++ ++                         T G    +S  E
Sbjct: 553 NSTSNTFLATIFPDTGDKDSKRIPS-----------------------TAGDKIIRSANE 589

Query: 653 LMTTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNE 712
           L+ T+      YIR IKPN  K    +D+  VL Q++  G+ E +RI  A +  R  F++
Sbjct: 590 LVDTLSKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDK 649

Query: 713 FILRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGML 772
           F+ R+Y+L P   ++  +T +  T D V    N IL  T     +YQ+G TK+F K    
Sbjct: 650 FVERFYLLSPQCSYAGDYTWQGNTLDAV----NLILRDTSIPVTEYQLGVTKVFIKTPET 705

Query: 773 AF-LEKLRSDKMHISSVLIQKNIRAKYYRR--EFLRIMSAITSLQQRVKGEVRRSIIDRE 829
            F LE +R    H  +  IQ+  R    RR    +RI  AI  ++   + E  R   ++ 
Sbjct: 706 LFALENMRDKYWHNMASRIQRAWRRFLQRRIDSAIRIQRAIREMKHGNQFEQLRDYGNKL 765

Query: 830 FKNKAATEIQSLLRGY 845
              +      SLL GY
Sbjct: 766 LGGRKERRAMSLL-GY 780

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  427 bits (1099), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 270/754 (35%), Positives = 402/754 (53%), Gaps = 55/754 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAGKQR 133
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPF-RDLGIYTNAVLESYKGKNR 98

Query: 134 GEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRYFASVEEENSMTVQ 193
            E+ PH+FAIAE  Y  +K   ENQ +++SGESGAGKT +AK IM+Y A+    +S ++ 
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIG 158

Query: 194 HQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGAKIRTYLL 253
              +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  YLL
Sbjct: 159 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLL 212

Query: 254 ERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDDKQE 313
           E+ R+V Q + ERN+HIFYQ   G S   K    ++  E Y Y    G    + +  +++
Sbjct: 213 EKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQL-MRKD 271

Query: 314 YNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDEENLKIACELLG 373
           Y  T++A+  +G+  E Q  IF++LAA+L IGNI   +     +   D         LL 
Sbjct: 272 YEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQ 331

Query: 374 IDSFNFAKWITKKQIIT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVENIN 428
           +D+    K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V+ +N
Sbjct: 332 VDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVN 391

Query: 429 TVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEY 488
             L      DK    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQE Y
Sbjct: 392 VSLQAFPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETY 448

Query: 489 VKEQIEWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPP 546
            +E+I+W+ I++ DN+   DLIE  N  GIL+ +++          +  Q   Q L+   
Sbjct: 449 EREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLFN 508

Query: 547 TNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINIL- 605
           +N  F        KFV+ HYA DV YD+ G  +KN+D +    +E++  +TN  L  I  
Sbjct: 509 SNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFP 565

Query: 606 DTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTNAHYI 665
           D +++++ +                       R PT G    +S  EL+ T+      YI
Sbjct: 566 DDVDKDSKR-----------------------RPPTAGDKIIKSANELVETLSKAEPSYI 602

Query: 666 RCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILLPASE 725
           R IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R+Y+L P   
Sbjct: 603 RTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCS 662

Query: 726 WSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF-LEKLRSDKMH 784
           ++  +T     + D +     IL   +  ++++Q+G T +F K     F LE +R    +
Sbjct: 663 YAGDYT----WDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWY 718

Query: 785 ISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVK 818
             +  IQ     + +RR   R + A   +Q+ ++
Sbjct: 719 NMAARIQ-----RAWRRFLQRRIDAAIKIQRTIR 747

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 40/72 (55%)

Query: 1352 ILTFFNSIYWSMKSFQIENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNV 1411
            I+  F ++ + ++S Q+   +  + ++T + +     FN ++  + +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1412 TRLEEWCKTHGV 1423
            + +E+W K H +
Sbjct: 512  STIEDWVKNHDM 523

>KLLA0E17193g 1523750..1525750 gi|586045|sp|Q08400|ST12_KLULA
           Kluyveromyces lactis STE12 protein, start by similarity
          Length = 666

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 19/102 (18%)

Query: 693 VLETIRISCAGFPSRWTFNEFILRYYI-----LLPASEWSFIFTKKDMTEDDVIGLCN-- 745
           ++E ++   A  P+ W  N+ I RYY+      +    W+ ++    +T  D++  C   
Sbjct: 33  LIEDLKFFLATAPANWQENQVIRRYYLSNDEGFVSCVFWNNLYY---ITGTDIVRCCAYR 89

Query: 746 -KILAVTVKEKEKYQIGNTKIF-----FKAGMLAFLEKLRSD 781
            +     + E++K++ G   IF      K G+ A LEK +SD
Sbjct: 90  MQKFGREIVERKKFEEG---IFSDLRNLKCGIDATLEKPKSD 128

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
           of the abundant RSC chromatin remodeling complex [2658
           bp, 885 aa]
          Length = 885

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 58  ESLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQ 96
           +S+P L + P+  A E  T L+++  PA+ H +   Y+Q
Sbjct: 136 KSVPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQ 174

>Kwal_33.14659
          Length = 1678

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 51/105 (48%), Gaps = 3/105 (2%)

Query: 1336 LLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTTLLNYVDAICFN--DLI 1393
            +L+ I  S       ++  FF +    +++ + ENEV ++ +  + N  D I  +  DLI
Sbjct: 1040 ILHAILFSSTSSEASNVGLFFKTFLEKLEALRKENEVSNENLKRIFNIHDMITEDIIDLI 1099

Query: 1394 MKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSK 1438
             ++N++S + G++   N+  +    + H +   T  ++ LI   K
Sbjct: 1100 SEKNYMSIRNGIEFMKNLCAVFPVVEFH-ISQMTQAIERLISHDK 1143

>Kwal_23.3840
          Length = 784

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1352 ILTFFNSIYWSMKSFQIENEVFHKVVTTLLNYVDAICFNDLI-MKRNFLSWKRGLQLNYN 1410
            I+  F ++ + +   Q+   +  + ++  + +  A  FN +I  K+  LS    +Q+  N
Sbjct: 452  IVQIFGALTYVLDLHQVHPLIAQQCLSLAVEWFSATLFNRIIDNKKKSLSRAHAVQIRLN 511

Query: 1411 VTRLEEWCKTH 1421
            ++ +++W K H
Sbjct: 512  ISVIQDWIKNH 522

>CAGL0K04037g 372546..378239 tr|Q9P8N8 Candida glabrata 1,
           3-beta-glucan synthase, identified start
          Length = 1897

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 14/98 (14%)

Query: 303 VKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSSDE 362
           V IE ++D       +D     G   ++ ++IF +   LL     + + +R    +S D+
Sbjct: 179 VSIEQIED-----VFIDLTNKFGFQRDSMRNIFDLFMTLL-----DSRTSR----MSPDQ 224

Query: 363 ENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLN 400
             L +  + +G D+ N+ KW    Q+    E    N+N
Sbjct: 225 ALLSVHADYIGGDTANYKKWYFAAQLDMDDEVGFRNMN 262

>AAL093C [94] [Homologous to ScYPL164C (MLH3) - SH] (177137..179341)
           [2205 bp, 734 aa]
          Length = 734

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 50/112 (44%), Gaps = 4/112 (3%)

Query: 277 GLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFK 336
           G + ++  E  L    D  ++  GG   +     +++YN  V ++     + +  +H+ K
Sbjct: 393 GKTDQDAPESSLHSGTDARHLLNGGINPVNQHPKRKKYNPPVASMNSSADATKILEHVAK 452

Query: 337 ILAALLHIGNIEIKKTRNDASLSSDEENLKIACELLGIDSFNFAKWITKKQI 388
           I    +++G + ++K     S+SS   +L  + E L +DS      I   QI
Sbjct: 453 IRTRNINVG-LPVQKPVGSGSISS---SLAFSDEHLSVDSIQLKDCIVINQI 500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 48,977,594
Number of extensions: 2198462
Number of successful extensions: 10099
Number of sequences better than 10.0: 243
Number of HSP's gapped: 10104
Number of HSP's successfully gapped: 366
Length of query: 1542
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1427
Effective length of database: 12,615,039
Effective search space: 18001660653
Effective search space used: 18001660653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)