Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E05302g82981735440.0
YOR329C (SCD5)8725849241e-111
Scas_663.247375358218e-98
Kwal_26.70526325197203e-84
KLLA0F02596g6584525653e-62
ADR356C8064665592e-60
CAGL0G08360g889188790.31
AFR616W66753770.44
AFL095W253567770.60
CAGL0J01892g137446712.3
AFL092C93567712.4
Kwal_23.539567863694.7
YOR217W (RFC1)86151668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E05302g
         (817 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E05302g complement(514064..516553) weakly similar to sp|P34...  1369   0.0  
YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy...   360   e-111
Scas_663.24                                                           320   8e-98
Kwal_26.7052                                                          281   3e-84
KLLA0F02596g 235864..237840 some similarities with sp|P34758 Sac...   222   3e-62
ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH] (1333929..1...   219   2e-60
CAGL0G08360g complement(789119..791788) similar to sp|P22543 Sac...    35   0.31 
AFR616W [3808] [Homologous to ScYBR260C (RGD1) - SH] complement(...    34   0.44 
AFL095W [3100] [Homologous to ScYHR211W (FLO5) - NSH] complement...    34   0.60 
CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces c...    32   2.3  
AFL092C [3101] [Homologous to ScYHR211W (FLO5) - NSH] (269106..2...    32   2.4  
Kwal_23.5395                                                           31   4.7  
YOR217W (RFC1) [5010] chr15 (749301..751886) DNA replication pro...    30   8.6  

>CAGL0E05302g complement(514064..516553) weakly similar to sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency, start by similarity
          Length = 829

 Score = 1369 bits (3544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/817 (84%), Positives = 694/817 (84%)

Query: 1   MSFDWLNVPGLNTATDDRQNSTLPTVSFDFGVTDDSSKEQGMHFLDETMKSSSDPSLVRK 60
           MSFDWLNVPGLNTATDDRQNSTLPTVSFDFGVTDDSSKEQGMHFLDETMKSSSDPSLVRK
Sbjct: 1   MSFDWLNVPGLNTATDDRQNSTLPTVSFDFGVTDDSSKEQGMHFLDETMKSSSDPSLVRK 60

Query: 61  LDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEEDSYV 120
           LDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEEDSYV
Sbjct: 61  LDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEEDSYV 120

Query: 121 ETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQFLANFNVREELK 180
           ETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQFLANFNVREELK
Sbjct: 121 ETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQFLANFNVREELK 180

Query: 181 KRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILNKXXXX 240
           KRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILNK    
Sbjct: 181 KRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILNKEGGN 240

Query: 241 XXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGXXXXXXXXXXXXXXXXXXXX 300
                   DVPASSGTTTSNNQPPGEKVDFDSFASLLLTG                    
Sbjct: 241 EFYEEVEEDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGKTVRKRIRRKVKNSVFKNKK 300

Query: 301 XXXAEKVTFQDAPHYGKDKQNKXXXXXXXXXXXXXXXXEPLDLSLPMDQLLKVIAKRKKN 360
              AEKVTFQDAPHYGKDKQNK                EPLDLSLPMDQLLKVIAKRKKN
Sbjct: 301 VRFAEKVTFQDAPHYGKDKQNKDTSTTTDDDSSYVSTDEPLDLSLPMDQLLKVIAKRKKN 360

Query: 361 SALVSSVPXXXXXXXXXXXILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQSTIFNTGY 420
           SALVSSVP           ILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQSTIFNTGY
Sbjct: 361 SALVSSVPTEQQETEEEREILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQSTIFNTGY 420

Query: 421 KVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQVPAIQA 480
           KVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQVPAIQA
Sbjct: 421 KVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQVPAIQA 480

Query: 481 TSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQSTGNQLNQP 540
           TSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQSTGNQLNQP
Sbjct: 481 TSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQSTGNQLNQP 540

Query: 541 THLDLRNRSPLQNLPHQSQQQHLVPQAVNSXXXXXXXXXXXXXXXXVHQSTQQHINNSLQ 600
           THLDLRNRSPLQNLPHQSQQQHLVPQAVNS                VHQSTQQHINNSLQ
Sbjct: 541 THLDLRNRSPLQNLPHQSQQQHLVPQAVNSQPQQQQLHQQGILQPQVHQSTQQHINNSLQ 600

Query: 601 QHLPNNNPTNLSAPNANLNSPPLESPGMLYASNAASNYFXXXXXXXXXXXXXXXNIHTTI 660
           QHLPNNNPTNLSAPNANLNSPPLESPGMLYASNAASNYF               NIHTTI
Sbjct: 601 QHLPNNNPTNLSAPNANLNSPPLESPGMLYASNAASNYFQSLLSNSPSPNASQANIHTTI 660

Query: 661 NSNMSSGIQPNRQPNVQSNANGHLSPNVSYGNNMQMSTXXXXXXXXXXXXXXXXXXPVYS 720
           NSNMSSGIQPNRQPNVQSNANGHLSPNVSYGNNMQMST                  PVYS
Sbjct: 661 NSNMSSGIQPNRQPNVQSNANGHLSPNVSYGNNMQMSTQGLQNQGSNMQQMQSQQLPVYS 720

Query: 721 NPTGTTNYQYPGPGSLQRQNSQPVNSQAHRPSFSSMLPPQQQYFQSDTQNTNYQNQGHAN 780
           NPTGTTNYQYPGPGSLQRQNSQPVNSQAHRPSFSSMLPPQQQYFQSDTQNTNYQNQGHAN
Sbjct: 721 NPTGTTNYQYPGPGSLQRQNSQPVNSQAHRPSFSSMLPPQQQYFQSDTQNTNYQNQGHAN 780

Query: 781 QHIPIXXXXXXXXXXXXIPTGQMSTQDILGDLQSLKN 817
           QHIPI            IPTGQMSTQDILGDLQSLKN
Sbjct: 781 QHIPINNNNQSYHNMQNIPTGQMSTQDILGDLQSLKN 817

>YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy
           suppressor of lethality caused by clathrin deficiency
           [2619 bp, 872 aa]
          Length = 872

 Score =  360 bits (924), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 236/584 (40%), Positives = 307/584 (52%), Gaps = 97/584 (16%)

Query: 1   MSFDWLNVPGLNTATDD----RQNSTL--PTVSFDFGVTDDSSKEQGMHFLDETMKSSSD 54
           MSFDWLNVPGL+ ++ D    R ++ L  P+VSFDFG+  +++      F D+  +S SD
Sbjct: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGI--NTAAPHDSSFWDQGSRSHSD 58

Query: 55  PSLVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHE 114
            +L  + + +N+  D                               +N++  +  NP + 
Sbjct: 59  TTLSYRNNHSNTAAD-----------------------------NATNVSSPQKDNPPNG 89

Query: 115 E------EDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQ 168
           E       D Y E+P+D++VPLSLSQNQLTHEE+RTY+RWY+YI  RTHGKL++L DVF+
Sbjct: 90  EVRTLSGGDVYAESPEDMQVPLSLSQNQLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFR 149

Query: 169 FLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIP 228
           FL NFN+ +++K RI +IFRSCKNALNIGQFFAVLRL++RA++  +LP R+MILEKAP+P
Sbjct: 150 FLTNFNLSQKVKDRIVEIFRSCKNALNIGQFFAVLRLVSRAIIYGILPLRRMILEKAPVP 209

Query: 229 RPRPILNKXXXXXXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGXXXXXXXX 288
           +PRPIL+             D   SS  T        +KVDFDSFASLLLTG        
Sbjct: 210 KPRPILSSENHEEVYEEVEDD--DSSAKTGD------QKVDFDSFASLLLTGKTTRKRVR 261

Query: 289 XXXXXXXXXXXXXXXAEKVTFQDAPHYGKDKQN----KXXXXXXXXXXXXXXXXEPLDLS 344
                          +E +TFQD P+  ++  N    +                 PLD +
Sbjct: 262 RRIKNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEARKQDPDAEDEDQDSNNDSPLDFT 321

Query: 345 LPMDQLLKVIAKRKKNSALVSSVPXXXXXXXXXXXILSDMKDSLSHFKQIQGPDSVTQIP 404
           LPMDQLLK + KR+KNS LVSS+P           +L DMKDSLSHFKQIQ  DS + +P
Sbjct: 322 LPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVLEDMKDSLSHFKQIQTVDSAS-LP 380

Query: 405 PLVAQGQQSTIFNTGYKVTGDQPPAQTTSQPQEPV------------------------- 439
                 Q      T   V     P Q   +P +P                          
Sbjct: 381 ISSVFLQNGNTLPTS-NVNNTTVPQQLPLEPLKPTATGSANHLVREEYNQGLHPSNGAIQ 439

Query: 440 --LEPLKPTATGSANHLMKSHMS-PNSIPGAFDSQPVQVPAIQATSSDVLEPLKPTATGS 496
             L+PLKPTATGSAN+LM+SHM  P SI      +P   P    T+S  L+PLKPTATGS
Sbjct: 440 TGLQPLKPTATGSANYLMRSHMEQPQSI------KPSSTPET-VTNSGGLQPLKPTATGS 492

Query: 497 ANYLMKQQFKPVDNQQTSGNI-----GHVASPQPVGVTFQSTGN 535
           ANYLMKQ   P  N   S           +SPQ  G  F ++ N
Sbjct: 493 ANYLMKQHISPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLNSPN 536

>Scas_663.24
          Length = 737

 Score =  320 bits (821), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 219/535 (40%), Positives = 281/535 (52%), Gaps = 100/535 (18%)

Query: 1   MSFDWLNVPGLNTATDDRQ-----------------NSTL--PTVSFDFGVTDDSSKEQG 41
           MSFDWLN+PGLNT  +                    N +L  P+VSFDFG   + +   G
Sbjct: 1   MSFDWLNIPGLNTEDNTNINNNNNTGASTNNGPGGLNGSLGPPSVSFDFGFPMNGNNT-G 59

Query: 42  MHFLDETMKSSSDPSLVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKS 101
           +  +D++++S SD S+V                           S +A++          
Sbjct: 60  LPTMDQSVRSQSDTSIVNM------------------------SSTDAVS---------- 85

Query: 102 NINGNRYHNPIHEEEDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLI 161
                            Y ET DDLRVPLSLSQ QLT+EELRTY+RWYNYI A+THGKL+
Sbjct: 86  ----------------DYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLV 129

Query: 162 KLADVFQFLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMI 221
           +L DVF+FL NFN+ ++LK RI  IFRSCKNALNIGQFFAVLRL+++A+L+++LP+RKMI
Sbjct: 130 RLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMI 189

Query: 222 LEKAPIPRPRPILNKXXXXXXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGX 281
           L+KAPIP+P+PI+              +V   +  T + N     KVDFDSF SLLLTG 
Sbjct: 190 LDKAPIPKPKPII--TISTDNDQEVYEEVDEDTPNTANGNNNENGKVDFDSFTSLLLTGR 247

Query: 282 XXXXXXXXXXXXXXXXXXXXXXAEKVTFQDAPHYGKDKQ---------NKXXXXXXXXXX 332
                                 AE +TFQ+ P      +         N+          
Sbjct: 248 TARKRIRRKIKNAVFKNKRVRFAEHITFQEPPKPNSGNENNNNNAMILNQTTNNNNMDDS 307

Query: 333 XXXXXXEPLDLSLPMDQLLKVIAKRKK-NSALVSSVPXXXXXXXXXXXILSDMKDSLSHF 391
                  PLDLSLPMDQLLK +A RKK NSALVS++P           +L DMKDSLSHF
Sbjct: 308 SSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNEQQETEEEKEVLEDMKDSLSHF 367

Query: 392 KQIQGPDSVTQIPPLVAQGQQSTIFNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATGSA 451
           K I   DS T +P   +  Q   + N    +  + P     S  Q P L+PLKPTATGSA
Sbjct: 368 KNITTVDSATLLPDSTSTMQPMYMNNENNALNQNNP-----SMNQVP-LQPLKPTATGSA 421

Query: 452 NHLMKSHMSPNSIPGAFDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMKQQFK 506
           NHL +   + N+ P + DS   Q+P         L+PLKPTATGSANYL +  F+
Sbjct: 422 NHLFRQEFAQNTNPIS-DSN--QMP---------LQPLKPTATGSANYLFRSYFE 464

>Kwal_26.7052
          Length = 632

 Score =  281 bits (720), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 197/519 (37%), Positives = 260/519 (50%), Gaps = 102/519 (19%)

Query: 1   MSFDWLNVPGLNTATDDRQNSTLP--TVSFDFGVTDDSSKEQGMHFLDETMKSSSDPSLV 58
           MSFDWLNVPGL +   D   ++ P  +VSF+FG       EQ    +  T          
Sbjct: 1   MSFDWLNVPGLPSDDGDYAGASEPPPSVSFNFGNVSLEPVEQRSQSITTT---------- 50

Query: 59  RKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEEDS 118
            K D  NS  +   VS         +R+Q       DH  +   +N              
Sbjct: 51  -KHDRVNSTHEASQVS---------NRTQ-------DHHGESQLVN-------------- 79

Query: 119 YVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQFLANFNVREE 178
           Y ET +DL+VPLSLS++QLT EE RTY+RWY YI++R   KLI L D+F+F+ NF + E 
Sbjct: 80  YAETKEDLQVPLSLSKSQLTREEARTYLRWYGYISSRKEAKLISLDDIFRFMGNFPLAEM 139

Query: 179 LKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILNKXX 238
            K+RI +IF++C+N+LNIGQFFA+LRL++RA+ E+++P R+MI + AP+P+P+ IL    
Sbjct: 140 AKERIERIFKTCRNSLNIGQFFAILRLISRALTENVMPMRRMISQAAPVPKPKSIL---- 195

Query: 239 XXXXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGXXXXXXXXXXXXXXXXXX 298
                     +V  S          P  KVDFDSFASLLLTG                  
Sbjct: 196 -AAGNEEVYEEVEDSQDG-------PELKVDFDSFASLLLTGQKKKKMRRRITNHHKKQK 247

Query: 299 XXXXXAEKVTFQDAPHYGKDKQNKXXXXXXXXXXXXXXXXEPLDLSLPMDQLLKVIAKRK 358
                 + VTFQD      D+                   EPLDLSLPMDQLLK +A R+
Sbjct: 248 RVRFTDKLVTFQDHAQPKTDE-------NASEGNGVPDDNEPLDLSLPMDQLLKKLAARR 300

Query: 359 KNSALVSS-VPXXXXXXXXXXXILSDMKDSLSHFKQIQGPDSVT--QIPPLVAQGQQSTI 415
            NSALVS               +L DM++SL+HF+QI   DSV+   +P  V+  Q++ +
Sbjct: 301 NNSALVSKPPSEQEPESQEEKEVLDDMRESLNHFQQIHNVDSVSVGGLPAQVSTVQKNAV 360

Query: 416 FNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQV 475
                                E  LEPLKPTATGSAN+L +S                Q 
Sbjct: 361 --------------------AENHLEPLKPTATGSANYLFRSSQQ-------------QT 387

Query: 476 PAIQATSSDVLEPLKPTATGSANYLMK--QQFKPVDNQQ 512
           P  Q T S+ L+PLKPTATGSANYL +  QQ  P  +Q+
Sbjct: 388 P--QVTISEPLQPLKPTATGSANYLFRSSQQSAPAADQK 424

>KLLA0F02596g 235864..237840 some similarities with sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency singleton, hypothetical start
          Length = 658

 Score =  222 bits (565), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 155/452 (34%), Positives = 221/452 (48%), Gaps = 68/452 (15%)

Query: 94  EDHKTQKSNINGNRYHNPIHEEEDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYIT 153
           +D +++   I+G  + +   +   SYVET  +L+VPL++ + QLT +E + Y+RW+  ++
Sbjct: 73  QDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDERKAYLRWFRDLS 132

Query: 154 ARTHGKLIKLADVFQFLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLED 213
           +R H + I L DVF FLANF + + +K+RI  IFR+C+ A+N  QF+A++RL+A  + + 
Sbjct: 133 SRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYAIIRLVAHGLQQH 192

Query: 214 MLPSRKMILEKAPIPRPRPILNKXXXXXXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSF 273
            LP+R MI EKAP+ RP+ IL+             D           N    +KVDFD F
Sbjct: 193 FLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDP----------NNATDKKVDFDGF 242

Query: 274 ASLLLTGXXXXXXXXXXXXXXXXXXXXXXXAEKVTF-QDAPHYGKDKQNKXXXXXXXXXX 332
           ASLLLTG                        +KV F ++   +  D   K          
Sbjct: 243 ASLLLTG------KAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGK 296

Query: 333 XXXXXXE-------------PLDLSLPMDQLL-KVIAKRKKNSALVSSVPXXXX-XXXXX 377
                 +              LDLSLPM+QLL K+ ++ + NSALV  +P          
Sbjct: 297 PAVTAPDNAASTESSPSDDSTLDLSLPMEQLLAKLSSRNRNNSALVKELPSDTQPETQEE 356

Query: 378 XXILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQSTIFNTGYKVTGDQPPAQTTSQPQE 437
             +L DMKDSLSHF+QIQ  DSVTQ+P  ++  + S                      +E
Sbjct: 357 REVLEDMKDSLSHFRQIQKVDSVTQLPNNMSSYESSNSSG------------------RE 398

Query: 438 PVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQVPAIQATSSD--VLEPLKPTATG 495
             LEPLKPTATGSAN+L +  + P+               I A  +D  +LEPLKPTATG
Sbjct: 399 QALEPLKPTATGSANYLFRQTVPPSH-------------NIDANKNDNHILEPLKPTATG 445

Query: 496 SANYLMKQQF---KPVDNQQTSGNIGHVASPQ 524
           SAN + K  F   KP ++    G       PQ
Sbjct: 446 SANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQ 477

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 485 VLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQSTGNQLNQPTHLD 544
            LEPLKPTATGSANYL +Q   P  N   + N  H+   +P+  T   + N++ +     
Sbjct: 400 ALEPLKPTATGSANYLFRQTVPPSHNIDANKNDNHIL--EPLKPTATGSANEIFKNI--- 454

Query: 545 LRNRSPLQNLPHQSQQQHLVP 565
            R   P ++LP Q +    VP
Sbjct: 455 FRRSKPAEHLPQQGRTAPFVP 475

>ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH]
           (1333929..1336349) [2421 bp, 806 aa]
          Length = 806

 Score =  219 bits (559), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 163/466 (34%), Positives = 224/466 (48%), Gaps = 110/466 (23%)

Query: 1   MSFDWLNVPGLNTATDDRQNSTL----PTVSFDFGVTDDSSKEQGMHFLDETMKSSSDPS 56
           MSFDWLNVPGLN   D  ++S      PTVSF+F      S+EQ                
Sbjct: 1   MSFDWLNVPGLNV-KDGPESSAGSAPPPTVSFNF------SEEQ---------------- 37

Query: 57  LVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEE 116
              + DE+  +                 R+Q+   T+E+++                   
Sbjct: 38  ---REDESAGR-----------------RTQD---TQEEYR------------------- 55

Query: 117 DSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKL-ADVFQFLANFNV 175
               ET +DLRVPLSLS +QL  EEL+TY  WY  + +R   + ++L  D+F+FL NF +
Sbjct: 56  ----ETAEDLRVPLSLSGSQLAPEELKTYRLWYKCMVSRRRSRTLRLEEDIFRFLGNFQL 111

Query: 176 REELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILN 235
            + +K+R   IFR+C+ A++ GQF+A++R +A A+  ++LP+R+MILE+A +P PR IL+
Sbjct: 112 SDSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILS 171

Query: 236 KXXXXXXXXXXXXDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGXXXXXXXXXXXXXXX 295
                        D P S+            +VDFDSFASLLLTG               
Sbjct: 172 LDAGPETYEEVEED-PKSAADN---------RVDFDSFASLLLTGKTVRKNIRRKINKRN 221

Query: 296 XXXXXXXXAEK-VTFQDAPHYGKDKQNKXXXXXXXXXXXXXXXXEPLDLSLPMDQLLKVI 354
                   +E  VTF +        +                  EPLD S+PMDQLLK +
Sbjct: 222 GRVKKVSFSENLVTFHE--------ELPEEEAAEDAADGSEDPNEPLDFSMPMDQLLKKM 273

Query: 355 AKRK-KNSALVSSVPXXXXXXXXXXXILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQS 413
           A+RK +N+ALVS  P            L+DM+DSL+HFK IQ  D+       VAQG  +
Sbjct: 274 AERKTRNTALVSEAPKQPETVEEREE-LADMRDSLNHFKHIQTADN-------VAQGSFA 325

Query: 414 TIFNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHM 459
           T +        D          +EP LEPLKPTATGSANHL +SHM
Sbjct: 326 TQYMASVSSNAD--------SGEEPALEPLKPTATGSANHLFRSHM 363

>CAGL0G08360g complement(789119..791788) similar to sp|P22543
           Saccharomyces cerevisiae YLR240w VPS34
           phosphatidylinositol 3-kinase, start by similarity
          Length = 889

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 39/188 (20%)

Query: 62  DEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNI-------NGNRYHNPIHE 114
           D +NSK  V   S           S + + T    +++  NI       N  ++ + IH 
Sbjct: 429 DTSNSKFTVVDFSS----------SSQMMKTRNTQRSESQNIMNSHIENNNPKFIHSIHS 478

Query: 115 EEDSYVETPDDLRVPLS--LSQNQLTHEELRTYIRWYNYITARTHGK--LIKLADVFQFL 170
           E+DS +E    +  PL+  L +  L ++ L  Y  W  YIT+ ++ +  L ++ + F   
Sbjct: 479 EDDSQIEELPVVISPLAEFLIRRALVNKRLGNYFYW--YITSESYDQPFLNQILESFLSR 536

Query: 171 ANFNVREELKK--RIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIP 228
            N N R E++K  ++  + R+C   +                L+D +  +K +L+     
Sbjct: 537 LNSNDRNEIEKQVKLLTLLRNCCEEIK--------------SLKDTVSKKKELLQTLLST 582

Query: 229 RPRPILNK 236
           + RP L K
Sbjct: 583 KVRPYLKK 590

>AFR616W [3808] [Homologous to ScYBR260C (RGD1) - SH]
           complement(1546778..1548781) [2004 bp, 667 aa]
          Length = 667

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 484 DVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQST-GN 535
           D+ E L+  A    N LMK+   PVD ++    I H ASP P G+  QST GN
Sbjct: 299 DLFEYLE--AYCKNNDLMKKNLVPVDYRKHPSMIRHNASPHPSGIGIQSTYGN 349

>AFL095W [3100] [Homologous to ScYHR211W (FLO5) - NSH]
           complement(260875..268482) [7608 bp, 2535 aa]
          Length = 2535

 Score = 34.3 bits (77), Expect = 0.60,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 468 FDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVG 527
           FD QP + P I AT++    P   T T +A Y     +   DNQ T+G +  + +P P G
Sbjct: 245 FDDQPNECPEIVATTT---HPYDGTETVTA-YTTLSTYTNSDNQLTTGRVVVINTPYPRG 300

Query: 528 VTFQSTG 534
            T  + G
Sbjct: 301 ETTTTNG 307

>CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces
           cerevisiae YIR006c PAN1, hypothetical start
          Length = 1374

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 10/46 (21%)

Query: 434 QPQEPVLEPLKPTATGSANHLMKSHMSPNSIPGAFDSQPVQVPAIQ 479
           Q  +PVLEPLKPTATG  N    + +  N          +++PAI+
Sbjct: 163 QGNQPVLEPLKPTATGFVNSFANNGLDNN----------LKIPAIR 198

>AFL092C [3101] [Homologous to ScYHR211W (FLO5) - NSH]
           (269106..271913) [2808 bp, 935 aa]
          Length = 935

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 468 FDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVG 527
           FD QP + P I AT++   +P   T T +A Y     +   DNQ T+G +  + +P P G
Sbjct: 238 FDDQPNECPEIVATTT---QPYDGTETVTA-YTTLSTYTNSDNQLTTGRVVVINTPYPRG 293

Query: 528 VTFQSTG 534
            T  + G
Sbjct: 294 ETTTANG 300

>Kwal_23.5395
          Length = 678

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 490 KPTATGSANYLMKQQFKPVDNQQTSGNIGHVASPQPVGVTFQSTGNQLNQPTHLDLRNRS 549
           KP    +A  L+K   + +D  +   + G V   +P+  T+ +  N+ N P HL+ R  +
Sbjct: 173 KPNGVSAAPPLVKLGTRVLDGSKPIVSKGRVGLSKPLIATYSNVINETNLPAHLEQRKIT 232

Query: 550 PLQ 552
           P++
Sbjct: 233 PIR 235

>YOR217W (RFC1) [5010] chr15 (749301..751886) DNA replication
           protein RFC large subunit [2586 bp, 861 aa]
          Length = 861

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 57  LVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNR 107
           LV+K +E + KL    VSG +L+++ + R ++ L T +   T    + GN+
Sbjct: 264 LVKKEEERSKKLAATRVSGGHLERDNVVREEDKLWTVKYAPTNLQQVCGNK 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,308,753
Number of extensions: 1020978
Number of successful extensions: 3612
Number of sequences better than 10.0: 78
Number of HSP's gapped: 3635
Number of HSP's successfully gapped: 92
Length of query: 817
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 707
Effective length of database: 12,788,129
Effective search space: 9041207203
Effective search space used: 9041207203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)