Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E05280g35134618390.0
CAGL0E05170g35234814510.0
Scas_574.937134410351e-140
YOL151W (GRE2)34234110251e-139
Scas_538.734734610081e-137
Scas_674.113463429841e-133
YGL157W3473429511e-128
Scas_680.63673499421e-126
YGL039W3483439361e-126
Scas_652.153503499221e-123
Scas_622.143873499191e-123
Sklu_2327.23463419141e-122
YDR541C3443399101e-122
Sklu_2244.23523438991e-120
Scas_702.203473368731e-116
Scas_550.43433398591e-114
Scas_630.133493418581e-114
Scas_601.53453458521e-113
Scas_617.13453478321e-110
Kwal_56.238633443436552e-83
KLLA0D11022g3593555805e-72
KLLA0D11000g3593575806e-72
Kwal_47.178723973575583e-68
Kwal_33.145663623574902e-58
KLLA0B14641g1671463618e-42
KLLA0B14663g76711591e-13
Sklu_2306.33492591054e-05
YGL001C (ERG26)349216920.002
YLL056C29840870.008
Kwal_14.77529539840.016
YBR019C (GAL10)699295800.069
Scas_652.19d341211790.075
KLLA0C18513g351263770.11
Scas_652.19d134447770.12
Scas_522.5692144770.14
CAGL0G00594g349218730.36
Scas_668.8349380720.50
KLLA0B09218g138543720.62
KLLA0F08415g688135691.4
CAGL0K07788g1374101672.8
Scas_591.9138639672.9
YHR027C (RPN1)993123663.2
Scas_688.181005119663.7
Kwal_23.36541392151645.5
KLLA0F09317g49374636.5
YBR115C (LYS2)1392103647.0
KLLA0B08371g26848627.0
Scas_641.19104643629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E05280g
         (346 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E05280g complement(511971..513026) similar to tr|Q12068 Sac...   712   0.0  
CAGL0E05170g complement(504611..505669) similar to tr|Q12068 Sac...   563   0.0  
Scas_574.9                                                            403   e-140
YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone ...   399   e-139
Scas_538.7                                                            392   e-137
Scas_674.11                                                           383   e-133
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...   370   e-128
Scas_680.6                                                            367   e-126
YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknow...   365   e-126
Scas_652.15                                                           359   e-123
Scas_622.14                                                           358   e-123
Sklu_2327.2 YGL157W, Contig c2327 8819-9859                           356   e-122
YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Prote...   355   e-122
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement        350   e-120
Scas_702.20                                                           340   e-116
Scas_550.4                                                            335   e-114
Scas_630.13                                                           335   e-114
Scas_601.5                                                            332   e-113
Scas_617.1                                                            325   e-110
Kwal_56.23863                                                         256   2e-83
KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyce...   228   5e-72
KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyce...   228   6e-72
Kwal_47.17872                                                         219   3e-68
Kwal_33.14566                                                         193   2e-58
KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces...   143   8e-42
KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57 Zygosaccharom...    66   1e-13
Sklu_2306.3 YGL001C, Contig c2306 4537-5586                            45   4e-05
YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 stero...    40   0.002
YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein ...    38   0.008
Kwal_14.775                                                            37   0.016
YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucos...    35   0.069
Scas_652.19d                                                           35   0.075
KLLA0C18513g complement(1636434..1637489) highly similar to sp|P...    34   0.11 
Scas_652.19d1                                                          34   0.12 
Scas_522.5                                                             34   0.14 
CAGL0G00594g 61223..62272 highly similar to sp|P53199 Saccharomy...    33   0.36 
Scas_668.8                                                             32   0.50 
KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1 Kluyverom...    32   0.62 
KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA Kluyv...    31   1.4  
CAGL0K07788g complement(773523..777647) highly similar to sp|P07...    30   2.8  
Scas_591.9                                                             30   2.9  
YHR027C (RPN1) [2314] chr8 complement(161722..164703) Non-ATPase...    30   3.2  
Scas_688.18                                                            30   3.7  
Kwal_23.3654                                                           29   5.5  
KLLA0F09317g 861757..863238 similar to sp|P32582 Saccharomyces c...    29   6.5  
YBR115C (LYS2) [304] chr2 complement(469704..473882) Alpha-amino...    29   7.0  
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    28   7.0  
Scas_641.19                                                            28   9.9  

>CAGL0E05280g complement(511971..513026) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 351

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE 60
           MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE
Sbjct: 1   MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE 60

Query: 61  IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK 120
           IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK
Sbjct: 61  IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK 120

Query: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180
           YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE
Sbjct: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180

Query: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP 240
           EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP
Sbjct: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP 240

Query: 241 QVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAG 300
           QVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAG
Sbjct: 241 QVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAG 300

Query: 301 EPGSNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
           EPGSNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN
Sbjct: 301 EPGSNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346

>CAGL0E05170g complement(504611..505669) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 352

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/348 (77%), Positives = 308/348 (88%), Gaps = 3/348 (0%)

Query: 1   MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE 60
           M + N+NTTVFVSGA+GFIAQH++RQLLDQNYKVIGSVRS EKGD+LKN IFK  +FNYE
Sbjct: 1   MASDNSNTTVFVSGATGFIAQHVVRQLLDQNYKVIGSVRSAEKGDHLKNVIFKGGDFNYE 60

Query: 61  IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK 120
           IVKDI+D  AFD VFEKHGKDIKVVLHTASP +F TT+ EKDLLIPAVNGTKGILESIKK
Sbjct: 61  IVKDISDPTAFDHVFEKHGKDIKVVLHTASPFHFNTTDIEKDLLIPAVNGTKGILESIKK 120

Query: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGK---ITEDSWNQDSWENCQTDAVRAYFGSKK 177
           YAAQTVERVVVTSSFA++TSTVDM   K     ITE+SWNQD+WE+CQ+D +R Y GSKK
Sbjct: 121 YAAQTVERVVVTSSFAANTSTVDMFYAKDSSKTITEESWNQDTWESCQSDPIRGYCGSKK 180

Query: 178 FAEEAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDD 237
           FAE+AAW+F N NKD+VKFKL+ ++PVYVFGPQN++EPGKK+LN SSEVIN LVHLKKDD
Sbjct: 181 FAEKAAWDFYNANKDSVKFKLSIINPVYVFGPQNYVEPGKKILNTSSEVINSLVHLKKDD 240

Query: 238 PLPQVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKI 297
           PLP+ A G+IDVRD+AKAHILAFQKDELI QRL+LH+GLFT QTLLD INEQFPEL+GKI
Sbjct: 241 PLPEFAGGHIDVRDVAKAHILAFQKDELIEQRLMLHAGLFTTQTLLDIINEQFPELKGKI 300

Query: 298 PAGEPGSNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           PAG+PG+  P+D LTP+DN+KTKKLLGFEF DLK  + DT+SQILEAE
Sbjct: 301 PAGKPGTGNPDDALTPVDNSKTKKLLGFEFIDLKKDLYDTISQILEAE 348

>Scas_574.9
          Length = 371

 Score =  403 bits (1035), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 253/344 (73%), Gaps = 5/344 (1%)

Query: 5   NNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKD 64
           ++ TTVFVSGASGFIA H++  LL+  YKVIGS RS EK D L        + +  IV D
Sbjct: 27  SSQTTVFVSGASGFIALHVVNDLLNAGYKVIGSARSQEKCDQLLAKFKNHPSLSMVIVPD 86

Query: 65  IADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQ 124
           I+DLNAFD VF+K+GK+IK+VLHTASP  F   +YEKDLLIPA+NGTK IL +IK+YAAQ
Sbjct: 87  ISDLNAFDDVFKKYGKEIKIVLHTASPFRFDVNDYEKDLLIPALNGTKSILNAIKQYAAQ 146

Query: 125 TVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAW 184
           TVERVV+TSS A+  +T+ M +    + E SWN  +WE CQTD V AY  SK FAE+AAW
Sbjct: 147 TVERVVITSSMAAQLNTIYMNDKSITVDETSWNDATWEGCQTDPVSAYCASKGFAEKAAW 206

Query: 185 EFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVAC 244
           +FL +NKD VKFKL+TV PVYVFGPQ   EP KKVLN SSE+INQ+V+  KD  L Q+  
Sbjct: 207 DFLKENKDQVKFKLSTVLPVYVFGPQLFPEPSKKVLNTSSEIINQIVNADKDTELMQMNG 266

Query: 245 GYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGS 304
           G+IDVRD+AKAH+LAFQKDE  G+RL L+ G+F+ Q  LD INE FP+L+GKIP G+PG+
Sbjct: 267 GFIDVRDVAKAHLLAFQKDECAGERLSLYGGMFSTQDFLDIINEDFPQLKGKIPVGKPGT 326

Query: 305 NKPEDLLT---PIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
            K  D++     I+N +TKKLLGFEF + +  +  +V QILE E
Sbjct: 327 GK--DVIENSYKINNERTKKLLGFEFINKRDCVDASVQQILETE 368

>YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone
           reductase involved in diamide tolerance and induced by
           osmotic stress, member of a family (Gre2p, Ygl039p,
           Ygl157p, Ydr541p) with similarity to plant
           dihydroflavonol-4-reductases [1029 bp, 342 aa]
          Length = 342

 Score =  399 bits (1025), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 200/341 (58%), Positives = 253/341 (74%), Gaps = 7/341 (2%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           +VFVSGA+GFIAQHI+  LL ++YKVIGS RS EK +NL  A   +  F+ E+V DI+ L
Sbjct: 2   SVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKL 61

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
           +AFD VF+KHGKDIK+VLHTASP  F  T+ E+DLLIPAVNG KGIL SIKKYAA +VER
Sbjct: 62  DAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVER 121

Query: 129 VVVTSSFASHTSTVDMCNTKGK---ITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185
           VV+TSS+A+     DM     K     E+SWN  +WE+CQ+D V AY GSKKFAE+AAWE
Sbjct: 122 VVLTSSYAA---VFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWE 178

Query: 186 FLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACG 245
           FL +N+D+VKF+L  V+PVYVFGPQ   +  KK LN S E++N L+HL  +D +P++  G
Sbjct: 179 FLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGG 238

Query: 246 YIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSN 305
           YIDVRD+AKAH++AFQK E IGQRL++    FT+Q +LD +NE FP L+G IP G+PGS 
Sbjct: 239 YIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSG 298

Query: 306 KPEDLL-TPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
              + L   +DN K+KKLLGF+FR+LK  I DT SQIL+ E
Sbjct: 299 ATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFE 339

>Scas_538.7
          Length = 347

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 246/346 (71%), Gaps = 7/346 (2%)

Query: 5   NNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKD 64
           +  TTVFVSGA+GFIA H++ +LL + YKVIGS RS EK D L      + + + EIV D
Sbjct: 2   STQTTVFVSGATGFIALHVVDKLLREGYKVIGSARSQEKCDELLQKFNYNPSISTEIVPD 61

Query: 65  IADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQ 124
           I++L AFD VF+KHG +IK+VLHTASP  F   +YEKDLLIPAVNGTK +L +IKKY AQ
Sbjct: 62  ISNLAAFDDVFKKHGHEIKIVLHTASPFRFDVNDYEKDLLIPAVNGTKSVLNAIKKYGAQ 121

Query: 125 TVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAW 184
           +VERVVVTSS A+  +          +TE+SWN  +WENCQTD +  Y  SK FAE AAW
Sbjct: 122 SVERVVVTSSVAAQINIKGANRDDLVLTEESWNDATWENCQTDPMAVYCASKTFAERAAW 181

Query: 185 EFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVAC 244
           +F+ +NKD V FKL+TV PVYVFGPQ   EP KK LN SSE+INQ+VH  KD  L Q+  
Sbjct: 182 DFIRENKDQVIFKLSTVLPVYVFGPQLFPEPSKKELNTSSEIINQIVHADKDTELMQLNG 241

Query: 245 GYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGS 304
           G+IDVRD+AKAH+LAFQKDE   QRL LH G+F  Q  LD INE F +LRGKIP G+PG+
Sbjct: 242 GFIDVRDVAKAHLLAFQKDECASQRLSLHGGMFATQDFLDIINEDFSQLRGKIPVGKPGT 301

Query: 305 NKPEDLLTP----IDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
            K   L+T     I+N KTKKLLGF F  L+  + D+VSQIL+ E+
Sbjct: 302 GK---LITSKGYQINNDKTKKLLGFPFIGLRECVDDSVSQILKMED 344

>Scas_674.11
          Length = 346

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/342 (57%), Positives = 239/342 (69%), Gaps = 7/342 (2%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           TVFVSGA+GFIA HI+  LL+  Y+VIGS RS EK   L      + + + E+VKDI+DL
Sbjct: 6   TVFVSGATGFIALHIVNDLLNAGYRVIGSARSQEKCGKLLEKFGNNPSLSMEVVKDISDL 65

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
           NAFD VF+KH KDI +VLHTASP  F TTEYEKDL+IPAVNGTK I  +IKKY AQTVER
Sbjct: 66  NAFDEVFKKHAKDITIVLHTASPFRFDTTEYEKDLIIPAVNGTKSIFNAIKKYGAQTVER 125

Query: 129 VVVTSSFASHTSTVDMCNTKGKITEDS-WNQDSWENCQTDAVRAYFGSKKFAEEAAWEFL 187
           VVVTSS A+       CN  G I ++S WN  +W NC TDAV AY  SK FAE  AW+FL
Sbjct: 126 VVVTSSGAAQIQPA-YCNRDGLIVDESTWNDCAWANCTTDAVTAYCASKTFAERVAWDFL 184

Query: 188 NKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYI 247
            +NK  VKFKL+TV PV VFGPQ   EP K  LN SSE+IN+LVH  KD    Q   GYI
Sbjct: 185 RENKGQVKFKLSTVMPVNVFGPQMFPEPSKTTLNTSSEIINKLVHTNKDTEWDQFNGGYI 244

Query: 248 DVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSNKP 307
           DVRD+++AH+ AF+K+E  G+RL L  G+F  Q +LD IN+ FP+L+GKIP G PG+ K 
Sbjct: 245 DVRDVSRAHLCAFEKEECAGERLSLFGGMFATQDILDIINDDFPQLKGKIPVGRPGTGK- 303

Query: 308 EDLLTP---IDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
            +L T    I+N +TK LLGFEF  L+  + D+V QILE E+
Sbjct: 304 -ELTTKGFQINNERTKILLGFEFIGLRQSVDDSVRQILEVES 344

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score =  370 bits (951), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 187/342 (54%), Positives = 243/342 (71%), Gaps = 2/342 (0%)

Query: 7   NTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIA 66
           +TTVFVSGA+GFIA HI+  LL   Y VIGS RS EK D L      +   + EIV+DIA
Sbjct: 4   DTTVFVSGATGFIALHIMNDLLKAGYTVIGSGRSQEKNDGLLKKFNNNPKLSMEIVEDIA 63

Query: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTV 126
             NAFD VF+KHGK+IK+VLHTASP +F TT +EKDLL PAVNGTK ILE+IKKYAA TV
Sbjct: 64  APNAFDEVFKKHGKEIKIVLHTASPFHFETTNFEKDLLTPAVNGTKSILEAIKKYAADTV 123

Query: 127 ERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEF 186
           E+V+VTSS A+  +  DM      ITE+SWN+D+W++CQ +AV AY GSKKFAE+ AWEF
Sbjct: 124 EKVIVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAVAAYCGSKKFAEKTAWEF 183

Query: 187 LNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGY 246
           L +NK +VKF L+T++P +VFGPQ   +  K  +N SS ++++L+H K           +
Sbjct: 184 LKENKSSVKFTLSTINPGFVFGPQMFADSLKHGINTSSGIVSELIHSKVGGEFYNYCGPF 243

Query: 247 IDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEP--GS 304
           IDVRD++KAH++A +K E  GQRL+L  GLF  Q ++D +NE+FP+L+GKI  GEP  G 
Sbjct: 244 IDVRDVSKAHLVAIEKPECTGQRLVLSEGLFCCQEIVDILNEEFPQLKGKIATGEPATGP 303

Query: 305 NKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
           +  E      DN+KTKKLLGF+F +LK  I DT +Q+LE +N
Sbjct: 304 SFLEKNSCKFDNSKTKKLLGFQFYNLKDCIVDTAAQMLEVQN 345

>Scas_680.6
          Length = 367

 Score =  367 bits (942), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 243/349 (69%), Gaps = 4/349 (1%)

Query: 1   MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE 60
           +  A  NTTVFVSGASGFIAQHII+ LL+Q+YKVIGSVRS EK  ++ +    + N N E
Sbjct: 16  IMVATQNTTVFVSGASGFIAQHIIKLLLEQDYKVIGSVRSQEKAKHVLSNFNHNPNLNLE 75

Query: 61  IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK 120
           IVKD+ADL AFD VF+KHGK+IK+VLH ASP+ F   + EKD+LIPAVNG K IL +I K
Sbjct: 76  IVKDLADLTAFDEVFQKHGKEIKIVLHPASPVTFEVNDLEKDVLIPAVNGVKSILNAILK 135

Query: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180
           YA QTVERVV TSS  +  +     +    I E+SWN  +WENCQ DAV AY GSK FAE
Sbjct: 136 YAPQTVERVVYTSSAMAQFNPAGKFSKDTLIDENSWNDATWENCQIDAVNAYSGSKAFAE 195

Query: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP 240
            AAW+F+ ++ + VKFKL TV P YV GPQ  I+  K  LN SSE+IN +VH   D  LP
Sbjct: 196 RAAWDFMKEHGNEVKFKLTTVLPTYVLGPQMKIDVSKGKLNSSSELINAVVHATSDAELP 255

Query: 241 Q---VACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKI 297
               +   ++DVRD+AKA +LAFQKD  I +RL L +G++T+Q +LD +++ FPEL GK+
Sbjct: 256 SFNPMMGVFVDVRDVAKAELLAFQKDGCIDKRLSLAAGVYTLQDVLDLVHKDFPELNGKV 315

Query: 298 PAGEPG-SNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           PAG PG      D L   +N +TKK+LGF+F D +    D+++QIL+AE
Sbjct: 316 PAGNPGVRGVTADELFSFNNDETKKVLGFKFIDFQKSAHDSIAQILDAE 364

>YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1047 bp, 348 aa]
          Length = 348

 Score =  365 bits (936), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 239/343 (69%), Gaps = 6/343 (1%)

Query: 8   TTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIAD 67
           T VFVSGA+GFIA H++  LL   YKVIGS RS EK D L      + N + EIV+DIA 
Sbjct: 6   TVVFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKFKSNPNLSMEIVEDIAA 65

Query: 68  LNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVE 127
            NAFD VF+KHGK+IKVVLH ASP++F TT++EKDLLIPAVNGTK ILE+IK YAA TVE
Sbjct: 66  PNAFDKVFQKHGKEIKVVLHIASPVHFNTTDFEKDLLIPAVNGTKSILEAIKNYAADTVE 125

Query: 128 RVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFL 187
           +VV+TSS A+  S  DM +T   + E+SWN+D+WE+CQ +AV AY GSKKFAE+ AW+FL
Sbjct: 126 KVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKTAWDFL 185

Query: 188 NKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYI 247
            +N+ ++KF L+T++P +VFGPQ   +  +  +N SS +I  LV  K  D     +  +I
Sbjct: 186 EENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLVSYKLGDNFYNYSGPFI 245

Query: 248 DVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSNKP 307
           DVRD++KAH+LAF+K E  GQRL L   +F  Q  LD +NE+FP+L+GKI  GEPGS   
Sbjct: 246 DVRDVSKAHLLAFEKPECAGQRLFLCEDMFCSQEALDILNEEFPQLKGKIATGEPGSGST 305

Query: 308 EDLLT----PIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
              LT      DN KTK LLGF+F   +  I DT SQ+LE ++
Sbjct: 306 --FLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQLLEVQS 346

>Scas_652.15
          Length = 350

 Score =  359 bits (922), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 188/349 (53%), Positives = 245/349 (70%), Gaps = 10/349 (2%)

Query: 4   ANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK 63
           + + +TVFVSGASGFIAQHII  LL+QNYKVIGSVRS EK +++ +    + N   EIVK
Sbjct: 2   STSKSTVFVSGASGFIAQHIISLLLEQNYKVIGSVRSNEKAEHVLSNFNHNPNLTLEIVK 61

Query: 64  DIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAA 123
           D+A L AFD VF+KHG +IK+VLH ASP+ F    +EKD+LIPAVNG K +L +I KYA 
Sbjct: 62  DLASLTAFDEVFKKHGDEIKIVLHAASPVVFQVDNFEKDILIPAVNGVKSMLNAILKYAP 121

Query: 124 QTVERVVVTSSFASHTSTVDMC--NTKG-KITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180
           QTVER++ TSS  +     + C  N KG K+ E +WN  +WENCQT+A+ AY  SK FAE
Sbjct: 122 QTVERLIYTSSIVAQ---FNPCGENEKGMKLDETTWNDATWENCQTNAINAYSASKTFAE 178

Query: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP 240
           +AAWEF+ K+ + VKFKL T+ P YV GPQ  I+     LN+SSE+IN +VH +++  LP
Sbjct: 179 KAAWEFMKKHGNEVKFKLTTILPSYVLGPQLKIDLSNGKLNLSSELINSIVHAREESQLP 238

Query: 241 QVAC--GY-IDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKI 297
            ++   GY IDVRD+AKA +LAFQKDE IG+RL L SG F++Q +L+ I++ FPEL GK+
Sbjct: 239 TLSSRLGYFIDVRDVAKAELLAFQKDECIGKRLSLTSGTFSIQRILNVIHKDFPELNGKV 298

Query: 298 PAGEPG-SNKPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           P G P    +  D +    N +TKK LGFEF D KT + D+  QIL+AE
Sbjct: 299 PVGAPDLVEESADDIFDFSNEETKKALGFEFIDFKTSVDDSTRQILDAE 347

>Scas_622.14
          Length = 387

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 241/349 (69%), Gaps = 5/349 (1%)

Query: 1   MTAANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYE 60
           +  A N  TVFVSG +GF+A  I   LL   YKVIGSVRS ++ D        +      
Sbjct: 40  IIMAANQETVFVSGCNGFVATRITVDLLKAGYKVIGSVRSQDEIDQFIPHFKPTDALTLV 99

Query: 61  IVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKK 120
           IV+DI+ L +FD VF+++GK+IK VLHTASP    TTEY KDLLIPAVNGT+ ILE+IKK
Sbjct: 100 IVEDISVLGSFDEVFKQYGKEIKYVLHTASPFIIDTTEYVKDLLIPAVNGTQAILEAIKK 159

Query: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180
           YAA +VERVV+TSSFA+        +    ITE+SWN  +W++CQ D + AY  SK FAE
Sbjct: 160 YAADSVERVVITSSFAAQAGPKQWYDNSLTITEESWNPSTWDDCQVDGMTAYCASKVFAE 219

Query: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLP 240
           + AW+FL  N+  VKFK+ T++P +V+GPQ   +P KK++N SS++IN +VH KK+  + 
Sbjct: 220 KEAWKFLKDNESQVKFKITTINPGFVYGPQTFFDPKKKIMNTSSQIINHIVHSKKETDIN 279

Query: 241 QVACGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAG 300
           ++   ++DVRDI+K HILAFQK ELIG+RL + SG+F+ Q +LD +NE FP+L+GKIP G
Sbjct: 280 EIFGPFVDVRDISKGHILAFQKKELIGKRLSMVSGMFSSQGVLDIVNEDFPQLKGKIPVG 339

Query: 301 EPGSNKPEDLL---TPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
           +PG++    L+     + N +TKKLLGFEF DLK  I DTV QILE E 
Sbjct: 340 KPGTDAT--LIAKHCTVINDETKKLLGFEFIDLKQCIDDTVKQILEYET 386

>Sklu_2327.2 YGL157W, Contig c2327 8819-9859
          Length = 346

 Score =  356 bits (914), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/341 (53%), Positives = 233/341 (68%), Gaps = 5/341 (1%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           TVFVSGASG+IA H++ +LL+  YKVIGS RS +K   ++     + N    IV DIA+ 
Sbjct: 6   TVFVSGASGYIALHVVNELLNAGYKVIGSTRSDKKAAEVEKKFGNNPNLKTVIVPDIAEP 65

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
            AFD  FE++G +IKVVLH ASP  F TTEYEKDLL+PAVNGTK ILES+KKYA QTVE 
Sbjct: 66  GAFDHAFEEYGSEIKVVLHVASPFFFDTTEYEKDLLLPAVNGTKSILESVKKYAPQTVEN 125

Query: 129 VVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFLN 188
           VVVTSS A+  S   M      +TE  WN  +WE    D V AY  SKKFAEEAAW+FL 
Sbjct: 126 VVVTSSLAAIVSPKRMAEPNALVTEKDWNDTTWEGAGADPVTAYCASKKFAEEAAWKFLE 185

Query: 189 KNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYID 248
           +NK  VKF+L TV+P YVFGPQ   +    VLN S E+IN +VH K    +  ++  YID
Sbjct: 186 ENKSIVKFRLTTVNPGYVFGPQLSSDSVGDVLNTSCELINGIVHSKPGSEIQPISGPYID 245

Query: 249 VRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSNKPE 308
           VRD+AKAH+LAF+K+E  G+RL+L  G F++Q + D INE+FP+L+G +  GEPG+   E
Sbjct: 246 VRDVAKAHLLAFEKEETFGKRLMLVEGAFSLQQVADIINEEFPQLKGNVTTGEPGTG--E 303

Query: 309 DLL---TPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
           +LL      D +KTK +LGF+ R+LK  + DTV QIL+ E+
Sbjct: 304 ELLNKSAKYDPSKTKAILGFKLRNLKETVYDTVDQILKVED 344

>YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Protein
           with high similarity to S. cerevisiae Gre2p, which is an
           alpha-acetoxy ketone reductase that is involved in
           diamide tolerance and is induced by osmotic stress [1035
           bp, 344 aa]
          Length = 344

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 182/339 (53%), Positives = 234/339 (69%), Gaps = 1/339 (0%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           TV VSGASGFIA HI+ QLL Q+YKVIG+VRS EK   L      + N   EIV DI+  
Sbjct: 4   TVLVSGASGFIALHILSQLLKQDYKVIGTVRSHEKEAKLLRQFQHNPNLTLEIVPDISHP 63

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
           NAFD V +K G++I+ VLHTASP ++ TTEYEKDLLIPA+ GTK IL SIKKYAA TVER
Sbjct: 64  NAFDKVLQKRGREIRYVLHTASPFHYDTTEYEKDLLIPALEGTKNILNSIKKYAADTVER 123

Query: 129 VVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFLN 188
           VVVTSS  +  +   M +     TE+SWN+ +WE+CQ D + AYF SKKFAE+AAWEF  
Sbjct: 124 VVVTSSCTAIITLAKMDDPSVVFTEESWNEATWESCQIDGINAYFASKKFAEKAAWEFTK 183

Query: 189 KNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYID 248
           +N+D +KFKL TV+P  +FGPQ   E     LN S E+IN L+H   +  +P     +ID
Sbjct: 184 ENEDHIKFKLTTVNPSLLFGPQLFDEDVHGHLNTSCEMINGLIHTPVNASVPDFHSIFID 243

Query: 249 VRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGS-NKP 307
           VRD+A AH+ AFQK+   G+RL++ +G F  Q +LD +NE FP+LRG IP G+PG+ ++ 
Sbjct: 244 VRDVALAHLYAFQKENTAGKRLVVTNGKFGNQDILDILNEDFPQLRGLIPLGKPGTGDQV 303

Query: 308 EDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
            D  +  DN+ T+K+LGFEFR L   + DT +QIL+ EN
Sbjct: 304 IDRGSTTDNSATRKILGFEFRSLHESVHDTAAQILKKEN 342

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/343 (53%), Positives = 246/343 (71%), Gaps = 6/343 (1%)

Query: 7   NTTVFVSGASGFIAQHIIRQLLD-QNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDI 65
           +TTVFVSGA+GFIAQ++I +LL  + YKVIGS RS EK D L +  F ++N + EIV +I
Sbjct: 9   STTVFVSGATGFIAQYVIDELLKTEKYKVIGSARSQEKADKLLSQ-FSNSNLSMEIVPNI 67

Query: 66  ADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQT 125
           A+ +AFD +F K+ KDIKVVLHTASP  F + +++KDLLIPAVNGT  IL+++KKYAA T
Sbjct: 68  AEPDAFDHIFAKYAKDIKVVLHTASPFFFESKDFDKDLLIPAVNGTSSILKAVKKYAANT 127

Query: 126 VERVVVTSSFASHTSTVDMCNTKGK-ITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAW 184
           VERVV+TSS+A+   T +  + KG  I E+SWN  SWE  + D + AY  SK FAE   W
Sbjct: 128 VERVVITSSYAA-VCTFNEDSQKGNVINEESWNTMSWEEAKKDGIAAYCASKAFAERFVW 186

Query: 185 EFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQ-VA 243
           EF  +NK+ +KFKL+T++PV+VFGPQ   E     LN S E+IN++VH   D  + Q + 
Sbjct: 187 EFFEENKNELKFKLSTINPVFVFGPQLFNESVAAQLNTSCELINKIVHSSSDSEIDQTLF 246

Query: 244 CGYIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPG 303
            GYIDVRD+AKAHI AF++D+ IGQRL+L    FT+QTL D IN+ FP+LR KI  G+P 
Sbjct: 247 GGYIDVRDVAKAHICAFEQDDCIGQRLILAEERFTMQTLADIINQDFPQLRSKIAIGKPK 306

Query: 304 SN-KPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           S+ +    +  +DN+K++KLLGF+F  LK  + DTVSQ+L+ E
Sbjct: 307 SDVQVLSRIATLDNSKSRKLLGFDFIPLKQSVDDTVSQLLKVE 349

>Scas_702.20
          Length = 347

 Score =  340 bits (873), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 227/336 (67%), Gaps = 1/336 (0%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           TVFVSGA+G+IA H++  LL + Y VIGSVRS EK D++        N   EIV DI+ L
Sbjct: 6   TVFVSGATGYIALHVVDNLLKEGYSVIGSVRSQEKADHILKEFSNDCNLTLEIVPDISAL 65

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
           +AFD VF++HGKDIKVV+HTASP+ F   + +KDLLIPA+NGTK ILESIKKYAA TVE 
Sbjct: 66  DAFDDVFKRHGKDIKVVIHTASPVVFDPKDLDKDLLIPAINGTKSILESIKKYAADTVEN 125

Query: 129 VVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFLN 188
           VV+TSS A+     +  ++   I E+SWN  + E        AY  SK FAE+AAWEFL 
Sbjct: 126 VVITSSLAAQRKPSETNDSTVTIDENSWNNITMEEAHECVRNAYSASKVFAEKAAWEFLK 185

Query: 189 KNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYID 248
            N D VKFKL TV P +VFGPQ  ++  K   N + E++  + + K +D L Q +  Y+D
Sbjct: 186 NNADVVKFKLTTVMPGFVFGPQTFVDRSKSKFNHTIEIVRAIANAKTEDELYQCSGTYVD 245

Query: 249 VRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGS-NKP 307
           VRD+A+AH+LAFQK E  G+RL L + +F  Q++L+ INE FP+L+GKI  G+P S N+ 
Sbjct: 246 VRDVARAHLLAFQKKECAGERLSLSTSMFCTQSILNVINEDFPQLKGKITEGDPASENET 305

Query: 308 EDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILE 343
            D +   +N KTKKLLGF+F  L+  I DTV+Q+ E
Sbjct: 306 LDNMMSFNNDKTKKLLGFDFIPLRKSIDDTVNQLFE 341

>Scas_550.4
          Length = 343

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/339 (52%), Positives = 225/339 (66%), Gaps = 2/339 (0%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADL 68
           +VF+SGA+GF+AQHII QLL+QN+KVIGSVRS  K D L      + N + E+V+DI++L
Sbjct: 2   SVFISGATGFVAQHIINQLLEQNFKVIGSVRSQAKADKLLRQFNSNKNLSLEVVEDISNL 61

Query: 69  NAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVER 128
            AFD VF KHGK+IK VLHT+SP      +YEKDLLIPA+NGTKGIL SI KYAA  VER
Sbjct: 62  AAFDEVFSKHGKEIKYVLHTSSPFFTECDDYEKDLLIPALNGTKGILNSILKYAADNVER 121

Query: 129 VVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFLN 188
           VV+TSS A+        +      E+SWN DS++   TD   AY GSKKFAE  AW F+ 
Sbjct: 122 VVITSSIAAMFDFTRDLDPSYFYDENSWNPDSYQEALTDGGHAYNGSKKFAERYAWNFVQ 181

Query: 189 KNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACG-YI 247
           ++K+ +KFKL TV+P YVFGPQ   E     LN S E+IN+L+HL   D +     G ++
Sbjct: 182 EHKNEIKFKLTTVNPCYVFGPQLFDENVTAKLNTSCELINKLLHLSAGDAVDNFFVGNFV 241

Query: 248 DVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSNKP 307
           DVRD+AKAH+L F+   L+ +RLLL S  F  Q +LD +NE F  L G++PAG P +   
Sbjct: 242 DVRDVAKAHLLGFENQNLVDKRLLLISSRFNAQDILDIMNEDFKTLEGQLPAGVPHTGAL 301

Query: 308 EDLLTPI-DNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
                 I DN+KTK+LLGFEF  LK  I D V+QIL  E
Sbjct: 302 HQWKGAIADNSKTKELLGFEFIPLKKTIDDMVTQILRKE 340

>Scas_630.13
          Length = 349

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 227/341 (66%), Gaps = 4/341 (1%)

Query: 6   NNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDI 65
           N   + VSGA GFIA HI+  LL + Y VIGSVR+ E+   L      +      +V+DI
Sbjct: 5   NKNAILVSGADGFIALHIVNDLLQKGYTVIGSVRNPEEAALLMKDFNNNPKLIPVVVEDI 64

Query: 66  ADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQT 125
           + LN+FD VF+++G  IK VLH ASP++F +++   DLLIPA+NGT  +L +IK+YA Q+
Sbjct: 65  SKLNSFDHVFQEYGSQIKGVLHVASPVHFESSDVVNDLLIPALNGTTAVLNAIKEYAPQS 124

Query: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185
           VE+VV+TSSFA   S   M +    +TEDSWN  +WENCQ+D + AY  SKKFAE+AAW+
Sbjct: 125 VEKVVITSSFAGFVSPKQMADKNTVVTEDSWNDSTWENCQSDPISAYCASKKFAEKAAWD 184

Query: 186 FLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACG 245
           FL K K  VKF+LA + P +VFGPQ      K V+NVS E+IN++VH +  D +P    G
Sbjct: 185 FLEKYKSEVKFELAVISPGWVFGPQLFSRGVKPVMNVSCEIINKIVHARSIDDVPFEMMG 244

Query: 246 -YIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGS 304
            YIDVRD AKAHI A + D   G RL+L+ G FT Q +LD ++  FPE+   IP G PG+
Sbjct: 245 PYIDVRDTAKAHIFALENDSCNGHRLILNEGFFTAQEILDIVHNDFPEVGKDIPMGNPGT 304

Query: 305 NKP--EDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILE 343
            K   E+  T  DN+KT+K+LGF FRDLK  + DTV+QI+E
Sbjct: 305 GKKLLEERFTA-DNSKTRKILGFPFRDLKETVDDTVAQIIE 344

>Scas_601.5
          Length = 345

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 239/345 (69%), Gaps = 6/345 (1%)

Query: 4   ANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK 63
           A    TVFVSGA+GFIA++II+ LLDQNYKVIGSVRS EKG  +      +AN + EIVK
Sbjct: 2   AATQKTVFVSGATGFIAKYIIKLLLDQNYKVIGSVRSEEKGQEVLADFDHNANLSIEIVK 61

Query: 64  DIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAA 123
           D+A L AFD VF+KHGKDI++VLHTASP+ F   + EKD+LIPAVNG K IL +I ++A 
Sbjct: 62  DLASLTAFDEVFKKHGKDIQIVLHTASPVTFQVDDVEKDILIPAVNGVKSILNAILQFAP 121

Query: 124 QTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAA 183
           QTVER V+TSS A+  + +   +    ITE SWN  +WE CQTD++ AY GSK FAE+AA
Sbjct: 122 QTVERFVLTSSLAAQINPLAPDSKDKIITEKSWNDATWEGCQTDSMSAYAGSKTFAEKAA 181

Query: 184 WEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVA 243
           W+F+ ++ + VK K++ V P +VFGPQ  ++     L  S E IN +++ K   P P  +
Sbjct: 182 WDFMKEHGNEVKMKMSAVLPSFVFGPQLKMDFSSGHLRSSMEFINSIINGKL--PPPMFS 239

Query: 244 CG-YIDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEP 302
            G +IDVRD+AKA + AFQKDE IG+RL L S ++TVQ +LD I++ FPEL   +  G+P
Sbjct: 240 AGAFIDVRDVAKAELAAFQKDECIGKRLALESDMYTVQDILDYIHKNFPELAKIVQVGKP 299

Query: 303 GSNKPEDLLTP--IDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           GS + E L      +N +TKK+LGF+F  L+T + D++ QI +A+
Sbjct: 300 GS-RDEALKNSFKFNNDETKKVLGFQFIPLETTLHDSLKQIDDAK 343

>Scas_617.1
          Length = 345

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 233/347 (67%), Gaps = 9/347 (2%)

Query: 4   ANNNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK 63
           ++  +TVFVSGASGFIAQ+II+ LL+QNYKVIGSVRS  K   + +    + + ++ I++
Sbjct: 2   SSTQSTVFVSGASGFIAQNIIKLLLEQNYKVIGSVRSNNKAKQVHSTFENNPSLSFVIIE 61

Query: 64  DIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAA 123
           D++ L AFD VF+K+GKDIK+VLHTASP+ F  T+ EK +LIPAVNG K IL +I KYA 
Sbjct: 62  DLSKLTAFDEVFKKYGKDIKIVLHTASPVTFQATDLEKGILIPAVNGVKSILNAILKYAP 121

Query: 124 QTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAA 183
           QTVER V TSS  +  +          I E SWN  +WE  Q D++ AY  SK FAE AA
Sbjct: 122 QTVERFVYTSSVLAQVNPTWTDFKNVTINEKSWNDSTWEGSQVDSLTAYSASKAFAERAA 181

Query: 184 WEFLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVA 243
           W+F+ +  + VKFKL TV P +VFGP+  I P    LN+S E++  ++H   +  LP V 
Sbjct: 182 WDFMKEYGNEVKFKLTTVLPSFVFGPEVKIGPK---LNLSGEILKTIIHATSEKQLPSVD 238

Query: 244 CGY---IDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAG 300
                 +DVRD+A+AH+LAFQK+E IG+RL L   +FT+Q +LD I+  FP+L G +P  
Sbjct: 239 TVLRVSVDVRDVARAHMLAFQKEECIGKRLSLVENVFTLQDILDLIHTDFPDLSGNVPVR 298

Query: 301 EPGSNK--PEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
            P SN+  P++L    +N ++KK+LGF+F D KT + D++ QIL+A+
Sbjct: 299 APVSNEKMPKELFG-FNNDESKKILGFKFYDFKTSVHDSIKQILDAQ 344

>Kwal_56.23863
          Length = 344

 Score =  256 bits (655), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/343 (42%), Positives = 209/343 (60%), Gaps = 9/343 (2%)

Query: 9   TVFVSGASGFIAQHIIRQLL-DQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIAD 67
           TV ++GA+ ++AQHII  LL + NY VIG+VRS EK   L    F S     E+V D+  
Sbjct: 6   TVLITGANNYVAQHIINVLLKNSNYNVIGTVRSNEKAVKLSEN-FNSDRLKCEVVSDMGS 64

Query: 68  LNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVE 127
            NAFD VF K+   I  V+HTASP+NF  T+Y  +++ PAV G K +L SIK+Y++  V+
Sbjct: 65  QNAFDEVFSKYYTKITHVIHTASPVNFQATDYYSEVINPAVEGMKSLLNSIKRYSSYLVK 124

Query: 128 RVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWEFL 187
           RVVV SS+ +     D      KI E+SWN     +       AY  SK  AE+AAW+F+
Sbjct: 125 RVVVLSSYPALIPMADDTKAGLKINEESWNPFETGDPIHSPQEAYAASKTLAEKAAWKFM 184

Query: 188 NKNKDAVKFKLATVDPVYVFGPQNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQ-VACGY 246
            +N  +V+F+L T+ P +++GPQ      KK    S E   Q++  K DD + + V+   
Sbjct: 185 EENT-SVQFELTTIQPAFIWGPQVFFSEAKKRTPGSCEFFTQIIESKVDDAIDKSVSYPV 243

Query: 247 IDVRDIAKAHILAFQKDELIGQRLLLHSGLFTVQTLLDAINEQFPELRGKIPAGEPGSNK 306
           +DVRD+A+AH+LA +K  L G+RL+L++G    Q L D IN  F ELRG+I  G+ GS  
Sbjct: 244 VDVRDVAQAHLLALKKANLGGKRLILYAGRCNNQILADTINAHFDELRGRIARGDQGSG- 302

Query: 307 PEDLLT---PIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAEN 346
            E L+T    +++TK+K+LLGF+FR +   I DT +QIL++ N
Sbjct: 303 -EALITNAATLNDTKSKELLGFQFRSISETIIDTTTQILKSRN 344

>KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  228 bits (580), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 145/355 (40%), Positives = 198/355 (55%), Gaps = 23/355 (6%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFK---SANFNYEIVKDIA 66
           V ++GASGFIA H++ QLL   Y+V+G+VRS EK + +K  + K   +  + +E+V DIA
Sbjct: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64

Query: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEY-EKDLLIPAVNGTKGILESIKKYAAQT 125
             NAFD VF+KH  D+K VLHTASP +F  T+  E++ LIPA +GTK +LESI+KY  + 
Sbjct: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKY-GKN 122

Query: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185
           VE VVVTSSFA+        +      E +WN   WE+ + DA  +Y  SKK+AE+ AW+
Sbjct: 123 VEHVVVTSSFAAIVHRHRSGDPTFINDETTWNPVIWEDAREDAATSYVASKKYAEKLAWD 182

Query: 186 FLNKNKDAVKFKLATVDPVYVFGPQNH-IEPGKKVLNVSSEVINQLVHL--KKDDPLPQV 242
           F+  N     F L TV+P YVFGPQ       +  LN S++ +N+ +    + + P  Q 
Sbjct: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLARASLNTSADFVNKALKTTPEYEGPFNQP 240

Query: 243 ACGYIDVRDIAKAHILAFQKDELIGQRLL-----------LHSGLFTVQTLLDAINEQFP 291
           A    DVRD+AK H+L   K E  GQRL               G F  + +L  +NE+ P
Sbjct: 241 AGVACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300

Query: 292 ELRGKIPAGEPGSNKPE-DLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           EL+GKI  G    N+ E   LT   N  T       F  L+  I D   QIL+ E
Sbjct: 301 ELKGKISPGGIKDNEAELSKLTYYRNKITTDSTKLTFYKLEDTIYDAAKQILDYE 355

>KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  228 bits (580), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 145/357 (40%), Positives = 201/357 (56%), Gaps = 27/357 (7%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFK---SANFNYEIVKDIA 66
           V ++GASGFIA H++ QLL   Y+V+G+VRS EK + +K  + K   +  + +E+V DIA
Sbjct: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64

Query: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEY-EKDLLIPAVNGTKGILESIKKYAAQT 125
             NAFD VF+KH  D+K VLHTASP +F  T+  E++ LIPA +GTK +LESI+KY  + 
Sbjct: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKY-GKN 122

Query: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185
           VE V+VTSS+A+        +      E SWN  +WE  + ++V AY  SKK+AE+ AW+
Sbjct: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182

Query: 186 FLNKNKDAVKFKLATVDPVYVFGPQNH-IEPGKKVLNVSSEVINQLVHL--KKDDPLPQV 242
           F+  N     F L TV+P YVFGPQ       K  LN S++++NQ +    + + P  Q 
Sbjct: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240

Query: 243 ACGYIDVRDIAKAHILAFQKDELIGQRLL-----------LHSGLFTVQTLLDAINEQFP 291
           A    DVRD+AK H+L   K E  GQRL               G F  + +L  +NE+ P
Sbjct: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300

Query: 292 ELRGKIPAGEPGSNKPEDLLTPID---NTKTKKLLGFEFRDLKTIIQDTVSQILEAE 345
           EL+GKI  G    N+ E  L  +D   N  T  L    F   +  + D   QIL+ E
Sbjct: 301 ELKGKISPGGIKDNEAE--LAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDYE 355

>Kwal_47.17872
          Length = 397

 Score =  219 bits (558), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 204/357 (57%), Gaps = 29/357 (8%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNA---IFKSANFNYEIVKDIA 66
           V VSG +GF+A H++  LL + + VIG+VRS EK D ++ +   ++  A  + E+VKDI 
Sbjct: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100

Query: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEY-EKDLLIPAVNGTKGILESIKKYAAQT 125
              AFD VFEKH  DI+ VLHTAS  +F   +  E+  L+PA  GT+ ILES  K   Q 
Sbjct: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158

Query: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185
           V+R V+TSSFAS  +     ++    TE +WN  +WE  + +   AY  SKK AE  AW+
Sbjct: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218

Query: 186 FLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKK--VLNVSSEVINQLVHLKKDDPLP--- 240
           FL +++  V F L TV P Y++GPQ   E G +   LN S+E++N+ +    +   P   
Sbjct: 219 FLKEHEKEVGFTLTTVCPPYIWGPQV-FEWGVQGATLNTSAEIVNKALQTTPEFKGPFDE 277

Query: 241 --QVACGYIDVRDIAKAHILAFQKDELIGQRLL-----------LHSGLFTVQTLLDAIN 287
              +AC   DVRD+A  H+L  + ++L G+RL              +G F +Q +L+ +N
Sbjct: 278 PNGLAC---DVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLN 334

Query: 288 EQFPELRGKIPAGEPGSN-KPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILE 343
           +QFPEL+GKI  G    N K   ++   +N KT +L G EF+ L+  + D V QIL+
Sbjct: 335 KQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391

>Kwal_33.14566
          Length = 362

 Score =  193 bits (490), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 192/357 (53%), Gaps = 28/357 (7%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAI---FKSANFNYEIVKDIA 66
           V V+GASG+IA HI+  L  + Y V+ +V S E    +  +    +  A  +  +V D+ 
Sbjct: 5   VLVTGASGYIAMHIVNILQSERYHVVATVESAEVARRIATSYEHYYPYAVLDVLVVPDVT 64

Query: 67  DLNAFDPVFEKHGKDIKVVLHTA--SPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQ 124
             +AF+PVF++H  DI+ V+HTA  +PL     +  +  L+PA  GT+ +L+SI+ +  Q
Sbjct: 65  APDAFEPVFQQH-PDIRHVIHTAPAAPLG-NAKDTREAYLVPATEGTRNVLQSIRNHGPQ 122

Query: 125 TVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAW 184
            V RVV+TSSFA+        + +  I+E SWN  +WE  Q    +AY  SK+ AE+  W
Sbjct: 123 -VSRVVITSSFAALMDLDHAADPQCVISETSWNPVTWEAAQHSNSKAYAASKRIAEQLVW 181

Query: 185 EFLNKNKDAVKFKLATVDPVYVFGPQNHI---EPGKKVLNVSSEVINQLVHLKKDDPLPQ 241
           ++  +++  V+F L TV+P Y+FGP  H+   E  +   N ++  I + + L  D P P 
Sbjct: 182 DWYREHQHDVRFTLTTVNPPYMFGP--HVFDWELERPEWNTTACFIKEALKLTPDSPGPF 239

Query: 242 VACGYI--DVRDIAKAHILAFQKDELIGQRLL--------LHS---GLFTVQTLLDAINE 288
           +    I  DVRD A  H+L  +  +L GQRL          HS   G F  Q +LD +N 
Sbjct: 240 IKPRGICCDVRDAALIHVLPLRNSDLAGQRLFPVNGTGIKQHSYEDGKFNFQRILDIMNA 299

Query: 289 QFPELRGKIPAGEPGSNKPEDL--LTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILE 343
           +FP +R  IP G  G+   E+L  LT  +N  T +L G EF+     ++D   QIL+
Sbjct: 300 EFPNIRESIPEGNSGAANQENLNQLTRYNNDDTCQLTGMEFKPFALSLRDATKQILQ 356

>KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces
           cerevisiae YGL039w, hypothetical start
          Length = 167

 Score =  143 bits (361), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 106/146 (72%), Gaps = 1/146 (0%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVKDIADLN 69
           V VSGASG+IAQH IR LL++ YKVIG+VR+ EK D++   +F S N   E+V ++A ++
Sbjct: 23  VLVSGASGYIAQHTIRILLEKGYKVIGTVRTQEKADSVAQ-LFNSDNLVLELVPELAKID 81

Query: 70  AFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAAQTVERV 129
           AFD VFEK+   IK V+HTASP+ +  T++E ++L+PA+NGT+ +LESIKK++A +VE V
Sbjct: 82  AFDHVFEKYNTQIKHVIHTASPVRYNMTDFENEMLLPAINGTRSVLESIKKFSADSVETV 141

Query: 130 VVTSSFASHTSTVDMCNTKGKITEDS 155
           V TSS ++  +   +   +  +TE++
Sbjct: 142 VYTSSISALANPAGIFKPETTLTEET 167

>KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57
           Zygosaccharomyces rouxii Ketoreductase, hypothetical
           start
          Length = 76

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 5/71 (7%)

Query: 277 FTVQTLLDAINEQFPELRGKIPAGEPGSNKPEDLL---TPIDNTKTKKLLGFEFRDLKTI 333
           F +Q + D INE +PEL+GKI  G PG+ K  D++   +  DN+KT+KLLGFEF   +  
Sbjct: 5   FALQDVADFINENYPELKGKISVGNPGAGK--DIVATTSKYDNSKTRKLLGFEFVPFEQS 62

Query: 334 IQDTVSQILEA 344
           + D+V+QIL A
Sbjct: 63  VTDSVNQILAA 73

>Sklu_2306.3 YGL001C, Contig c2306 4537-5586
          Length = 349

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 109/259 (42%), Gaps = 35/259 (13%)

Query: 8   TTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFN-YEIVKDIA 66
           ++V + G SGF+  H+++Q  D   K    V        L   + K   FN  EI     
Sbjct: 5   SSVLLIGGSGFLGLHLVQQFYDLTPKPDIHVFDVRP---LPEKLSKQFTFNPSEIAFHKG 61

Query: 67  DLNAFDPVFEK-HGKDIKVVLHTASPLNFTTTE-YEKDLLIPAVNGTKGILESIKKYAAQ 124
           DL + + V E     +  VV+H+ASP++  + E YEK      V GT+ +L+  K     
Sbjct: 62  DLTSPEDVGEAIKSSNADVVVHSASPIHGNSQEVYEKV----NVQGTRNLLDVAKNCG-- 115

Query: 125 TVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAW 184
            V+ VV TSS     +  D+ N            ++W   +   +  Y  +K  AEE   
Sbjct: 116 -VKAVVYTSSAGVIFNGQDVHNA----------DETWPIPEV-PMDGYNETKAIAEEMV- 162

Query: 185 EFLNKNKDAVKFKLATVDPVYVFGPQN-HIEPGKKVLNVSSEVINQLVHLKKDDPLPQVA 243
             LN N     F    + P  +FGP +  + PG   L   +++      +  ++ L    
Sbjct: 163 --LNANDPKSNFLTVALRPAGIFGPGDRQLVPG---LRAVAKLGQSKFQIGDNNNL---- 213

Query: 244 CGYIDVRDIAKAHILAFQK 262
             +    ++A AH+LA QK
Sbjct: 214 FDWTYAGNVADAHVLAAQK 232

>YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 sterol
           dehydrogenase, C-4 decarboxylase, required for
           ergosterol biosynthesis [1050 bp, 349 aa]
          Length = 349

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 91/216 (42%), Gaps = 32/216 (14%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKV---IGSVRSTEKGDNLKNAIFKSANFNYEIVK-D 64
           +V + G SGF+  H+I+Q  D N K    I  VR      +L   + K   FN + +K  
Sbjct: 6   SVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVR------DLPEKLSKQFTFNVDDIKFH 59

Query: 65  IADLNAFDPVFEK-HGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAA 123
             DL + D +    +     VV+H ASP++    +      I  V GT+ +++  KK   
Sbjct: 60  KGDLTSPDDMENAINESKANVVVHCASPMHGQNPDIYD---IVNVKGTRNVIDMCKKCG- 115

Query: 124 QTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAA 183
             V  +V TSS     +  D+ N            ++W   +   + AY  +K  AE+  
Sbjct: 116 --VNILVYTSSAGVIFNGQDVHNA----------DETWPIPEV-PMDAYNETKAIAEDMV 162

Query: 184 WEFLNKNKDAVKFKLATVDPVYVFGPQN-HIEPGKK 218
              L  N  +  F    + P  +FGP +  + PG +
Sbjct: 163 ---LKANDPSSDFYTVALRPAGIFGPGDRQLVPGLR 195

>YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein
          possibly involved in cell detoxification or stress
          response [897 bp, 298 aa]
          Length = 298

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 10 VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKN 49
          VF++GASGFI   ++ +L+   ++V+G  RS E    +K+
Sbjct: 3  VFITGASGFIGSAVLSELISSGHEVVGLARSDEAAAKIKS 42

>Kwal_14.775
          Length = 295

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 10 VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLK 48
          VFV+G SGFI   ++ +LL   + V+   RS E  D L+
Sbjct: 3  VFVTGGSGFIGTGVVSELLHLGHTVVALSRSQESADKLR 41

>YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucose
           4-epimerase, catalyzes a step in galactose metabolism
           [2100 bp, 699 aa]
          Length = 699

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 109/295 (36%), Gaps = 88/295 (29%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKS-ANFN---------Y 59
           V V+G +G+I  H + +L++  Y  +         DNL N+ + S A            Y
Sbjct: 14  VLVTGGAGYIGSHTVVELIENGYDCV-------VADNLSNSTYDSVARLEVLTKHHIPFY 66

Query: 60  EIVKDIADLNAFDPVFEKHGKDIKVVLHTAS----------PLNFTTTEYEKDLLIPAVN 109
           E+  D+ D    + VF+++   I  V+H A           PL +    Y  ++L     
Sbjct: 67  EV--DLCDRKGLEKVFKEY--KIDSVIHFAGLKAVGESTQIPLRY----YHNNIL----- 113

Query: 110 GTKGILESIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAV 169
           GT  +LE +++Y    V + V +SS   +       N    I E+         C     
Sbjct: 114 GTVVLLELMQQY---NVSKFVFSSSATVYGDATRFPNMI-PIPEE---------CPLGPT 160

Query: 170 RAYFGSKKFAEEAAWEFLNKNKDAVKFK-LATVDPVYVFGPQNHIEPGKKVLNVSSEVIN 228
             Y  +K   E    +  N +K + KF  L   +P+    P   I  G+  L + + ++ 
Sbjct: 161 NPYGHTKYAIENILNDLYNSDKKSWKFAILRYFNPIGAH-PSGLI--GEDPLGIPNNLLP 217

Query: 229 QLVHLKKDDPLPQVACG----------------------YIDVRDIAKAHILAFQ 261
            +          QVA G                      YI V D+AK HI A Q
Sbjct: 218 YMA---------QVAVGRREKLYIFGDDYDSRDGTPIRDYIHVVDLAKGHIAALQ 263

>Scas_652.19d
          Length = 341

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 87/211 (41%), Gaps = 37/211 (17%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKN-AIFKSANFNYEIV----K 63
           T  ++G +  I   +++ L  +N  +I  VRS EKG+  K  AI K  N    I      
Sbjct: 43  TALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVVGGN 102

Query: 64  DIADLNAFDPVFEK-----HGKDIKVVLHTA---SPLNFTTTE------YEKDLLIPAVN 109
           D  DL    P  E+       K + +++H A   +P+N  T++      +  ++L P + 
Sbjct: 103 DFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPVNTGTSKQGLEAMFSTNVLGPQL- 161

Query: 110 GTKGILESIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENC---QT 166
             +  L+ +       ++R+V  SS A   +  D            W+  ++E C   + 
Sbjct: 162 -LQHFLDPLFLKKDDDLKRIVWVSSGAHANACFDY--------GIHWDDPTYEKCTIAER 212

Query: 167 DAVRAYFGSKKFA---EEAAWEFLNKNKDAV 194
            +    +G  K A   +  AW    KNK+ V
Sbjct: 213 PSPYELYGQSKAANIYQAKAWA--TKNKEIV 241

>KLLA0C18513g complement(1636434..1637489) highly similar to
           sp|P53199 Saccharomyces cerevisiae YGL001c ERG26 C-3
           sterol dehydrogenase (C-4 decarboxylase) singleton,
           start by similarity
          Length = 351

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 107/263 (40%), Gaps = 45/263 (17%)

Query: 9   TVFVSGASGFIAQHIIRQ---LLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK-- 63
           +V + G SGF+  H+I+Q   L  Q    +  VR       L + I K   F+   +   
Sbjct: 8   SVLLIGGSGFLGLHLIQQFSELKPQPQIHVFDVRP------LPDRISKQFTFDPSTITFH 61

Query: 64  --DIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTE-YEKDLLIPAVNGTKGILESIKK 120
             D+          E  G  I  V+H+ASP++  + E YEK      V GTK +L   K+
Sbjct: 62  QGDLTSPADVRKAIETSGATI--VVHSASPMHGNSQEIYEKV----NVKGTKNLLTVAKQ 115

Query: 121 YAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAE 180
                V+ VV TSS     +  D+ N            ++W   +   +  Y  +K  AE
Sbjct: 116 C---RVKAVVYTSSAGVIFNGQDIHNA----------DETWPIPEV-PMDGYNETKAIAE 161

Query: 181 EAAWEFLNKNKDAVKFKLATVDPVYVFGPQN-HIEPGKKVLNVSSEVINQLVHLKKDDPL 239
           E     L+ N     F    + P  +FGP +  + PG   L   +++      +  ++ L
Sbjct: 162 EMV---LSANDPENDFLTIALRPAGIFGPGDRQLVPG---LRQVAKLGQSKFQIGDNNNL 215

Query: 240 PQVACGYIDVRDIAKAHILAFQK 262
                 +    ++A AH+LA QK
Sbjct: 216 ----FDWTYAGNVADAHVLAAQK 234

>Scas_652.19d1
          Length = 344

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 6  NNTTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIF 52
          ++ T  V+G +  I +H++  L  +N  VIG VR+  KG+  K  I 
Sbjct: 40 SDKTAVVTGCNTGIGKHVVELLYQKNCNVIGVVRTDAKGEEAKKEII 86

>Scas_522.5
          Length = 692

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 41/144 (28%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK------ 63
           V V+G +G+I  H + +L++  Y+ +         DNL N+ + +     EI+       
Sbjct: 8   VLVTGGAGYIGSHTVVELIENGYECVIV-------DNLCNSSYDAVA-RLEILTKHHIPF 59

Query: 64  ---DIADLNAFDPVFEKHGKDIKVVLHTAS----------PLNFTTTEYEKDLLIPAVNG 110
              D+ D    + VF++H   I  V+H A           PL +    Y  ++L     G
Sbjct: 60  YKVDLCDAEGLEKVFQEH--KIDSVIHFAGLKAVGESTQIPLRY----YHNNIL-----G 108

Query: 111 TKGILESIKKYAAQTVERVVVTSS 134
           T  +LE + KY    V+++V +SS
Sbjct: 109 TLVLLELMGKY---DVKKLVFSSS 129

>CAGL0G00594g 61223..62272 highly similar to sp|P53199 Saccharomyces
           cerevisiae YGL001c ERG26, start by similarity
          Length = 349

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 92/218 (42%), Gaps = 32/218 (14%)

Query: 9   TVFVSGASGFIAQHIIRQLLDQNYKV---IGSVRSTEKGDNLKNAIFKSANFNYEIVK-D 64
           +V + G +GF+  H+I+Q  D + +    I  +R       L   I K   F+   +K  
Sbjct: 6   SVLLIGGAGFLGLHLIQQFYDVSPRPDIHIFDIRP------LPEKISKQFTFDVNDIKFH 59

Query: 65  IADLNAFDPVFEK-HGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESIKKYAA 123
             DL + + + +        VV+H+ASP++    E    +    V GT+ I+++ KK   
Sbjct: 60  KGDLTSSEDIKKAILASKCNVVVHSASPVHGGAAEVYHKV---NVTGTRNIIDTSKKCG- 115

Query: 124 QTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAA 183
             V+ +V TSS     +  D+ N            ++W   +   + AY  +K  AE+  
Sbjct: 116 --VKALVYTSSAGVIFNGQDIHNA----------DETWPIPEV-PMDAYNETKAIAEDMV 162

Query: 184 WEFLNKNKDAVKFKLATVDPVYVFGPQN-HIEPGKKVL 220
              L  N     F    + P  +FGP +  + PG + +
Sbjct: 163 ---LKANDPDNDFLTIALRPAGIFGPGDRQLVPGLRTV 197

>Scas_668.8
          Length = 349

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 153/380 (40%), Gaps = 81/380 (21%)

Query: 8   TTVFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSAN-FNY---EIVK 63
           ++V + G SGF+  H+I+Q  +       S R +    +++    K +N F +   +I  
Sbjct: 5   SSVLLIGGSGFLGLHLIQQFYEL------SPRPSIHVFDVRPLPEKLSNQFTFKLDDIQV 58

Query: 64  DIADLNAFDPVFEKHGKDIK-----VVLHTASPLNFTTTEYEKDLLIPAVNGTKGILESI 118
            I DL +F+ V     K IK     VV+H+ASP++    E   DL+   V GT+ +++  
Sbjct: 59  HIGDLTSFEDV----QKAIKVSGANVVVHSASPMHGQNKEI-YDLV--NVKGTRNVIDVC 111

Query: 119 KKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKF 178
           K      V  +V TSS     +  D+ N            + W   +   + AY  +K  
Sbjct: 112 KN---TNVNILVYTSSAGVIFNGQDVHNA----------DERWPIPEV-PMDAYNETKFT 157

Query: 179 AEEAAWEFLNKNKDAVKFKLATVDPVYVFGPQN-HIEPGKKVLNVSSEVINQLVHLKKDD 237
           AE+     L  N     F    + P  +FGP +  + PG   L   +++      L  ++
Sbjct: 158 AEDMV---LKSNDPENGFLTVALRPAGIFGPGDRQLVPG---LRAVAKLGQSKFQLGDNN 211

Query: 238 PLPQVACGYIDVRDIAKAHILAFQK-------DELIGQRLLLHSGLFT------------ 278
            L      +    ++A +H+LA Q+        E+ G+   + +   T            
Sbjct: 212 NL----FDWTYAGNVADSHVLAAQRLLDPATAKEVSGEAFFITNDTPTYFWSLARTVWKA 267

Query: 279 --------------VQTLLDAINEQFPELRGKIPAGEPGSNKPEDLLTPIDNTKTKKLLG 324
                         V  L   ++E F +L GK P   P   K        +  K KKLLG
Sbjct: 268 DGHIDKNVIVLKRPVAILAGYLSEFFSKLLGKEPGLTPFRVKIVCASRYHNIAKAKKLLG 327

Query: 325 FEFR-DLKTIIQDTVSQILE 343
           +E R D++  I+ T++ + E
Sbjct: 328 YEPRVDIEEGIKRTLAWMDE 347

>KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1 Kluyveromyces
            lactis alpha-aminoadipate reductase, start by similarity
          Length = 1385

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 3    AANNNTTVFVSGASGFIAQHIIRQLLDQ-----NYKVIGSVRS 40
            +A  N  VFV+G +GF+  +I+  LL++     N KV   VR+
Sbjct: 959  SAKKNINVFVTGVTGFLGSYILADLLNRPTSSYNIKVFAHVRA 1001

>KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA
           Kluyveromyces lactis GAL10 bifunctional protein
           [Includes: UDP-glucose 4-epimerase (Galactowaldenase);
           Aldose 1-epimerase (Mutarotase)], start by similarity
          Length = 688

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 23/135 (17%)

Query: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFKSANFNYEIVK------ 63
             V+G +G+I  H + +L +  YK I         DNL N+ ++S     E++       
Sbjct: 7   CLVTGGAGYIGSHTVVELCEAGYKCIVV-------DNLSNSSYESVA-RMELLTGQEIKF 58

Query: 64  ---DIADLNAFDPVFEKHGKDIKVVLHTASPLNFT-TTEYEKDLLIPAVNGTKGILESIK 119
              D+ +L   + +F+ +   I  VLH A       +T+         + GT  +LE +K
Sbjct: 59  AKIDLCELEPLNKLFDDY--KIDSVLHFAGLKAVGESTQIPLTYYFNNIVGTINLLECMK 116

Query: 120 KYAAQTVERVVVTSS 134
              +  V+++V +SS
Sbjct: 117 ---SHDVKKLVFSSS 128

>CAGL0K07788g complement(773523..777647) highly similar to sp|P07702
            Saccharomyces cerevisiae YBR115c LYS2
            Aminoadipate-semialdehyde dehydrogenase, hypothetical
            start
          Length = 1374

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 43/101 (42%), Gaps = 19/101 (18%)

Query: 3    AANNNTTVFVSGASGFIAQHIIRQLLDQ-----NYKVIGSVRSTEKGDNLKNAIFKSANF 57
            A      +FV+G +GF+   I+  +L++     N+K+   VR+ ++   L     + A  
Sbjct: 949  AGPTTVNIFVTGVTGFLGSFILSDILNRTVTGVNFKIFAHVRAADETSGLDR--IRKAGT 1006

Query: 58   NYEIVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTE 98
             Y   K            E++   ++VV+   S  NF  T+
Sbjct: 1007 VYGTWK------------EEYANSLQVVIGDLSKKNFGLTD 1035

>Scas_591.9
          Length = 1386

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 26/39 (66%), Gaps = 5/39 (12%)

Query: 10   VFVSGASGFIAQHIIRQLLDQN-----YKVIGSVRSTEK 43
            VFV+GA+GF+  +I+ ++L ++     +KV   VR+ ++
Sbjct: 967  VFVTGATGFLGSYILSEILKRSSSAYEFKVFAHVRAKDE 1005

>YHR027C (RPN1) [2314] chr8 complement(161722..164703) Non-ATPase
           component of the 26S proteasome complex, required for
           degradation of proteins of the endoplasmic reticulum,
           with Rpn2p acts as receptor for binding of Dsk2p and
           Rad23p to proteasome, also functions in RNA polymerase
           II transcription elongation [2982 bp, 993 aa]
          Length = 993

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 53/123 (43%), Gaps = 15/123 (12%)

Query: 53  KSANFNYEIVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTK 112
           +  +F YE V+DI            +GK  +  L+ A  LN T  +  +D+    ++ +K
Sbjct: 317 QKTSFEYEGVQDII----------GNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSK 366

Query: 113 GILESIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAY 172
            +  S    +AQ      + SSF +    +  CN K  +  D+W   +  +  T AV A 
Sbjct: 367 SVFSSAGLDSAQQN----LASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAV-AS 421

Query: 173 FGS 175
            GS
Sbjct: 422 IGS 424

>Scas_688.18
          Length = 1005

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 57  FNYEIVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTKGILE 116
           F YE ++DI         F          L+ A  LN T  +  +D+    ++ +K +  
Sbjct: 330 FEYEGMQDIIGNTKLSEHF----------LYLAKELNLTVPKVPEDIYKSHLDNSKSVFS 379

Query: 117 SIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGS 175
           S    +AQ      + SSF +    +  CN K  +  DSW   + ++  T AV A  GS
Sbjct: 380 SAGLDSAQQN----LASSFVNGFLNLGYCNDKVIVDNDSWVYKTKDDGMTSAV-ASIGS 433

>Kwal_23.3654
          Length = 1392

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 68/151 (45%), Gaps = 26/151 (17%)

Query: 10   VFVSGASGFIAQHIIRQLLDQ-----NYKVIGSVRSTEKGDNLK-----NAIFK--SANF 57
            VFV+G +GF+  +I+  LL +     N KV   VR+ ++   ++       ++   S +F
Sbjct: 973  VFVTGVTGFLGSYILADLLQRPTTPFNIKVYAHVRAKDEAAGMERLAKAGVVYGTWSDDF 1032

Query: 58   NYEIVKDIADLN----AFDPV-FEKHGKDIKVVLHTASPLNFTTTEYEKDLLIPAVNGTK 112
               I   + DL+      D V ++   K+I V++H  + +++    Y K L  P V  T 
Sbjct: 1033 ASRIQVVLGDLSKPQFGLDNVKWDNLTKEIDVIIHNGALVHW-VYPYAK-LRDPNVISTI 1090

Query: 113  GILESIKKYAAQTVERVVVTSSFASHTSTVD 143
             ++       A+         +F S TSTVD
Sbjct: 1091 NVMNLAATNKAKFF-------TFVSSTSTVD 1114

>KLLA0F09317g 861757..863238 similar to sp|P32582 Saccharomyces
           cerevisiae YGR155w CYS4 cystathionine beta-synthase,
           start by similarity
          Length = 493

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 12/74 (16%)

Query: 120 KYAAQTV--ERVVVT-SSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSK 176
           KYA Q +  E V+V  SS ++ T+ VD CN   ++TED    D       D+VR+Y    
Sbjct: 268 KYARQLISNEGVLVGGSSGSAFTALVDYCNEHPELTED----DVIVVIFPDSVRSYL--T 321

Query: 177 KFAEEAAWEFLNKN 190
           KF ++   E+L  N
Sbjct: 322 KFVDD---EWLKTN 332

>YBR115C (LYS2) [304] chr2 complement(469704..473882)
            Alpha-aminoadipate-semialdehyde dehydrogenase large
            chain, sixth step in lysine biosynthesis pathway [4179
            bp, 1392 aa]
          Length = 1392

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 21/103 (20%)

Query: 3    AANNNTT--VFVSGASGFIAQHIIRQLLDQ-----NYKVIGSVRSTEKGDNLKNAIFKSA 55
            +A   TT  VFV+G +GF+  +I+  LL +     ++KV   VR+  K +    A  + A
Sbjct: 964  SAEGKTTINVFVTGVTGFLGSYILADLLGRSPKNYSFKVFAHVRA--KDEEAAFARLQKA 1021

Query: 56   NFNYEIVKDIADLNAFDPVFEKHGKDIKVVLHTASPLNFTTTE 98
               Y                EK   +IKVVL   S   F  ++
Sbjct: 1022 GITYGTWN------------EKFASNIKVVLGDLSKSQFGLSD 1052

>KLLA0B08371g complement(747517..748323) highly similar to
          sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
          similarity
          Length = 268

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 7  NTTVFVSGASGFIAQHIIRQLLDQ---NYKVIGSVRSTEKGDNLKNAI 51
          N T+F++GAS  I Q    + LD    N K+I + R   K + LK  I
Sbjct: 13 NKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKI 60

>Scas_641.19
          Length = 1046

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 210 QNHIEPGKKVLNVSSEVINQLVHLKKDDPLPQVACGYIDVRDI 252
           +N+ E   K++N++ +VIN+L  +KK+   P+     I +RDI
Sbjct: 947 RNYYETKVKIINLTRKVINELKQVKKNGRSPKYLSS-IQLRDI 988

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,558,085
Number of extensions: 513008
Number of successful extensions: 1651
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1606
Number of HSP's successfully gapped: 54
Length of query: 346
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 244
Effective length of database: 13,065,073
Effective search space: 3187877812
Effective search space used: 3187877812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)