Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E05258g1081074744e-63
CAGL0G06358g1131123662e-46
KLLA0A03883g110893582e-45
YOR327C (SNC2)115963495e-44
ADR355C109883495e-44
Scas_663.25112913471e-43
YAL030W (SNC1)117953272e-40
Kwal_26.705474512363e-27
Scas_564.4*237651218e-09
Kwal_56.23743162641135e-08
KLLA0F19448g231811122e-07
YLR093C (NYV1)253611042e-06
AGR054C248661032e-06
CAGL0C00429g23457981e-05
AER109W20050790.004
CAGL0D03498g20561790.005
Sklu_2258.720050780.005
Kwal_47.1712120049780.005
Scas_571.120050780.007
YKL196C (YKT6)20049770.008
KLLA0D02684g20060720.042
CAGL0C03179g21550680.13
Scas_659.11*21574592.5
CAGL0L06908g43948565.8
Scas_623.544648565.9
KLLA0F17798g31746559.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E05258g
         (107 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   187   4e-63
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   145   2e-46
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   142   2e-45
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   139   5e-44
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   139   5e-44
Scas_663.25                                                           138   1e-43
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   130   2e-40
Kwal_26.7054                                                           96   3e-27
Scas_564.4*                                                            51   8e-09
Kwal_56.23743                                                          48   5e-08
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    48   2e-07
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    45   2e-06
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    44   2e-06
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    42   1e-05
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    35   0.004
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    35   0.005
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       35   0.005
Kwal_47.17121                                                          35   0.005
Scas_571.1                                                             35   0.007
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    34   0.008
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    32   0.042
CAGL0C03179g complement(310371..311018) highly similar to sp|P22...    31   0.13 
Scas_659.11*                                                           27   2.5  
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    26   5.8  
Scas_623.5                                                             26   5.9  
KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces...    26   9.5  

>CAGL0E05258g complement(511027..511353) highly similar to sp|P33328
           Saccharomyces cerevisiae YOR327c SNC2, start by
           similarity
          Length = 108

 Score =  187 bits (474), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 91/107 (85%)

Query: 1   MASNDNYDPYLLSEDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLA 60
           MASNDNYDPYLLSEDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLA
Sbjct: 1   MASNDNYDPYLLSEDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLA 60

Query: 61  MSAQGFKRGANRVRRQMWYKDLKMRMCLFXXXXXXXXXXXXXXXXHF 107
           MSAQGFKRGANRVRRQMWYKDLKMRMCLF                HF
Sbjct: 61  MSAQGFKRGANRVRRQMWYKDLKMRMCLFLVIVILLVVIIVPIVVHF 107

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  145 bits (366), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 5/112 (4%)

Query: 1   MASNDNYDPYLLSE-----DGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDK 55
           M+S+  YDPY+  E     +  QSKAAALK+EIDDTV IMR+NINKVAERGE LTSI+DK
Sbjct: 1   MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60

Query: 56  ADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCLFXXXXXXXXXXXXXXXXHF 107
           ADNLA+SAQGFKRGANRVR+QMWYKDLKM+ CLF                HF
Sbjct: 61  ADNLAISAQGFKRGANRVRKQMWYKDLKMKFCLFVVIICLLVAIVVPIAVHF 112

>KLLA0A03883g join(344642..344725,344850..345098) similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
          synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
          SNC1 synaptic vesicle-associated membrane protein,
          start by similarity
          Length = 110

 Score =  142 bits (358), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 78/89 (87%), Gaps = 2/89 (2%)

Query: 1  MASNDNYDPYLLS--EDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADN 58
          M+S+  YDPY+ +  E  G SK AALKSEIDDTVDIMR+NINKVAERGE LTSI DKADN
Sbjct: 1  MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60

Query: 59 LAMSAQGFKRGANRVRRQMWYKDLKMRMC 87
          LA+SAQGFKRGANRVR+QMW+KDLKMRMC
Sbjct: 61 LAVSAQGFKRGANRVRKQMWWKDLKMRMC 89

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [348 bp, 115 aa]
          Length = 115

 Score =  139 bits (349), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 68/96 (70%), Positives = 79/96 (82%), Gaps = 7/96 (7%)

Query: 1  MASNDNYDPYLLSEDG-------GQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSID 53
          M+S+  YDPY+  E+         Q+K AAL+ EIDDTV IMR+NINKVAERGE LTSI+
Sbjct: 1  MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIE 60

Query: 54 DKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCLF 89
          DKADNLA+SAQGFKRGANRVR+QMW+KDLKMRMCLF
Sbjct: 61 DKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLF 96

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  139 bits (349), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (87%), Gaps = 1/88 (1%)

Query: 1  MASNDNYDPYLLSEDG-GQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNL 59
          M+S+  YDPY+  E    QSKAAALK+EIDDTV IMR+NINKVAERGE LTSI DKADNL
Sbjct: 1  MSSSVPYDPYVPPEGAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDKADNL 60

Query: 60 AMSAQGFKRGANRVRRQMWYKDLKMRMC 87
          A+SAQGFKRGANRVR+QMW+KDLKMR+C
Sbjct: 61 AVSAQGFKRGANRVRKQMWWKDLKMRLC 88

>Scas_663.25
          Length = 112

 Score =  138 bits (347), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/91 (74%), Positives = 78/91 (85%), Gaps = 4/91 (4%)

Query: 1  MASNDNYDPYLLSEDG----GQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKA 56
          M+S+  YDPY+  E+      QSKAAALK+EIDDTV IMR+NINKVAERGE LTSI+DKA
Sbjct: 1  MSSSVPYDPYVPPEETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKA 60

Query: 57 DNLAMSAQGFKRGANRVRRQMWYKDLKMRMC 87
          DNLA+SAQGFKRGANRVR+QMW+KDLKMR C
Sbjct: 61 DNLAVSAQGFKRGANRVRKQMWWKDLKMRAC 91

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  130 bits (327), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 8/95 (8%)

Query: 1  MASNDNYDPYLLSED--------GGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSI 52
          M+S+  +DPY LSE           +S+ A L++EIDDTV IMR+NINKVAERGE LTSI
Sbjct: 1  MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60

Query: 53 DDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMC 87
          +DKADNLA+SAQGFKRGANRVR+ MWYKDLKM+MC
Sbjct: 61 EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMC 95

>Kwal_26.7054
          Length = 74

 Score = 95.5 bits (236), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 50/51 (98%)

Query: 35 MRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMR 85
          MR+NINKVAERGE LTSI+DKADNLA+SAQGFKRGANRVR+QMW+KDLKMR
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51

>Scas_564.4*
          Length = 237

 Score = 51.2 bits (121), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 43/65 (66%)

Query: 19  SKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMW 78
           S+ A+ ++++ D V+IM NNI+K  ER E ++ + DK   L  ++  FK+ A R++ +MW
Sbjct: 150 SEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERMW 209

Query: 79  YKDLK 83
           ++ +K
Sbjct: 210 WQRMK 214

>Kwal_56.23743
          Length = 162

 Score = 48.1 bits (113), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 41/64 (64%)

Query: 21  AAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYK 80
           A A + ++ D + +M +NI+K  +R E ++ + D+   L  S+  FKR A R++ +MW++
Sbjct: 77  AEATEQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQ 136

Query: 81  DLKM 84
           ++K+
Sbjct: 137 NVKL 140

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 5   DNYDPYLLS-EDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSA 63
           D +   LLS    GQ  AA+ + E+ + + IM +NI+K  +R E ++ + D  + L  ++
Sbjct: 130 DKFHEELLSYRTEGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENS 189

Query: 64  QGFKRGANRVRRQMWYKDLKM 84
             F+R ++++ R+MW+ ++K 
Sbjct: 190 FKFQRKSSKIMRKMWWNNVKF 210

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 23  ALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDL 82
           A + +I D + IM +NI+K  ER E ++ + DK   L  S+  F+R A  ++  MW++ +
Sbjct: 170 ATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKV 229

Query: 83  K 83
           K
Sbjct: 230 K 230

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 39/66 (59%)

Query: 19  SKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMW 78
           + + A   ++   V +M +NI+K  +R E ++ + D+   L  S+  F+R A R++R+MW
Sbjct: 162 TSSNATDQDLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMW 221

Query: 79  YKDLKM 84
           + ++K 
Sbjct: 222 WNNIKF 227

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 42.4 bits (98), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 38/57 (66%)

Query: 27  EIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLK 83
           ++ + + IM +NI+K  ER E ++ + DK  +L  +++ FKR A +++ +MW++ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 35.0 bits (79), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRV 73
           ++ E+D+T  ++   I  V +RGE L ++ DK+++L+ S++ F + A + 
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 35.0 bits (79), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 14  EDGGQSKAA-ALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANR 72
           +D  Q+ A   ++ E+D+T  ++   I  V +RGE L ++ DK+++L  S++ F + A +
Sbjct: 138 QDPAQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 197

Query: 73  V 73
            
Sbjct: 198 T 198

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 34.7 bits (78), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRV 73
           ++ E+D+T  ++   I  V +RGE L ++ DK+++L+ S++ F + A + 
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>Kwal_47.17121
          Length = 200

 Score = 34.7 bits (78), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANR 72
           ++ E+D+T  ++   I  V +RGE L ++ DK+++L+ S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 34.7 bits (78), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRV 73
           ++ E+D+T  ++   I  V +RGE L ++ DK+++L  S++ F + A + 
Sbjct: 144 VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKT 193

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 34.3 bits (77), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANR 72
           ++ E+D+T  ++   I  V +RGE L ++ DK+++L  S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 32.3 bits (72), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 14  EDGGQSKAAA-LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANR 72
           +D  Q+ A   ++ E+D+T   +   I  V +RGE L ++ DK+++L+ +++ F + A +
Sbjct: 133 QDPSQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

>CAGL0C03179g complement(310371..311018) highly similar to sp|P22214
           Saccharomyces cerevisiae YLR268w SEC22, start by
           similarity
          Length = 215

 Score = 30.8 bits (68), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%)

Query: 24  LKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRV 73
           L  E+     IM  NI  +  RG+ L  +DD +++L +S++ +++ A ++
Sbjct: 137 LNQELVGVKQIMSKNIEDLLYRGDSLEKMDDMSNSLKISSKKYRKSAQKI 186

>Scas_659.11*
          Length = 215

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 6   NYDPYL------LSEDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNL 59
           N+D +L       S+   Q     L  E+    +IM  NI  +  RG+ L  + D + +L
Sbjct: 112 NFDSFLQKTKRIYSDKKVQDNLDQLNQELVGVQEIMSKNIEDLLYRGDSLEKMSDLSASL 171

Query: 60  AMSAQGFKRGANRV 73
             S++ +++ A ++
Sbjct: 172 KESSKRYRKSAQKI 185

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 26.2 bits (56), Expect = 5.8,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 41  KVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCL 88
           K   R   LT + + ++  A++  G  +   R+ R   +KD + R+C+
Sbjct: 307 KSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 354

>Scas_623.5
          Length = 446

 Score = 26.2 bits (56), Expect = 5.9,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 41  KVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRMCL 88
           K   R   LT + + ++  A++  G  +   R+ R   +KD + R+C+
Sbjct: 314 KSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

>KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces
           cerevisiae YLR026c SED5 syntaxin (T-SNARE) singleton,
           start by similarity
          Length = 317

 Score = 25.8 bits (55), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 25/46 (54%)

Query: 23  ALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKR 68
            ++S I +  ++ +   + V E+GE +  IDD   ++ M+  G +R
Sbjct: 238 TIESTIQEVGNLFQQLAHMVQEQGETIQRIDDNVGDIEMNIHGAQR 283

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,807,015
Number of extensions: 93768
Number of successful extensions: 383
Number of sequences better than 10.0: 39
Number of HSP's gapped: 382
Number of HSP's successfully gapped: 39
Length of query: 107
Length of database: 16,596,109
Length adjustment: 77
Effective length of query: 30
Effective length of database: 13,930,523
Effective search space: 417915690
Effective search space used: 417915690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)