Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E04950g67366235070.0
Scas_669.1469065419930.0
YGL144C (ROG1)68566919820.0
Kwal_23.346466864018010.0
ADL285C64464117800.0
KLLA0E14872g67765216310.0
YDL109C64766614310.0
Scas_613.1462862814140.0
CAGL0H10340g5925878911e-111
AER322C6366367635e-92
KLLA0B01375g6406447565e-91
YDR444W6876507325e-87
CAGL0M10043g6586717035e-83
Kwal_47.184826236366991e-82
Scas_717.506586586941e-81
Kwal_55.217034412102262e-19
AFR386C5042112076e-17
KLLA0F16709g5312072061e-16
Kwal_27.101022582241934e-16
Sklu_2393.45462241943e-15
YOR059C4504361924e-15
CAGL0L10318g4572121844e-14
Sklu_2232.44452131702e-12
KLLA0F16423g4592091702e-12
ADR202C4432131595e-11
Scas_698.394712231471e-09
Scas_715.4231107711.1
YBR073W (RDH54)92453693.8
Scas_578.934558674.1
YGL167C (PMR1)95041675.7
Scas_705.121447119675.9
YBR097W (VPS15)1454104676.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E04950g
         (662 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...  1355   0.0  
Scas_669.14                                                           772   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   768   0.0  
Kwal_23.3464                                                          698   0.0  
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   690   0.0  
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   632   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   555   0.0  
Scas_613.14                                                           549   0.0  
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   347   e-111
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   298   5e-92
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   295   5e-91
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   286   5e-87
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   275   5e-83
Kwal_47.18482                                                         273   1e-82
Scas_717.50                                                           271   1e-81
Kwal_55.21703                                                          92   2e-19
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    84   6e-17
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    84   1e-16
Kwal_27.10102                                                          79   4e-16
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                79   3e-15
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    79   4e-15
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    75   4e-14
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            70   2e-12
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    70   2e-12
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    66   5e-11
Scas_698.39                                                            61   1e-09
Scas_715.4                                                             32   1.1  
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...    31   3.8  
Scas_578.9                                                             30   4.1  
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    30   5.7  
Scas_705.12                                                            30   5.9  
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    30   6.8  

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score = 1355 bits (3507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/662 (100%), Positives = 662/662 (100%)

Query: 1   MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFR 60
           MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFR
Sbjct: 1   MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFR 60

Query: 61  AGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWI 120
           AGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWI
Sbjct: 61  AGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWI 120

Query: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKL 180
           LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKL
Sbjct: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKL 180

Query: 181 PRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETE 240
           PRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETE
Sbjct: 181 PRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETE 240

Query: 241 KGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVN 300
           KGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVN
Sbjct: 241 KGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVN 300

Query: 301 FITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSIL 360
           FITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSIL
Sbjct: 301 FITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSIL 360

Query: 361 RKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAF 420
           RKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAF
Sbjct: 361 RKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAF 420

Query: 421 FNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDI 480
           FNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDI
Sbjct: 421 FNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDI 480

Query: 481 IIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLS 540
           IIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLS
Sbjct: 481 IIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLS 540

Query: 541 WRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTRED 600
           WRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTRED
Sbjct: 541 WRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTRED 600

Query: 601 LNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATASNEESLREIKDEVTQN 660
           LNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATASNEESLREIKDEVTQN
Sbjct: 601 LNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATASNEESLREIKDEVTQN 660

Query: 661 LD 662
           LD
Sbjct: 661 LD 662

>Scas_669.14
          Length = 690

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/654 (56%), Positives = 491/654 (75%), Gaps = 24/654 (3%)

Query: 9   DILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPF 68
           D+LY  +S++   + +RY+I Y LY+ +EIP D+KLD LY+R+KN  P+S+RA YL GPF
Sbjct: 3   DLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGPF 62

Query: 69  ILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQIL 128
           ILY DVR   YHHSQ I S+ D PQFE+NL   Q  +  LSLH IQ +YVWI+DVVSQIL
Sbjct: 63  ILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQIL 122

Query: 129 FTTNTNVPFEVTVGMDRKMLEE--NNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAP 186
           FTTNT++ +E+++G  ++ L    NNE      LGS  + L+V++L T DLWKLP +LAP
Sbjct: 123 FTTNTDITYEISMGYTKESLHHSINNE-----RLGS--DRLVVTKLNTLDLWKLPVQLAP 175

Query: 187 ---KKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGV 243
              ++  KHLVILTHGLHSN++ D+ Y+ME+IYKSQ N+PNE ++VDGY  N+C+TE+GV
Sbjct: 176 SDRRRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGV 235

Query: 244 RYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
           +YLG RLA YI++ LYDA + KISF+GHSLGGLVQTFAI  +  +YPWFF KV+P+NFI 
Sbjct: 236 KYLGERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIA 295

Query: 304 IASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKF 363
           +ASP+LGIVTDNPAY+ LLLSFGV+G+TG+DL LD     ++PLLY L GE  RS+L KF
Sbjct: 296 MASPLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLLKF 355

Query: 364 ERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFFNK 423
           +RRT+YANA+NDGIVPLYT+ LL+LDYD IL++L + E+ +      N+T+ +NTA FNK
Sbjct: 356 KRRTLYANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTASFNK 415

Query: 424 NFISPLTKMLSLWAPQKFPES-DPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIII 482
           NFISPLTKMLS+WAPQKFP+  D K+PKVS  QSA SILLPPLPD  +++NPK R+ +II
Sbjct: 416 NFISPLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVII 475

Query: 483 HDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWR 542
           HDK YT+ED+   + + + +FFN++N+ LQA + + + + +YQ+LE++IA RWH+G+SWR
Sbjct: 476 HDKTYTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWR 535

Query: 543 KVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDV---------- 592
           KV+VALKPDAHNNIIVRRRF+NAYGW VIDHLI  HF+G++   + Q             
Sbjct: 536 KVVVALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRLEEEQTKAGLEAPLPNDQ 595

Query: 593 -SITTTREDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATAS 645
            S+    ++  W+ + + + LF EGPTGMIST+GE++E+F K   + + +  +S
Sbjct: 596 SSVIEPIDEYAWVTKAESESLFDEGPTGMISTMGEMLETFTKTHLATISNKNSS 649

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/669 (57%), Positives = 502/669 (75%), Gaps = 27/669 (4%)

Query: 9   DILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPF 68
           +IL+HY+SSVKVGE+ERY+I Y LY+ +EIP DL L+SL+++++N +PLS+RA YL GPF
Sbjct: 8   EILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPF 67

Query: 69  ILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQIL 128
           +LY DV++  YHHSQ IV+S DYP+FE N+Q QQ  V ELS+HNI+ KYVWI DV+SQIL
Sbjct: 68  MLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQIL 127

Query: 129 FTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPKK 188
           FTTNTNV +EVT+G  ++ +E  +++    HLGS S  L V+RLTT DLW LP ++   +
Sbjct: 128 FTTNTNVTYEVTIGTSKESVENPHDLPS--HLGSYSPKLTVNRLTTLDLWNLPVQITTPQ 185

Query: 189 DIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLGT 248
             KHLV+LTHGLHSNVS DL Y+ME+IYK+Q N+P+E ++V GY  NVC+TEKGV+YLGT
Sbjct: 186 KKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGT 245

Query: 249 RLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIASPM 308
           RLA+YII +LYD  ++KISFVGHSLGGL+Q FAI  +   YPWFF KV P+NFIT+ASP+
Sbjct: 246 RLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASPL 305

Query: 309 LGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERRTI 368
           LGIVTDNPAYI +LLSFGV+G+TG+DL L+ D+   KPLLY LSG  +  ILR+F+RRT+
Sbjct: 306 LGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLIEILRRFKRRTV 365

Query: 369 YANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGP--NNITVSDNTAFFNKNFI 426
           YANA+NDGIVPLYT+ LL+LDY+ IL++L++ +EN S   P  N+ +   N  FFNK FI
Sbjct: 366 YANAINDGIVPLYTASLLFLDYNDILEQLQKLKEN-SKKSPLINDASTPVNQDFFNKTFI 424

Query: 427 SPLTKMLSLWAPQKFP-ESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDK 485
           SPLTKMLS+ APQKFP E+  +IPKVSFF+SA+SILLPPLP+  +I++P  R+ +IIHDK
Sbjct: 425 SPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHDK 484

Query: 486 IYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVI 545
           IY E+DI   E D +  FF  KNI LQA      E+ KY+ LE+TIA RWH+G++WRKV+
Sbjct: 485 IYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKVV 544

Query: 546 VALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSG---------------------ENF 584
           VALKPDAHNNIIVRR+F+NAYGWPVIDHLI  HF+G                     ++ 
Sbjct: 545 VALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDENDDINSTQVVEPIQSV 604

Query: 585 EMDSQKDVSITTTREDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATA 644
               +K        ++  W+ + + +G+F EGPTGMISTVGEIVE+ AK+ FS ++D   
Sbjct: 605 TEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVIDRRN 664

Query: 645 SNEESLREI 653
           ++E+   E+
Sbjct: 665 ASEDPNDEV 673

>Kwal_23.3464
          Length = 668

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/640 (54%), Positives = 460/640 (71%), Gaps = 22/640 (3%)

Query: 10  ILYHYRSSVKVGEIERYLIEYILYEDDE-IPDDLKLDSLYVRLKNCSPLSFRAGYLAGPF 68
           ++YH +SSVKVGE+ERY+I Y LY+DDE +P DL L+SL+++++N    +FRA YL GP+
Sbjct: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65

Query: 69  ILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQIL 128
           +LY DVR+++YHHSQ +  SAD P FE  LQ QQ  + ELSLHN++  YVW++DVVSQI+
Sbjct: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125

Query: 129 FTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPKK 188
           FTT T V FEV+VG  RK L +++E    P  GS  + L V+RLT+ DLW LP +L+   
Sbjct: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFS--PVSGSLESKLNVTRLTSLDLWNLPVQLSTHT 183

Query: 189 DIK-HLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLG 247
             K HLVILTHGLHSNV AD+ YL E+I K Q  +P E ++V G+  NVC+TEKG+ YLG
Sbjct: 184 HQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLG 243

Query: 248 TRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIASP 307
           TRLA+YI+  LY   VKKISF+GHSLGGLVQTFAI  +  +YPWFF  V P+NFIT+A+P
Sbjct: 244 TRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATP 303

Query: 308 MLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERRT 367
           +LGIVTDNPAY+N+LLSFG+VG+TG+DL L     D KPLLY L G+  +++LR F+RRT
Sbjct: 304 LLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVLRMFKRRT 363

Query: 368 IYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFFNKNFIS 427
           IYANAVNDGIVPLY++ LL+LDY+ +L +L+ K E +     N  T SD   F ++NF+S
Sbjct: 364 IYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSN--TSSD---FISRNFLS 418

Query: 428 PLTKMLSLWAPQKFPESDP-KIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDKI 486
           P++K +S WAPQKFP+    KIPKVS  +SA S+L+PPLP+  +I+NP  R +IIIHDKI
Sbjct: 419 PISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKI 478

Query: 487 YTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVIV 546
           Y ++++   E   +     + N  L+A +  + +  +   LE+ IA RWH+G+SWRKV+V
Sbjct: 479 YCDQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNR--RLEEEIARRWHEGISWRKVVV 536

Query: 547 ALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSG---ENFEMDSQKDVSITTT------ 597
            LKPDAHNNIIVRRRFSNAYGWPV+DHL   HF+    E+ EMDS    S+ +       
Sbjct: 537 GLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEMDSMVTNSVKSDQTSPED 596

Query: 598 -REDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRF 636
            +ED +W+    ++ +F  GPTGMISTVGEI++S AK  F
Sbjct: 597 HKEDRSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSF 636

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/641 (51%), Positives = 458/641 (71%), Gaps = 26/641 (4%)

Query: 8   KDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGP 67
           +++LYHYRSSV++GE+ERY+I Y LY+++E+P+ ++L SL++++KN S L++RA YL GP
Sbjct: 7   REVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGP 66

Query: 68  FILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQI 127
           ++LY D+R+ +YHHSQ + SSAD PQFE  +Q Q   + ELSLH +Q +YVW+LDVVSQI
Sbjct: 67  YMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQI 126

Query: 128 LFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPK 187
           +FTTN+ VPFEVT+   +  LE+   +   P  GS +  L V+R TT DLW LP+++   
Sbjct: 127 IFTTNSVVPFEVTIASAKPALEDTATLA--PQAGSFNRRLTVNRQTTLDLWNLPQQVFDD 184

Query: 188 -KDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYL 246
               +HLV+LTHGLHSNV+AD+ YL E I + Q  +PNE ++V G+ DNVC+TEKG++YL
Sbjct: 185 YTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYL 244

Query: 247 GTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIAS 306
           G RL +YI+  LY+  +K+ISF+GHSLGGL QTFAI  +A  YPWFF+KV PVNF+ ++S
Sbjct: 245 GGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSS 304

Query: 307 PMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERR 366
           P+LGIVT+NPAY+N+LLS GVVG+TG+DL L     D++PLL SL G   R ILRKF++R
Sbjct: 305 PLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKR 364

Query: 367 TIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFFNKNFI 426
           T+YANAVNDGIVPLYTS LLYLDYD+ILK+L  +E              D   FF K  I
Sbjct: 365 TLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQ-----------VDKQDFFTKTLI 413

Query: 427 SPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDKI 486
           +PL K +++  PQ   +S   IPKVS F SA S+LLPPLP+ ++++NP     +I+HDK+
Sbjct: 414 NPLVKAINVLMPQT--QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKM 471

Query: 487 YTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVIV 546
           Y+E DI +V + P+      KNI+   L  + + + +Y++LE+ IA +WHKG++WRKVIV
Sbjct: 472 YSEADIPEVGQPPE------KNIWSSLLLNIGNNE-EYKQLEEEIAKKWHKGMTWRKVIV 524

Query: 547 ALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENF---EMDSQKDVSITTTREDLNW 603
            LKPDAHNNIIVRRRF+NAYGWPVIDHL+  HF+G ++   E ++++        ++  W
Sbjct: 525 HLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKW 584

Query: 604 IKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATA 644
           I RP  +  F  GPTGMIS+VGEI+E+     F     A++
Sbjct: 585 INRPHNETFFDVGPTGMISSVGEILENIKNSAFQKTASASS 625

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/652 (48%), Positives = 441/652 (67%), Gaps = 23/652 (3%)

Query: 6   ANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLA 65
           ++ DI+YH++SS+++GE+ERY+  Y LY  DEIP DL LDSL++++KN   ++ RA YL 
Sbjct: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89

Query: 66  GPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVS 125
           GP++LY DVR+ +YHH Q +  SAD PQFE+N+Q QQ  + ELSLHN++ +YVWI+D+ S
Sbjct: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149

Query: 126 QILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWK---LPR 182
           QILFT   ++ F +TVG  ++ +  ++       LG  S+ + V RLTT DLW    L +
Sbjct: 150 QILFTKQASINFSITVGGSKESISVDSARNI--QLGVQSSRMKVDRLTTADLWNASLLSK 207

Query: 183 ELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKG 242
            +  ++  +HLVILTHGLHSNV++DL Y+ E+I K+Q N   E+L+V G+ DNVC+TEKG
Sbjct: 208 SVFGRRK-EHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTEKG 265

Query: 243 VRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFI 302
           +++LGTRLA++I+ NLY+    KISF+GHSLGGLVQ+FAI  ++  YP FF++V+PVNFI
Sbjct: 266 IKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFI 325

Query: 303 TIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSL-SGEFIRSILR 361
           T+ASPMLGIV+DN  YI  LL+ G+ G+TG+DL+L      ++PLL +L S   +R IL+
Sbjct: 326 TMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILK 385

Query: 362 KFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFF 421
            F+  T+YANA NDGIVPLYTS LL+LDYD IL KL    E+              T FF
Sbjct: 386 CFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDL------------QTDFF 433

Query: 422 NKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDII 481
            +NFISPLTK + +  PQ+  ++  KIP  S   SA S+L+PPLPD ++I +PK R D++
Sbjct: 434 QRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVV 493

Query: 482 IHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSW 541
           +HDK+Y+ +DI D + +      N+ N+ L+  +       +Y++LE+ IA  WHK + W
Sbjct: 494 VHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFG--GQYKKLEEQIARNWHKDVKW 551

Query: 542 RKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTREDL 601
           RKVI+ LKPDAHNNII RRRFSNAYGWPV+DHL   HF  ++    S K +   +  ED 
Sbjct: 552 RKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWK-LDPISKDEDF 610

Query: 602 NWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATASNEESLREI 653
           +WI +P  D +F  GPTGMI T GE++E+        + ++T     S  E+
Sbjct: 611 DWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMTESTVPTSYSQEEL 662

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/666 (45%), Positives = 426/666 (63%), Gaps = 51/666 (7%)

Query: 1   MDEIDANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFR 60
           M+   +  ++LYH +SSVK+GE+ERY+I Y LY+ D IP D+ LDSL+V++KN + LS++
Sbjct: 1   MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYK 60

Query: 61  AGYLAGPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWI 120
             YL GPFILY DVR+ +Y  S  I+ SAD P F++NLQAQQ  + ELSLH+I+ +YVWI
Sbjct: 61  PAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWI 120

Query: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLI-----VSRLTTD 175
           +D+VSQILF   T V FE+ VG  +  L+   +I C   L   + N++     V RLTT 
Sbjct: 121 VDIVSQILFNKETKVTFEIVVGNSKASLKR--KIRCNDSLPDKACNILHTGLSVHRLTTA 178

Query: 176 DLWKLPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDN 235
           D+WK+PR +   +   HLVILTHG  SNVSAD+ YLMEEIYK+Q N PNE L++ GY  N
Sbjct: 179 DIWKVPRPIDMSQK-SHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKN 237

Query: 236 VCETEKGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK 295
            CETEKG+++LG  LA+YIID LYD  V KISF+GHSLGGL QTFAI  +  +YP+FF K
Sbjct: 238 ACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKK 297

Query: 296 VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEF 355
           V+P+NFI++ASP+LGI T  P Y+ + LS G++G TG++L L      +KPLLY LS E 
Sbjct: 298 VEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEES 357

Query: 356 IRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLR-----------EKEENK 404
           + S+L +F+RRT+YANAVNDGIVPLY+S LL+LDY  +L+KL            + E + 
Sbjct: 358 LISVLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVSP 417

Query: 405 SLSGPNNITVSDNTAFFNKNFISPLTKMLSLWAPQK--FPESDPKIPKVSFFQSAASILL 462
               PN+  V+++    N       +   + W  ++    +   ++   S  +S  S+LL
Sbjct: 418 IGELPNHSDVANDDDGINA------SSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLL 471

Query: 463 PPLPDINFIVNPKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKT 522
            P PD  F  +P  R   IIHDKIYTE+++      P  + +        A     + KT
Sbjct: 472 SPCPDAKFFSDPDARVATIIHDKIYTEKNL----PPPSPTLYEG-----TAAKEGETRKT 522

Query: 523 KYQELEKTIAIRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGE 582
           + +E+E+ IA RWHKG+ WRKV+V LKPDAHNNIIVRRRFSNAYGWPV+DHL++ HF  +
Sbjct: 523 R-KEMEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRD 581

Query: 583 NF-------EMDSQKDVSITTTREDLN----WIKRPDEDGLFKEGPTGMISTVGEIVESF 631
           +        +  +++D+++ T   + N    W+ + ++  ++     G++ST  ++  S+
Sbjct: 582 DPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH---GGIVSTASQLASSW 638

Query: 632 AKKRFS 637
             K  S
Sbjct: 639 ISKHSS 644

>Scas_613.14
          Length = 628

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/628 (47%), Positives = 403/628 (64%), Gaps = 50/628 (7%)

Query: 6   ANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLA 65
           ++  +LY   S VK+G I RY+I+Y LY  DEIP  + LD L + +KN    SF+A YL 
Sbjct: 6   SDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLM 65

Query: 66  GPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVS 125
           GPF LY DVR+ +YHH Q IVSS D PQF +NLQ     + ELSLH I+ KYVWI+DV+S
Sbjct: 66  GPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVIS 125

Query: 126 QILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNN------LIVSRLTTDDLWK 179
           Q +F+ N+   FE+T                   LG+T+NN      L V  L+TD +W 
Sbjct: 126 QSIFSLNSVTSFELT-------------------LGTTTNNYNSGSSLEVETLSTDVIWN 166

Query: 180 ----LPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDN 235
               +P     +K I HLVILTHG+HSNV+AD+SYLME+IY +Q+ + NE ++V GY  N
Sbjct: 167 EKATIPLLRESRKMI-HLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGN 225

Query: 236 VCETEKGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK 295
           VC+TE G+++LG  LA YIID LY  +V KISF+GHSLGGL+Q+FAI ++A  +PWFF+K
Sbjct: 226 VCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEK 285

Query: 296 VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEF 355
           VKPVNFIT+A+P LGIVTDNP+Y+ +LLS G++G+TG DL L     +   +LY LSGE 
Sbjct: 286 VKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDN---ILYLLSGEP 342

Query: 356 IRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITV- 414
           I+SI++KFERRT+YANA+NDGIVPLYTS LL+LDY  +L +L       +L     IT+ 
Sbjct: 343 IKSIMKKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSEL------DNLKRSIKITID 396

Query: 415 SDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNP 474
           +  +   ++  I+  +    ++  +K  +   K+PK S  +S ASIL PP P   +I NP
Sbjct: 397 TPESGRESEKIINTSSSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNP 456

Query: 475 KHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKN-IFLQALSTVTSEKTKYQELEKTIAI 533
             R  +IIHDK+YTE+DI+ +E    S+F+  KN   L       S   + + LE  IA 
Sbjct: 457 SSRAKVIIHDKVYTEDDIERIE----SNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAK 512

Query: 534 RWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEM--DSQKD 591
           RWH G  WRKVIVAL  +AHNNIIVRRRFSN YGW VIDHLI  HF+G +  +  ++++ 
Sbjct: 513 RWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQ 572

Query: 592 VSITTTRE---DLNWIKRPDEDGLFKEG 616
             +  T E   + +WI + ++   +  G
Sbjct: 573 AVMKATMEPNKEFSWITKVEDPCSYSGG 600

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  347 bits (891), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 222/587 (37%), Positives = 327/587 (55%), Gaps = 72/587 (12%)

Query: 11  LYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPFIL 70
           + H R ++ +GE  R+LIE     D  +         +VRL+N +  + RA YL GPF+L
Sbjct: 1   MIHVRGALAIGETSRFLIEVNSNIDGPV---------FVRLRNRTKATRRATYLLGPFVL 51

Query: 71  YGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELS---LHNIQSKYVWILDVVSQI 127
           Y D R     +    V     PQF+AN++ Q     +L      ++  K  WI+DVVS++
Sbjct: 52  YCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106

Query: 128 LFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLP------ 181
           LF   T V +E+ + +D    +++   + +    S   +++  + +  D+ +        
Sbjct: 107 LFNQITKVDYELLISLDINNFKKSKYQQDI--YESIEGDVVAKQYSNHDIQEFIEVGAKI 164

Query: 182 RELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEK 241
           ++   K+  +HLVI+THG+ SNVS D+ Y+ME++     +  +E LI+DGY  NVC TE 
Sbjct: 165 KKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTEL 224

Query: 242 GVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNF 301
           G++ LG RLA+YI+   Y+ ++KKISF+GHSLGGLVQTFAI  +   + WFFD VKPVNF
Sbjct: 225 GIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNF 284

Query: 302 ITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDV-DLPDEKPLLYSLSGEFIRSIL 360
           I++A+P LG+ +    Y   LLS G +G+TG+DL     +      +LY LSG+   SIL
Sbjct: 285 ISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSIL 344

Query: 361 RKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILK--KLREKEENKSLSGPNNITVS--- 415
           +KFERRT+YANA+NDGIVPL +S LLYLDY  ILK  KL +KE +   S    I ++   
Sbjct: 345 QKFERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIRS----IVMTWKE 400

Query: 416 --DNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVN 473
             D+  F     ++P +K+                 +VS   +  +++LP  P      N
Sbjct: 401 FQDSEDFKVYKKVNPKSKIFR---------------RVSLTNTVGNLVLPEPPK-----N 440

Query: 474 PKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNI-FLQALSTVTSEKTKYQELEKTIA 532
                 ++IHD++Y   DI      PDS +F    I  + A+           +L++ +A
Sbjct: 441 ITSDMKVLIHDQVYQYNDI------PDSEYFPPDGIDEIMAMDR--------HQLQECMA 486

Query: 533 IRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHF 579
            RWH G SWRKVIV L+ DAHN+I VRRR+SN+ GW VI H+I  HF
Sbjct: 487 RRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  298 bits (763), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 201/636 (31%), Positives = 326/636 (51%), Gaps = 87/636 (13%)

Query: 6   ANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLA 65
            N  +LY+ +  +  GE+ RY+I+    +  ++    K++ L +R+KN      R  YL 
Sbjct: 20  GNHVLLYNDQRGISQGEVFRYIIKV---DKAQLDAKTKIEELVLRIKNVESPLLRPIYLT 76

Query: 66  GPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHN----IQSK-YVWI 120
           GP+ +Y +VR  NY   ++     D  QF ++L+  +     L L+     ++S  Y W 
Sbjct: 77  GPYSVYAEVRPYNY--DENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQVLESTVYSWT 134

Query: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKL 180
            DV+SQ+ +  +  +   +++G  R + +    ++         +   V    T  +W  
Sbjct: 135 ADVLSQMTWMVDHPILVRLSIGNTRSIGKA--AMKTPARAVEPVSGFTVEIQDTMTVWNE 192

Query: 181 PRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFP---NEILIVDGYFDNVC 237
           P  L P++ + HLVI+THG+ SN+  D+ YL + + K         N+ ++V GY  N+ 
Sbjct: 193 P-PLFPERPV-HLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNIG 250

Query: 238 ETEKGVRYLGTRLADYIIDNLYDAD----VKKISFVGHSLGGLVQTFAIGNLAARYPWFF 293
           ++ KG+ YL  R+ADY++  +        + +ISF+GHSLGGLVQTFAI  +  R P  F
Sbjct: 251 KSHKGIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDPGIF 310

Query: 294 D----KVKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLP------- 342
                 ++P+NFI +ASP LG++ D P Y  + L+FG +GRTGKDLNL  D         
Sbjct: 311 SPQAGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISELVRN 370

Query: 343 -----DEKPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDY------- 390
                + +P+L S+    ++S+L+ F  RT+YANA++DGIVPL TS LLYLD+       
Sbjct: 371 PKQAYNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLYLDWYSLQEVN 430

Query: 391 ----------------DAILKK---------LREKEENKSLSGPNNITVSDNTAFFNKNF 425
                           D  LK+         L EK++      P  +    +  +     
Sbjct: 431 LIGAQEGAETFDLGEEDHALKRYDTVEIPPDLSEKKDTIRWLLPRALIKRRHKWYKRSQT 490

Query: 426 ISPLTKMLSLWAPQKFPESD-PKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHD 484
           + P   +  LW      +SD   + K S   SAA+IL+ P P  ++  +P+ R D I HD
Sbjct: 491 VKP--GIEQLWD----EDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRTDYIFHD 544

Query: 485 KIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKV 544
           K Y+ E++         +++ N+ +    L  +     K    ++ IA  + + +SWRKV
Sbjct: 545 KRYSPEELP-------PAYYRNREL----LKKILYPNDKVHRTQEKIARGYQESMSWRKV 593

Query: 545 IVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFS 580
           +V ++P++HNNIIVRRRF N++GW VI+HL++EHF 
Sbjct: 594 LVNIQPESHNNIIVRRRFVNSFGWIVIEHLVNEHFG 629

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  295 bits (756), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 207/644 (32%), Positives = 327/644 (50%), Gaps = 97/644 (15%)

Query: 10  ILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKL--DSLYVRLKNCSPLSFRAGYLAGP 67
           +L     S+ +G++ RY I  I+ ++  + D ++   D+LY+  KN      R  ++ GP
Sbjct: 19  LLLRETGSLGIGDVNRYKI--IVDKNKLLSDGIECTDDTLYLEFKNQESALLRPLWITGP 76

Query: 68  FILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLH-----NIQSKYVWILD 122
           + +Y ++  NNY   +  +   D  +F ++L+  +    +L L+     +  S Y W +D
Sbjct: 77  YSIYVEITPNNYDERKQFI--GDGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKID 134

Query: 123 VVSQILFTTNTNVPFEVTVGMDRKML---EENNEIECLPHLGSTSNNLIVSRLTTDDLWK 179
           +++Q    T   +PF  T+    K     +++  IE        ++ L +S+L T+ LW 
Sbjct: 135 LIAQFTVVTIVRLPFVFTLATTYKTAKHSQKDKNIEV-----QQTDGLKISKLDTEQLWN 189

Query: 180 LPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFP---NEILIVDGYFDNV 236
           LP    P K + HLVI+THG+ S++  D+  L + I ++    P   N  L++ GY  NV
Sbjct: 190 LPPPF-PDKPV-HLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNV 247

Query: 237 CETEKGVRYLGTRLADYIIDNL----YDADVKKISFVGHSLGGLVQTFAIGNLAARYPWF 292
            ++ KG+R+LG +LA+YIID +        + +ISFVGHSLGG VQ  AI  ++   P  
Sbjct: 248 GKSHKGIRHLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDI 307

Query: 293 FDK---VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVD--LPDE--- 344
           FDK   + PVNF+  ASP LG++ D P YI+++L  G +G+TG+DL L     LP +   
Sbjct: 308 FDKTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIV 367

Query: 345 -----------KPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAI 393
                      KP+L  L       + ++F+ RT+YAN   DGIVPL T+ LLYLD+  +
Sbjct: 368 NNDGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRGL 427

Query: 394 LKKLREKEENKSLS------------GPNNITVSDNTAFFN---------KNFISPLTKM 432
               + + EN + S            G    + SDN +            K    P  + 
Sbjct: 428 SDVQQVRSENNAQSEEGVEEQKGSSLGEIPESSSDNKSILQWLLPQSLIKKEKYKPYVRT 487

Query: 433 LS--------------LWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRN 478
            +                +P  F    PK  K +  Q+AAS +  PLP ++++V+P  R 
Sbjct: 488 QTTSSVESASSDSNNNSDSPTTF--KPPK--KANTLQAAASTISAPLPGMSYLVDPSSRT 543

Query: 479 DIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKG 538
           D IIHDK+YT E++ D         + +K +  + +    S   K    E+ IA  W + 
Sbjct: 544 DRIIHDKVYTPEELPD-------KHYKHKKLVKKIIYPNYSIHMK----EERIARYWQET 592

Query: 539 LSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGE 582
           + WRKVIV L+PD+HNNIIVRRRF N++GW V++H+  EHF  +
Sbjct: 593 MDWRKVIVELQPDSHNNIIVRRRFVNSFGWIVVNHIADEHFGSK 636

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  286 bits (732), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 202/650 (31%), Positives = 325/650 (50%), Gaps = 101/650 (15%)

Query: 10  ILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPFI 69
           +L   R  +++GE+ RY  ++ + +D      L +  L++R+KN      R  YL GP+ 
Sbjct: 21  LLVDERKRLRIGELYRY--KFSVNKDVIKEQGLDVSHLFLRIKNEESALLRPLYLTGPYS 78

Query: 70  LYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQ---VKVM--ELSLHNIQSKYVWILDVV 124
            Y DVR +NY+ ++        P F  NL+  +   VK++  E S     S Y W +D++
Sbjct: 79  FYIDVRPHNYNENRKFPGKEIIP-FVENLKPDERFKVKILLNENSRVGDTSLYSWTIDII 137

Query: 125 SQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPREL 184
           SQ+  TT   + F   +G  RK+++++N       L  +   + +    T+ LW LP + 
Sbjct: 138 SQLAVTTIPKLEFSFRIGTTRKVVKKSN------GLFKSIEGVSLEMWDTETLWDLPPKF 191

Query: 185 APKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFP-----NEILIVDGYFDNVCET 239
            P+K + HLVI+THG+ SN+  D+ Y+ ++I   +  FP     N  +IV G+  NV ++
Sbjct: 192 -PEKPV-HLVIMTHGIFSNIGCDMLYMKDKI--EEMTFPMDESINPNIIVRGFMGNVGKS 247

Query: 240 EKGVRYLGTRLADYIIDNLYDAD----VKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK 295
             G+  LG R+  Y+++ +   +    V +ISF+GHSLGG  Q+ A+  ++ + P FFD 
Sbjct: 248 GHGIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIKRPDFFDA 307

Query: 296 VK---PVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYS-- 350
           VK   PVNFIT+ASP +G++ D P Y+++ L  G +G TG+DLNL       K  LY+  
Sbjct: 308 VKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSKDGLYADD 367

Query: 351 -------------LSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKL 397
                        L     + +   F+RRTIYAN ++DGIVPL T+ LLYLD+ +I K  
Sbjct: 368 EVYPEHSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAALLYLDWRSIHKVQ 427

Query: 398 REKEENKSLSGPNNITVSDN------TAFFNKN--------FISPLTKMLSLWAPQKFPE 443
           + +++NK+    +    SD+      ++  N+N          SP  K    W   +   
Sbjct: 428 KIRKKNKNSPTSSEFVSSDSPESSGASSPSNENGNNVGEIPAESPNKKATLQWTLPQAVI 487

Query: 444 SDPKIPKVSFFQ-------------------------------SAASILLPPLPDINFIV 472
              KI K    Q                               SA S+L   +PD  +I 
Sbjct: 488 HGSKINKYKRGQTNEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYIK 547

Query: 473 NPKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIA 532
           NP  R D +IHDK+Y  E++           + N+ I  + +    S       +++ IA
Sbjct: 548 NPAVRKDEVIHDKLYHPEELP-------PPHYENRPIVKKLIYPNES----VNRIQERIA 596

Query: 533 IRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGE 582
             W + ++WRKV+V ++PD+HNNI+VRRRF N YG+  ++H++  HF  +
Sbjct: 597 REWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHFGSK 646

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  275 bits (703), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 201/671 (29%), Positives = 326/671 (48%), Gaps = 103/671 (15%)

Query: 10  ILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPFI 69
           +L H ++S+ +G + RY+++    +  E  D +    LY+R KN      R  YL GP+ 
Sbjct: 8   LLVHEKNSLGIGGMCRYILQVDHKKLKE--DGIDTQELYLRFKNLESPLLRPVYLTGPYA 65

Query: 70  LYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLH---NIQSK------YVWI 120
            Y DVR  NY   +  + S D   F ++L+  +    +L  +    +Q+K      Y W 
Sbjct: 66  FYIDVRPCNYDEDKTYIGSEDV-AFCSDLKPDEKFKAKLYFNANSRLQTKNARDEIYSWT 124

Query: 121 LDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKL 180
           +D++SQ+   T   + +   VG  +K+++++   +      ++   L +       LW L
Sbjct: 125 IDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKV-----TSVRGLSLKMWDEKSLWNL 179

Query: 181 PRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFP---NEILIVDGYFDNVC 237
           P +  P K I HLVILTHG+ SNV  D+ Y+ ++I ++  N     N  ++V G  DN+ 
Sbjct: 180 PPKY-PDKPI-HLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPNVVVRGCMDNMG 237

Query: 238 ETEKGVRYLGTRLADYIIDNLYDA----DVKKISFVGHSLGGLVQTFAIGNLAARYPWFF 293
           ++  G+ YLG RLA +++  + +      V KISF+GHSLGG  Q+ AI  ++  YP FF
Sbjct: 238 KSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVMYPDFF 297

Query: 294 DKV---KPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLD------------ 338
           + V   KP++FI +ASP +G++ D P Y+++ L  G +G TG+DLNL             
Sbjct: 298 NTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSNEGLSA 357

Query: 339 VDLPDE-----KPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAI 393
           + L  E     K +L  +     + + + F  RT+YAN V+DGIVPL T+ LLYLD+ ++
Sbjct: 358 LTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTAALLYLDWRSL 417

Query: 394 --LKKLREKEENKSLSGPNNITVSDNTAFFNKN---------FISPLTKMLSLWAPQKFP 442
             +K +++    KS +     + +DN +    N           SP +K    WA  +  
Sbjct: 418 TQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEIPSESPNSKNFLQWALPQVI 477

Query: 443 ESDPKIPK-----------------------------------VSFFQSAASILLPPLPD 467
              PK+ K                                    S F SA S L  P+P 
Sbjct: 478 IKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKGPSEASTFMSALSTLTAPVPT 537

Query: 468 INFIVNPKHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQEL 527
             +I NPK R D ++HD++Y  +D+      P+  +          +  V         +
Sbjct: 538 QEYIKNPKVRKDRVVHDRVYEPQDL------PEQHYLKR-----STMKRVVYPNESVNRI 586

Query: 528 EKTIAIRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMD 587
           ++ IA  W   +SWRKV+V ++PD+HNNI+VRRRF N YG   + H++ EHF  E  +  
Sbjct: 587 QERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHFGLEACKKQ 646

Query: 588 SQKDVSITTTR 598
           +  + +I  T+
Sbjct: 647 AGVNNNIKLTK 657

>Kwal_47.18482
          Length = 623

 Score =  273 bits (699), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 200/636 (31%), Positives = 311/636 (48%), Gaps = 98/636 (15%)

Query: 15  RSSVKVGEIERYLIEYILYEDDEIPDD--LKLDSLYVRLKNCSPLSFRAGYLAGPFILYG 72
           R  + +GE+ RY +      D  + DD    +   Y+  KN      R  YL GP+  Y 
Sbjct: 15  RLKLGLGELVRYNVTV----DRSLLDDHLSHITEFYLTFKNTESAFLRPIYLTGPYSFYV 70

Query: 73  DVRSNNYHHS-------QHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVS 125
           DV+  NY          Q         ++ A LQ      +E S      ++VW ++V+S
Sbjct: 71  DVQPCNYDERIPFNEKLQFCEDVKPNEEYRAVLQLNDNSRVEES-----ERFVWQINVMS 125

Query: 126 QILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELA 185
           Q+  T    + F + +   +     ++EI   P   ++    +  +  T  LW LP    
Sbjct: 126 QLSVTKIPVLGFRLCISCGK-----SSEIPSSPV--TSIKGFVCEKWDTHGLWNLPPRF- 177

Query: 186 PKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQA----NFPNEILIVDGYFDNVCETEK 241
           P + + HLV+LTHG+ SNV  DL YL + I  + +    +     L+V GY  N   + K
Sbjct: 178 PDRPL-HLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGNQGRSSK 236

Query: 242 GVRYLGTRLADYIIDNLYDA----DVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK-- 295
           G++  G RLA +II+ + D     D++ ISFV HSLGG  Q  AI  +    P  FD   
Sbjct: 237 GIKANGVRLAKFIIETVDDLKEEYDLQYISFVAHSLGGPSQAMAIRYICLERPDIFDPAK 296

Query: 296 -VKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLD---------VDLPDEK 345
            +KP+NFIT+ASP LGI  + P ++ L L  GV+G+TG DLNL+         +   DEK
Sbjct: 297 GLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDGIVRKDEK 356

Query: 346 -------PLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAI--LKK 396
                  PLL  +    +  ++++FE RTIYAN ++DGIVPL T+ LLYLD+ A+  ++ 
Sbjct: 357 LGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLDWKALGDVRG 416

Query: 397 LREKEENKSLSGPNNITVSD---------------------NTAFFNKNFISPLTKMLSL 435
           +R +        P +    D                       A   K      T++LS 
Sbjct: 417 IRRENGKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRKYKKYTRTQILSQ 476

Query: 436 WAPQK--------FPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDKIY 487
            +  +         P S P  P  +   SAA+I++ PLP   ++ NPK R D I+HDKIY
Sbjct: 477 ESGNENSYSEESTEPISPP--PSANPLVSAANIIVAPLPTQKYLQNPKEREDKIVHDKIY 534

Query: 488 TEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVIVA 547
             +++         + +  +++    L  +     +   +++ IA +W + ++WRKV+V+
Sbjct: 535 YPDELP-------PAHYRKRDV----LKKIIYPNDRIYRVQERIARQWQETMNWRKVLVS 583

Query: 548 LKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGEN 583
           ++PD+HNNI+VRR+F NA+GW V+DHL+ EHF  E+
Sbjct: 584 IEPDSHNNIVVRRKFVNAFGWVVVDHLVKEHFGKES 619

>Scas_717.50
          Length = 658

 Score =  271 bits (694), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 190/658 (28%), Positives = 316/658 (48%), Gaps = 101/658 (15%)

Query: 5   DANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDD-LKLDSLYVRLKNCSPLSFRAGY 63
           D    +L +    + +G++ RY+I     +  ++ D  + ++ L++R+KN      R  Y
Sbjct: 13  DTKGILLLNETKKLGIGDLSRYIISV---DKKKLEDSGICIEELFLRIKNEESPLLRPVY 69

Query: 64  LAGPFILYGDVRSNNYHHSQ-----HIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYV 118
           L GP+  Y DVR +NYH  +      ++   ++ + +A  + +        + N  + Y 
Sbjct: 70  LTGPYTFYVDVRPHNYHEDEIFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTNT-YS 128

Query: 119 WILDVVSQILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLW 178
           W +D++SQ+       + +   +   +K  +  ++ +    +    +   V  L T  LW
Sbjct: 129 WTVDILSQLCVIPTPTLKYSFRIATTKKETKNGSKGKKPVKM----DGFEVKLLDTSSLW 184

Query: 179 KLPRELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEI---LIVDGYFDN 235
             P +  P K + HLVI+THG+ SN+  D+ Y+ ++I ++  + P +I   ++V G   N
Sbjct: 185 SFPPKY-PNKPV-HLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKN 242

Query: 236 VCETEKGVRYLGTRLADYIIDNLYDAD----VKKISFVGHSLGGLVQTFAIGNLAARYPW 291
           + ++  GV YLG R+A+YII+ + + +    V KISF+GHSLGG  Q  A+  ++ + P 
Sbjct: 243 MGKSAHGVHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPD 302

Query: 292 FF---DKVKPVNFITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNL----------- 337
            F     +KPVNFIT+ASP +G++ D P Y++L L  G +G TG+DLNL           
Sbjct: 303 IFHPTKGIKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGL 362

Query: 338 --DVDLPDEKPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTSGLLYLDYDAILK 395
             D +    K +L  +      +I  +F  RT+YAN V+DGIVPL T+ LLYLD++++ K
Sbjct: 363 TTDGNAAKTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVPLRTAALLYLDWNSLAK 422

Query: 396 KLREKEENKSLSGPNNITVSDNTAFFNKNFISP-----------------LTKMLSLWAP 438
             R ++ + S        V D+++       SP                 + K  +L   
Sbjct: 423 AKRIQDRSSSTQEAATPNVPDDSSVSRSETGSPSPNARHETPTGEIPSSGIDKKAALRWA 482

Query: 439 QKFPESDPKIPKVSFFQSAA---------------------------------SILLPPL 465
              P    K  +    +S+                                  S+L  PL
Sbjct: 483 LPLPSKRSKFKRGQVTESSMEDSSGNGSTTETDDNDANEFTAPPEASTMLAALSVLTAPL 542

Query: 466 PDINFIVNPKHR-NDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKY 524
           P   +I NP+ R +D I+HDKIYT ++I      P + + N       A+  V       
Sbjct: 543 PSQEYIKNPEVRHHDAIVHDKIYTPKEI------PRAHYANR-----PAIKKVIYPNESV 591

Query: 525 QELEKTIAIRWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGE 582
              ++ IA +W   ++WRKV+V +KPD+HNNI+VRRRF N YG   + H++ EHF  E
Sbjct: 592 NRTQERIARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDVAVSHMVEEHFGVE 649

>Kwal_55.21703
          Length = 441

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 105/210 (50%), Gaps = 24/210 (11%)

Query: 191 KHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIV---DGYFDNVCETEKGVRYLG 247
           KHL +L HGL  N    ++ + +   ++  +  N +      +GYF    +T  G+  +G
Sbjct: 4   KHLFVLVHGLWGNYK-HMNAIRDVFAETFHDHENTLFFSPRQNGYF----KTFDGIEIMG 58

Query: 248 TR----LADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
            R    L  +I +     ++ KISFVG+S+GGL+  F IG +       F  ++P  FIT
Sbjct: 59  YRTLLELCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFIT 117

Query: 304 IASPMLGI--------VTDNPAYINLLLSFG--VVGRTGKDLNLDVDLPDEKPLLYSLSG 353
            A+P LG+         +   A + +L + G  ++GRTG+ L +   LP++  L+   SG
Sbjct: 118 FATPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQDSLPEQSILVQLSSG 177

Query: 354 EFIRSILRKFERRTIYANAVNDGIVPLYTS 383
           E++  + R F+ R   AN  ND  V  YTS
Sbjct: 178 EYLHGLAR-FKHRLCVANVKNDRTVAFYTS 206

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 101/211 (47%), Gaps = 21/211 (9%)

Query: 192 HLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLGTRLA 251
           HLV L HGL  NV+  + YL   + + Q   P  +++     +    T  G+   G R+A
Sbjct: 5   HLVFLVHGLWGNVT-HMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 252 DYIIDNLYDAD-------VKKISFVGHSLGGLVQTFAIGNLAARYPWFFDK--VKPVNFI 302
             I + +   +       V K S VG+S+GGL+  +A+G L +    FF K  +K +NF 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSNQ--FFKKQDIKLINFT 121

Query: 303 TIASPMLGIVTDNP----AYINLLLSFGVVGRTGKDLNLD--VDLPDEKPL--LYSLSGE 354
           T  SP +G++           N + S  ++G +G+ + L   +   +  PL  L S+   
Sbjct: 122 TFCSPHVGVLAPGKNLAVRVFNFVCSL-ILGNSGRQMFLKDRIKAANGMPLIVLMSVGDS 180

Query: 355 FIRSILRKFERRTIYANAVNDGIVPLYTSGL 385
                L +F+ R++YAN VND     +TSG+
Sbjct: 181 IFYKALEQFQHRSLYANIVNDKRTAWWTSGI 211

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 110/207 (53%), Gaps = 14/207 (6%)

Query: 192 HLVILTHGLHSNVSA--DLSYLMEEIYKSQANFP--NEILIV-DGYFDNVCETEKGVRYL 246
           HLV+L HGL  N S   ++   +  +  S A     NE+++V   + +   +T  G+   
Sbjct: 16  HLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGIDVC 75

Query: 247 GTRLADYIID--NLYDAD-VKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
           G R++  I D  N Y +D V K S +G+SLGGL+  +A+G L     +  + ++ VNFIT
Sbjct: 76  GIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNFIT 135

Query: 304 IASPMLGIVT-DNPAYINL--LLSFGVVGRTGKDLNLDVDLPDEKPLLYSLS--GEFIRS 358
             +P +G++   N   +NL  ++   V+G +GK + L  D  +  PLLY +S        
Sbjct: 136 FCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFLK-DKYNGYPLLYVMSSPSSVFYK 194

Query: 359 ILRKFERRTIYANAVNDGIVPLYTSGL 385
            L++F+ R +YAN +ND     +TSG+
Sbjct: 195 ALKQFKYRALYANIINDKRTAWWTSGI 221

>Kwal_27.10102
          Length = 258

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 114/224 (50%), Gaps = 19/224 (8%)

Query: 177 LWKLPRELAPKKDIKHLVILTHGLHSNVSADLSYL---MEEIYKSQANFPN--EILIVDG 231
           + +L R    KK   HLV+L HGL  N S  L Y+   ++E ++S+ +  +  E+++   
Sbjct: 1   MLELERGSTGKKPC-HLVVLVHGLWGNRS-HLDYMSNALKESFESREDTCSKEELVVYTP 58

Query: 232 YFDNVCETEKGVRYLGTRLADYIIDNLYD-ADVKKISFVGHSLGGLVQTFAIGNLAARYP 290
           + +   +T  G+   G R+A  I + +     V K S  G+SLGGL+  +A+G L  R  
Sbjct: 59  HLNEGYKTYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQL 118

Query: 291 WFFDKVKPVNFITIASPMLGIVTDNP----AYINLLLSFGVVGRTGKDLNLDVDLP---D 343
           +    ++ VNF T  +P +G+            N ++   V+G +GK + L  D P    
Sbjct: 119 FKKRDIQLVNFTTFCTPHVGVYAPGKNVAVRLYNAIVPL-VLGSSGKQMFLK-DKPKFSG 176

Query: 344 EKPLLYSLSGE--FIRSILRKFERRTIYANAVNDGIVPLYTSGL 385
           E PL+ S+S E       L++F+ +++YAN +ND     +TSG+
Sbjct: 177 ELPLILSMSLENSIFYKALQEFQTKSLYANVINDKRTAWWTSGI 220

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 108/224 (48%), Gaps = 30/224 (13%)

Query: 185 APKKDIKHLVILTHGLHSNVS--------ADLSYLMEEIYKSQANFPNEILIV------D 230
           +P KD  HLV+L HGL  N S         D S    ++++       E ++V      +
Sbjct: 4   SPSKDY-HLVVLVHGLWGNGSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNE 62

Query: 231 GYFDNVCETEKGVRYLGTRLADYIIDNLYD-ADVKKISFVGHSLGGLVQTFAIGNLAARY 289
           GY     +T  G+   G R+A  I D +     V K S VG+SLGGL+  +A+G L  + 
Sbjct: 63  GY-----KTYDGIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQ 117

Query: 290 PWFFDKVKPVNFITIASPMLGIVT--DNPA--YINLLLSFGVVGRTGKDLNL--DVDLPD 343
            +    ++ +NF T  +P +G+     N A    N ++ F V+G +GK + L   V    
Sbjct: 118 LFKKHDIELINFTTFCTPHVGVYAPGKNIAVNLFNTIVPF-VLGNSGKQMFLKDQVRSAG 176

Query: 344 EKPLLYSLSGE--FIRSILRKFERRTIYANAVNDGIVPLYTSGL 385
             PL+Y +S E       L++F+ + +YAN +ND     +TSG+
Sbjct: 177 NLPLVYLMSMENSVFYKALQEFKYKALYANVINDKRTAWWTSGI 220

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 107/436 (24%), Positives = 191/436 (43%), Gaps = 85/436 (19%)

Query: 191 KHLVILTHGL---HSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLG 247
           KHL +L HGL   ++++ +  + L   + K   N  ++++      + + +T  G+  +G
Sbjct: 5   KHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVN--DDMIYFLPKQNAMFKTFDGIEIIG 62

Query: 248 TR----LADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
            R    + ++I D   D  + K+S +G+S GGLV  F IG +   +   F+ ++P  FIT
Sbjct: 63  YRTLIEVCEFIRD-YKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQLFIT 121

Query: 304 IASPMLGIVTDNP---AYINLL------LSFGVVGRTGKDLNLDVDLPDEKPLLYSLS-G 353
           +A+P LG+   NP   AY + L      L   ++G++G+++ +         +L  LS G
Sbjct: 122 MATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIA---NSSNNILVKLSQG 178

Query: 354 EFIRSILRKFERRTIYANAVNDGIVPLYTSGLL----YLDYDAILK-KLREKEENKSLSG 408
           E++ + L  F+ R  +AN  ND  V  YT+ +     ++D+D  LK    EK       G
Sbjct: 179 EYLEA-LSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKLKYTFEEKIPGSGYKG 237

Query: 409 PNNITVSDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDI 468
                V  N    N +            AP K  ++  K  +       A+ L+ P+  +
Sbjct: 238 ILPKIVDLNALNVNSH------------APTKPTKTYKKWGRTILIILVATFLILPIALV 285

Query: 469 --------NFIVNPKHRNDI---IIHD----KIYTEEDIKDVEKDPDSSFFN-------- 505
                   ++IV  K+R  +   I+H+    K+   E +K    D   S  N        
Sbjct: 286 MNGLGTAYSYIVTCKYRKMLSNGILHNEVRGKLGLTEQLKGYVTDAYGSIINSALDMDAN 345

Query: 506 ----NKNI----------FLQALSTVTSE--KTKYQEL----EKTIAIRWHKGLSWRKVI 545
               N N+          F+Q  +T+     K+K+++L     + + +R    L W +V 
Sbjct: 346 YEASNSNLVNEEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKVILRNLNKLKWIRVP 405

Query: 546 VALKP-DAHNNIIVRR 560
           + +K  +AH  I+ RR
Sbjct: 406 IYIKAVNAHGVIVARR 421

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 105/212 (49%), Gaps = 26/212 (12%)

Query: 191 KHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYF-----DNVCETEKGVRY 245
           KHL +L HGL  N     S  +E++  +  N        D  F     +   +T  G+  
Sbjct: 5   KHLFVLIHGLWGNYKHMKS--LEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDGIEI 62

Query: 246 LGTR----LADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNF 301
           +G R    L +++ +   D ++ KISFVG+SLGGLV  F +G + +     F  ++   F
Sbjct: 63  IGYRTLLELCEFMKE-FKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIF 121

Query: 302 ITIASPMLGIVTDNP-AYINLLLSFG--------VVGRTGKDLNLDVDLPDEKPLLYSLS 352
           +T+A+P LGI   NP  Y++  L F         ++G++G++L +     D   +L  LS
Sbjct: 122 MTMATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSND---ILVRLS 178

Query: 353 -GEFIRSILRKFERRTIYANAVNDGIVPLYTS 383
            G++I + L +F  R ++AN  ND  V  +T 
Sbjct: 179 EGKYIEA-LEEFNHRILFANVKNDRTVAFFTG 209

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 98/213 (46%), Gaps = 28/213 (13%)

Query: 191 KHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIV---DGYFDNVCETEKGVRYLG 247
           KHL +L HGL  N     S  ++ ++       N I      +GYF    +T  G+  +G
Sbjct: 4   KHLFVLVHGLWGNYKHMDS--IKGVFSKTFGDENVIFFAPKQNGYF----KTFDGIEIVG 57

Query: 248 TR----LADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
            R    L ++I        + KISF+G+S+GGL+  F IG +       F+ +    FIT
Sbjct: 58  YRTLLELCEFI-RKYGVGKITKISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFIT 116

Query: 304 IASPMLGI----------VTDNPAYINLLLSF---GVVGRTGKDLNLDVDLPDEKPLLYS 350
            A+P LG+           T +  +++ +LSF    V+GR+G+ L +      +  L+  
Sbjct: 117 FATPHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWDSTLVKL 176

Query: 351 LSGEFIRSILRKFERRTIYANAVNDGIVPLYTS 383
            S E++   L  F+ R   AN  ND  V  YTS
Sbjct: 177 SSDEYLLG-LSAFKYRICIANVKNDRTVAFYTS 208

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 21/209 (10%)

Query: 191 KHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLGTRL 250
           KHL IL HGL  N     S  ++E+ +   +  ++I+I         +T  G+R +   +
Sbjct: 7   KHLFILVHGLWGNHKHMNS--IKEMLEKTLDDIDDIVIFKPENSGYLKTLHGIRVVSYNV 64

Query: 251 ADYIID---NLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIASP 307
            D I     N       ++S +G+S+GGLV  F IG +       F  ++P+ F+T A+P
Sbjct: 65  LDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFMTFATP 124

Query: 308 MLGIVTDNPA-----YI------NLLLSFG--VVGRTGKDLNLDVDLPDEKPLLYSLSGE 354
            LG+    P+     Y+      ++L   G  ++GR+G ++   +   D++ L+    GE
Sbjct: 125 HLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIF--ISNKDDRILVDLSQGE 182

Query: 355 FIRSILRKFERRTIYANAVNDGIVPLYTS 383
           ++   L +F  R  +AN  ND  V  YTS
Sbjct: 183 YLYG-LSRFHHRVCFANVKNDRTVAFYTS 210

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 98/213 (46%), Gaps = 31/213 (14%)

Query: 191 KHLVILTHGL---HSNVSADLSYLMEEIYKSQANF-PNEILIVDGYFDNVCETEKGVRYL 246
           KHL +L HGL   HS++++  +   E +      + P      +GY     +T  G+  +
Sbjct: 5   KHLFVLVHGLWGTHSHMNSIKTAFSEALGDDAVFYVPRS----NGY----VKTLHGIELV 56

Query: 247 GTRLADYIIDNLYDADVKK---ISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFIT 303
           G +    + + +   D +K   ISF+G+S+GGLV  F IG +       F  ++PV F+T
Sbjct: 57  GYQTVVELTEFVQARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFMT 116

Query: 304 IASPMLGIVTDNP-----------AYINLLLSFG--VVGRTGKDLNLDVDLPDEKPLLYS 350
            A+P LG+    P           A + +    G   +GR+G+ L L  +  ++  L+  
Sbjct: 117 FATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLAYE--NDDTLVRM 174

Query: 351 LSGEFIRSILRKFERRTIYANAVNDGIVPLYTS 383
             G ++  + R F  R   AN  ND  V  YT+
Sbjct: 175 TEGVYLEQLAR-FRHRVCLANVKNDRTVAFYTA 206

>Scas_698.39
          Length = 471

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 106/223 (47%), Gaps = 29/223 (13%)

Query: 182 RELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYF----DNVC 237
           R L   +   HL IL HGL  N    +  L E +  S  +  + + +V  +F    + + 
Sbjct: 7   RPLVSNQKDAHLFILLHGLWGNYK-HMESLKETLKNSIQDDTDRLPLV--FFSPRQNAMF 63

Query: 238 ETEKGVRYLGTRLADYIIDNLY---DADVKKISFVGHSLGGLVQTFAIGNLAAR-----Y 289
           +T  GV  +G R    II  +    +    K+S +G+S+GGL+  F IG +  +      
Sbjct: 64  KTFDGVEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDE 123

Query: 290 PWFFDKVKPVNFITIASPMLGIVTDNP------AYINLLLSF---GVVGRTGKDLNLDVD 340
              F  ++P  FIT A+P LGI   NP       ++N +L+     ++G +G+++ +   
Sbjct: 124 MKVFKGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFI--- 180

Query: 341 LPDEKPLLYSLSGEFIRSILRKFERRTIYANAVNDGIVPLYTS 383
                 L+   SG+++ + L KF+ R ++AN  ND  V  YTS
Sbjct: 181 -MRNTELVELSSGKYLDA-LSKFKWRIVFANVKNDRTVAFYTS 221

>Scas_715.4
          Length = 231

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 49  VRLKNCSPLSFRAGYLAGPFILY---GDVRSNNYHHSQHIV-----SSADYPQFEANLQA 100
           +RL + +P +F A    GP  L+   GD     + H              + Q +     
Sbjct: 15  LRLNSRAP-NFTAASTVGPLNLHEYLGDSWGILFSHPADFTPVCTTEMGAFAQLKPEFDK 73

Query: 101 QQVKVMELSLHNIQSKYVWILDVVSQILFTTNTNVPFEVTVGMDRKM 147
           + VK++ LSL +++S   WI D+       +    PF +   +D+K+
Sbjct: 74  RNVKLVGLSLESVESHDKWIKDIQEVAKLPSKQPFPFPIIGDVDKKV 120

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%)

Query: 409 PNNITVSDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASIL 461
           PNN++ ++NT +F   +  P TK    W+   +        K+ F+  A   L
Sbjct: 62  PNNLSSNENTRYFTIMYRKPTTKKHKTWSGDGYATLKASSDKLCFYNEAGKFL 114

>Scas_578.9
          Length = 345

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 541 WRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTR 598
           W+K  +  + +A N +  +R+ S   G  ++  L SE+   +NFE+D+  D+S+ +T+
Sbjct: 251 WKKNHIIERINAENKLKAKRKLS---GREIVQKLTSEN---KNFEIDNADDMSLDSTQ 302

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 389 DYDAILKKLREKEENKSLSGPNNITVSDNTAFFNK---NFI 426
           D +  L+   E    +SL GPN ITV D+ + F K   NFI
Sbjct: 53  DKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFI 93

>Scas_705.12
          Length = 1447

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 16/119 (13%)

Query: 73  DVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQILFTTN 132
           D++ N       I+   D P+    ++   V   ELSL + + +  WI D +S      N
Sbjct: 300 DLKKNLMTEEDMIIRKTDIPERFQEIREGLVNYGELSLEDQELETNWISDKIS---LDKN 356

Query: 133 TNVPFEVT-----VGMDRKMLEENNEIECLPHLGSTSNNLIVSR------LTTDDLWKL 180
            +  +++T     VG   K + ++N +E +P + +   N I S+      LT DDLW +
Sbjct: 357 FDASYDLTEFKEAVGNSIKFINQDN-LE-VPFIYAYRRNYIASKDKDGFVLTEDDLWDI 413

>YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine
           protein kinase involved in vacuolar protein sorting
           [4365 bp, 1454 aa]
          Length = 1454

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 532 AIRWHKGLSWRKVIVALKPDAHNN---IIVRRRFSNAYGWPVIDHLISEHFSG--ENFEM 586
           ++R  K L W+K+I        NN    I +   S  YG+   D   S    G   +  +
Sbjct: 777 SVRASKSLFWKKIITNHVDSFGNNRIEFITKNYSSKNYGFNKRDTKSSSSLKGIKTSSTV 836

Query: 587 DSQKDVSITTTREDLNWIKRPDEDGLFKEGPTGMISTVGEIVES 630
            S  +  I  T ED+NWI +    GL ++    +++  G ++ +
Sbjct: 837 YSHDNKEIPLTAEDINWIDKFHIIGLTEKDIWKIVALRGYVIRT 880

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,666,950
Number of extensions: 1143596
Number of successful extensions: 3687
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3716
Number of HSP's successfully gapped: 52
Length of query: 662
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 554
Effective length of database: 12,857,365
Effective search space: 7122980210
Effective search space used: 7122980210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)