Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E04928g40539918640.0
Scas_618.1340735911401e-155
Sklu_1484.339938511241e-153
KLLA0E14850g39636310941e-148
YGL143C (MRF1)41336410891e-147
ADL284C42236110821e-146
Kwal_23.346740036510741e-145
Scas_590.1116371013e-05
Sklu_2044.512344986e-05
YLR281C15537981e-04
Kwal_56.2331315844981e-04
AGR281C17637982e-04
KLLA0C04642g16837972e-04
CAGL0F05027g18739850.008
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E04928g
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   722   0.0  
Scas_618.13                                                           443   e-155
Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           437   e-153
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   426   e-148
YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   424   e-147
ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   421   e-146
Kwal_23.3467                                                          418   e-145
Scas_590.1                                                             44   3e-05
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            42   6e-05
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    42   1e-04
Kwal_56.23313                                                          42   1e-04
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    42   2e-04
KLLA0C04642g complement(427221..427727) some similarities with s...    42   2e-04
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    37   0.008

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/399 (88%), Positives = 352/399 (88%)

Query: 1   MWIARNNLKVLSRARIPVWRAYRFXXXXXXXXXXXXXXFQELNPLLLKRVSGVSKELAEL 60
           MWIARNNLKVLSRARIPVWRAYRF              FQELNPLLLKRVSGVSKELAEL
Sbjct: 1   MWIARNNLKVLSRARIPVWRAYRFASTAASEADEEALEFQELNPLLLKRVSGVSKELAEL 60

Query: 61  EKQISNGYDEDVQRKYNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKSXXXXXXXXXXXX 120
           EKQISNGYDEDVQRKYNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKS            
Sbjct: 61  EKQISNGYDEDVQRKYNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKSLAEEAAAELHEL 120

Query: 121 VPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWK 180
           VPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWK
Sbjct: 121 VPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWK 180

Query: 181 HHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVV 240
           HHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVV
Sbjct: 181 HHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVV 240

Query: 241 VLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQ 300
           VLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQ
Sbjct: 241 VLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQ 300

Query: 301 DERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXXXXXXXVTTMDRSDKIRTYNFSQNRIT 360
           DERSQHRNKAKAFSILRS                     VTTMDRSDKIRTYNFSQNRIT
Sbjct: 301 DERSQHRNKAKAFSILRSKLAELEQQQKAEKERQVRKEQVTTMDRSDKIRTYNFSQNRIT 360

Query: 361 DHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQAESI 399
           DHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQAESI
Sbjct: 361 DHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQAESI 399

>Scas_618.13
          Length = 407

 Score =  443 bits (1140), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/359 (58%), Positives = 267/359 (74%), Gaps = 3/359 (0%)

Query: 41  ELNPLLLKRVSGVSKELAELEKQISNGYDEDV--QRKYNSLMSLQDVYDRYKEQLGNYRE 98
           EL P L+ + +   KELAEL KQ+S G   DV  Q+++  L S++D +  Y+ QL NY+ 
Sbjct: 45  ELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKS 104

Query: 99  LKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGGSE 158
           L+E+   D S            VP L +T  +L  RLIPPHPFA+KAC+LELRPGVGG+E
Sbjct: 105 LQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTE 164

Query: 159 AMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAGVH 218
           AMIF +DLLNMYIGYAH+ KWK+ I++  ENE+G G++DA+L IDEPG+Y+ L++E+GVH
Sbjct: 165 AMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVH 224

Query: 219 RVQRIPATESKGRTHTSTAAVVVLPQLGDEG-KDLDAFERSFKPEEIRIDVKRASGKGGQ 277
           RVQRIPATE+KGRTHTSTAAVVVLPQ+GD+  + ++A+ER+FKP+EIRIDV RA GKGGQ
Sbjct: 225 RVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQ 284

Query: 278 HVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXXXXX 337
           HVNTT+SAVRLTH PTGI++ MQDERSQ +NKAKAF+ILR+                   
Sbjct: 285 HVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRARLAEREQKLKEEKERDARK 344

Query: 338 XXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQA 396
             VTT DRSDKIRTYN+ QNR+TDHRCGL LY L+ ++ GERL +VI+A+R FDD  +A
Sbjct: 345 EQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERA 403

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  437 bits (1124), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 282/385 (73%), Gaps = 10/385 (2%)

Query: 18  VWRAYRFXXXXXXXXXXXXXXFQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRK 75
           +W + RF              F+EL+PLL+KR      EL +LE  +S G  +D + Q+K
Sbjct: 14  LWTSLRFQTTEAIE-------FKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKK 66

Query: 76  YNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRL 135
           +  L S+ D +  YK+ L NY++LK+MI  D S            +P L K++  LL++L
Sbjct: 67  FAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIKSSSSLLNKL 126

Query: 136 IPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGI 195
           +PPHPFA+K C+LELRPGVGG+EAMIFA+DLL+MYI YAH K+WK+HI S  ENE+GSGI
Sbjct: 127 LPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGI 186

Query: 196 MDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVVVLPQLGDEG-KDLDA 254
           +DA+L+IDEPG+YN L++EAGVHRVQRIPATE+KGRTHTSTAAV+VLPQ+G+E  K+ DA
Sbjct: 187 LDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADA 246

Query: 255 FERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFS 314
           +ER+FKP+EIRIDV RA GKGGQHVNTT+SAVRLTH P+GI+I MQ+ERSQH+NKAKAF+
Sbjct: 247 YERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFA 306

Query: 315 ILRSXXXXXXXXXXXXXXXXXXXXXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGV 374
           ILR+                     VTT DRSDKIRTYNF QNRITDHRCG NL++++GV
Sbjct: 307 ILRAKLAERERKEKEESARAARKGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGV 366

Query: 375 ISGERLDDVINAVRSFDDNIQAESI 399
           ++GERLDDVI A+  ++   +++ +
Sbjct: 367 MAGERLDDVIEAMERYEGATKSKEL 391

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 269/363 (74%), Gaps = 3/363 (0%)

Query: 39  FQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQLGNY 96
           F+ L+  L+ R      EL ELE  +S G  +D + Q+ +  L ++ D Y +Y+E++  Y
Sbjct: 29  FRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKYREEVNQY 88

Query: 97  RELKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGG 156
           +EL+E++++D S            +P+L KT   LL++L+PPHPFA+K  +LELRPGVGG
Sbjct: 89  KELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILELRPGVGG 148

Query: 157 SEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAG 216
           SEAMIF +DLLNMYI YA+  KWK +++S  EN +GSG+++A+L IDEPG+Y+ LK+EAG
Sbjct: 149 SEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYDKLKFEAG 208

Query: 217 VHRVQRIPATESKGRTHTSTAAVVVLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGG 276
           VHRVQR+PATESKGRTHTSTAAV+VLP++G+E +  DA+ER+FKP+EIRIDV RASGKGG
Sbjct: 209 VHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES-DAYERTFKPDEIRIDVMRASGKGG 267

Query: 277 QHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXXXX 336
           QHVNTT+SAVRLTH P+GI+I MQ+ERSQHRNKAKAF+ILR+                  
Sbjct: 268 QHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAILRARLAEKERLEKEEKERNAR 327

Query: 337 XXXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQA 396
              V+T DRSDKIRTYN+ QNRITDHRCG  LYD+EGV+ GERLDDVI+A+ +F    +A
Sbjct: 328 KDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMDAFSSEQKA 387

Query: 397 ESI 399
           + +
Sbjct: 388 KQL 390

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 204/364 (56%), Positives = 268/364 (73%), Gaps = 3/364 (0%)

Query: 39  FQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQLGNY 96
           + EL+PLL+K+      EL +L+K +S G  +D + Q+ Y  L +L D +  YKE+L   
Sbjct: 46  YTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNEL 105

Query: 97  RELKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGG 156
           + L+EMI  D S            VP  + T+  L+++L+PPHPFA+K  +LELRPGVGG
Sbjct: 106 KSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGG 165

Query: 157 SEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAG 216
            EAMIF ++LL+MYIGYA+ +KWK+ I+S  ENE+GSGI+DA+L+I+E G+Y+ L++EAG
Sbjct: 166 IEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAG 225

Query: 217 VHRVQRIPATESKGRTHTSTAAVVVLPQLGDE-GKDLDAFERSFKPEEIRIDVKRASGKG 275
           VHRVQRIP+TE+KGRTHTSTAAVVVLPQ+GDE  K +DA+ER+FKP EIR+D+ RASGKG
Sbjct: 226 VHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKG 285

Query: 276 GQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXXX 335
           GQHVNTT+SAVRLTHIP+GI++ MQDERSQH+NKAKAF+ILR+                 
Sbjct: 286 GQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTILRARLAEKERLEKEEKERKA 345

Query: 336 XXXXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQ 395
               V++ +RSDKIRTYNF QNRITDHRCG  L DL GV+SGERLD+VI A+  +D   +
Sbjct: 346 RKSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTER 405

Query: 396 AESI 399
           A+ +
Sbjct: 406 AKEL 409

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  421 bits (1082), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 263/361 (72%), Gaps = 3/361 (0%)

Query: 39  FQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQLGNY 96
           F+EL+P L+KR +G + EL  LEK +S G  +D + Q+KY+ L S+ D +  Y++ +  Y
Sbjct: 53  FRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMY 112

Query: 97  RELKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGG 156
           REL++MI  D S             P L ++   LL +L+PPHPFAEK C++ELRPGVGG
Sbjct: 113 RELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGG 172

Query: 157 SEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAG 216
            EAMIF +DLLNMYIGYA + +WK  + S  EN  G+G+ +A+L+IDEPG+Y+ +K+E+G
Sbjct: 173 IEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESG 232

Query: 217 VHRVQRIPATESKGRTHTSTAAVVVLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGG 276
           VHRVQRIPATESKGRTHTSTAAVVVLP++ +E +  DA+ER+FKP EIRIDV RASGKGG
Sbjct: 233 VHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES-DAYERTFKPGEIRIDVMRASGKGG 291

Query: 277 QHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXXXX 336
           QHVNTT+SAVR+TH P+GI IHMQ+ERSQHRNKAKAF ILR+                  
Sbjct: 292 QHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARERSAR 351

Query: 337 XXXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQA 396
              V++ DRSDKIRTYNF QNR+TDHRC ++L+ L  V++GERLD++I+++  +D   +A
Sbjct: 352 KDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKA 411

Query: 397 E 397
           +
Sbjct: 412 K 412

>Kwal_23.3467
          Length = 400

 Score =  418 bits (1074), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/365 (55%), Positives = 277/365 (75%), Gaps = 4/365 (1%)

Query: 39  FQELNPLLLKRVSGVSKELAELEKQISNG---YDEDVQRKYNSLMSLQDVYDRYKEQLGN 95
           F+EL+PLLLKR     +EL +LE+ ++ G   +D + Q+K++ L ++ D +  Y  ++  
Sbjct: 28  FKELHPLLLKRAEKYVEELQKLEEWMAKGGGSFDVERQKKFSKLSAVVDSFRIYSREVST 87

Query: 96  YRELKEMIDVDKSXXXXXXXXXXXXVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVG 155
           ++EL++M+  D S             P L+KT   LL +L+PPHPFA++ C+LE+RPGVG
Sbjct: 88  FKELQDMVKDDPSLRDEAELELVQIKPQLEKTASSLLTQLLPPHPFADRPCILEIRPGVG 147

Query: 156 GSEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEA 215
           G EAMIFA+DLLNMYI +AH K+WK+H++S  ENE+GSGI+DA+L+IDEPG+Y +L++E+
Sbjct: 148 GIEAMIFAQDLLNMYINFAHIKRWKYHLISSSENESGSGIVDAILSIDEPGSYEMLRFES 207

Query: 216 GVHRVQRIPATESKGRTHTSTAAVVVLPQLG-DEGKDLDAFERSFKPEEIRIDVKRASGK 274
           GVHRVQRIPATE+KGRTHTSTAAVVVLPQ+  D  K+ D++ER+FKP+EIRIDV RA GK
Sbjct: 208 GVHRVQRIPATETKGRTHTSTAAVVVLPQMAEDSEKEADSYERTFKPDEIRIDVMRARGK 267

Query: 275 GGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSXXXXXXXXXXXXXXXX 334
           GGQHVNTT+SAVRLTH P+GI+I+MQ+ERSQH+NKAKAF+ILR+                
Sbjct: 268 GGQHVNTTDSAVRLTHYPSGIVINMQNERSQHKNKAKAFAILRARLAEAERKEKEEKARA 327

Query: 335 XXXXXVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNI 394
                VTT DRSDKIRTYNF QNR+TDHRCG NL+D+EG+++GERL+DVI+A+  +D + 
Sbjct: 328 LRKGQVTTTDRSDKIRTYNFPQNRVTDHRCGFNLHDMEGIMAGERLEDVISAMSVYDSDS 387

Query: 395 QAESI 399
           +A+ +
Sbjct: 388 RAKEL 392

>Scas_590.1
          Length = 116

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNK 309
           G GGQ +N   S V+L H+PTGI++  Q+ RS+ +N+
Sbjct: 3   GAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNR 39

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSIL 316
           G GGQ +N   S V+L H+PTGI++  Q+ RS+ +N+  A   L
Sbjct: 15  GPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIARQKL 58

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNK 309
           G GGQ +N   S V+L H PTGI++  Q+ RS+ +N+
Sbjct: 47  GPGGQKINKCNSKVQLRHEPTGIVVECQETRSREQNR 83

>Kwal_56.23313
          Length = 158

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (65%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSIL 316
           G GGQ +N   S V+L H+PTGI++  Q+ RS+ +N+  A + L
Sbjct: 49  GPGGQKINKCNSKVQLRHLPTGIVVECQETRSRDQNRRLARNKL 92

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNK 309
           G GGQ +N   S V+L H+P+GI+I  Q  RS+ +N+
Sbjct: 63  GPGGQKINKCNSKVQLRHVPSGIVIECQATRSREQNR 99

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNK 309
           G GGQ +N   S V+L H+PTGI++  Q  RS+ +N+
Sbjct: 58  GPGGQKINKCNSKVQLRHVPTGIVVDCQATRSRDQNR 94

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 271 ASGKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNK 309
            +G GGQ +N   S V++ H+P+ I++  Q  RS+ +N+
Sbjct: 59  GTGPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNR 97

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,317,959
Number of extensions: 439880
Number of successful extensions: 1359
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1356
Number of HSP's successfully gapped: 22
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)