Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E02409g35723110211e-138
YOL007C3412393662e-40
Scas_644.133432383348e-36
Sklu_2419.73072332408e-23
Kwal_56.224883082272181e-19
ACL009C3211511162e-06
CAGL0J10076g37832760.16
Scas_694.26382216750.25
KLLA0F03465g35976662.7
Kwal_23.487830726636.0
Kwal_56.2370241664637.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02409g
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02409g complement(228503..229576) similar to sp|Q08054 Sac...   397   e-138
YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protei...   145   2e-40
Scas_644.13                                                           133   8e-36
Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement        97   8e-23
Kwal_56.22488                                                          89   1e-19
ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [...    49   2e-06
CAGL0J10076g complement(985926..987062) weakly similar to sp|P53...    34   0.16 
Scas_694.26                                                            33   0.25 
KLLA0F03465g complement(325270..326349) no similarity, hypotheti...    30   2.7  
Kwal_23.4878                                                           29   6.0  
Kwal_56.23702                                                          29   7.2  

>CAGL0E02409g complement(228503..229576) similar to sp|Q08054
           Saccharomyces cerevisiae YOL007c CSI2 involved in chitin
           synthesis, hypothetical start
          Length = 357

 Score =  397 bits (1021), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 197/231 (85%)

Query: 122 VGPIYIPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQ 181
           VGPIYIPSAQNNKYVYHATHPSGTVFTAFGSC                 RSWKNARKEYQ
Sbjct: 122 VGPIYIPSAQNNKYVYHATHPSGTVFTAFGSCLAFIALVLVLVWIALTLRSWKNARKEYQ 181

Query: 182 IRERENKYQLDPYYFQNGXXXXXXXXXXXXXXXXXEKILKKKASRMSLYSLGGGSAFNLL 241
           IRERENKYQLDPYYFQNG                 EKILKKKASRMSLYSLGGGSAFNLL
Sbjct: 182 IRERENKYQLDPYYFQNGDKDDYSSSDSDVASDISEKILKKKASRMSLYSLGGGSAFNLL 241

Query: 242 SSEKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIV 301
           SSEKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIV
Sbjct: 242 SSEKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIV 301

Query: 302 PQNGLNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL 352
           PQNGLNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL
Sbjct: 302 PQNGLNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL 352

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/43 (100%), Positives = 43/43 (100%)

Query: 1  MKSSQVTQIFLLIASFLVSSVDAVVVATQPSHHLHMRGLPKLV 43
          MKSSQVTQIFLLIASFLVSSVDAVVVATQPSHHLHMRGLPKLV
Sbjct: 1  MKSSQVTQIFLLIASFLVSSVDAVVVATQPSHHLHMRGLPKLV 43

>YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protein
           of unknown function [1026 bp, 341 aa]
          Length = 341

 Score =  145 bits (366), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 127/239 (53%), Gaps = 26/239 (10%)

Query: 125 IYIPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIRE 184
           +YIP    NK++Y A HP+GTVF AF  C                 +SW++ARKE ++R 
Sbjct: 113 VYIPVTDGNKFLYQAHHPNGTVFIAFAGCLGAILLSLTGAWIALNIKSWRSARKENKLRN 172

Query: 185 RENKYQLDPYYFQ-NGXXXXXXXXXXXXXXXXXEKILKKKASRMSLYSLGGGSAFNLLSS 243
            EN+YQ DP+YFQ N                  EK+LK  +SRMSLY+LG  S  NLL++
Sbjct: 173 LENQYQHDPFYFQTNINDDESETSSHSDDSDISEKVLKNNSSRMSLYTLGSTSVLNLLNN 232

Query: 244 EKLDTKPPAPPSNNPRLSMFISPTEILK---NEGNTW--STDSSAFNSLTSTPREQSVAN 298
           +          ++N R SMFISPTEIL+   N  NTW  S +S+ ++SL+STPRE     
Sbjct: 233 K-------TDANDNFRSSMFISPTEILQSDANNSNTWSQSNESAIYDSLSSTPREPGATQ 285

Query: 299 IIVPQNGLNKLGDP--PF--TGKNLS-NMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL 352
           I      L K  D   PF  T  NLS + +  STP   + +  G  K+ RPPS HLD L
Sbjct: 286 I------LGKFTDSTNPFNYTSYNLSPDSEDRSTPKSNVSQ--GKVKKYRPPSVHLDQL 336

>Scas_644.13
          Length = 343

 Score =  133 bits (334), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 119/238 (50%), Gaps = 21/238 (8%)

Query: 128 PSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIREREN 187
           P+   N  +YH  +  GTVF AFGSC                 ++W++ RKEYQ+R  E 
Sbjct: 108 PNTNGNYNIYHTNYTDGTVFIAFGSCLLFITLILSVVWAVLGLKAWRDERKEYQLRALEE 167

Query: 188 KYQLDPYYFQNGXXXXXXXXXXXXXXXXXEKILKKKASRMSLYSLGGGSAFNLL---SSE 244
           KYQ DP+  QN                  EK LK+K+SRMS YSLG  SA NLL   +++
Sbjct: 168 KYQYDPFQLQNEIDDSRSNSDNDSQSDISEKYLKQKSSRMSFYSLGTASALNLLNPKAND 227

Query: 245 KL---DTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPR-EQSVANII 300
           K    DT      ++N R SMFISPTEIL+ +   ++ DSS F+S  STP+ EQ+    +
Sbjct: 228 KYSDDDTNKINSAASNFRKSMFISPTEILQQDI-PFNNDSSIFDSAISTPKGEQTSTTQV 286

Query: 301 VP---QNGLNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGN---QKRGRPPSAHLDDL 352
           +     N    L D  F G  L  +D        +P  N N   +K  RPPSAHLD L
Sbjct: 287 IANPDNNNWGLLNDSSFQGLGLK-LD------SELPSSNENNQKKKNYRPPSAHLDQL 337

>Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement
          Length = 307

 Score = 97.1 bits (240), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 107/233 (45%), Gaps = 8/233 (3%)

Query: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIRERE 186
           IP   +NK +Y  ++  GTVF   G+                  R+W  ARKEY+++  E
Sbjct: 71  IPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALE 130

Query: 187 NKYQLDPYYF--QNGXXXXXXXXXXXXXXXXXEKILK-KKASRMSLYSLGGGSAFNLLSS 243
           NKYQ DP+ F   +                  EK+LK  ++ R S +SLG  S  NLL+ 
Sbjct: 131 NKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQSRRKSTHSLGSSSTLNLLNK 190

Query: 244 EKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTW--STDSSAFNSLTSTPREQSVANIIV 301
            +   K   P   + R SMFISPTEIL+ + +++     +S   S TSTP E+++   I 
Sbjct: 191 YENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGSTTSTPTEKTITQFIG 250

Query: 302 PQNGLNKLGDPP--FTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL 352
                   G  P     +N ++    S P ++  +    +K  RPPS HLD +
Sbjct: 251 STPNCFDRGRAPGVLLFENPTDALTVSVP-LSDTRQEQTRKSFRPPSVHLDQM 302

>Kwal_56.22488
          Length = 308

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 98/227 (43%), Gaps = 23/227 (10%)

Query: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIRERE 186
           +P +  NK +   ++ +GTVF A G                   ++W +ARKEY +   +
Sbjct: 99  VPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQ 158

Query: 187 NKYQLDPYYFQNGXXXXXXXXXXXXXXXXXEKILKKKAS-RMSLYSLGGGSAFNLLSSEK 245
           N+YQ DP+ F                    E++LK +AS R S+YSLG  S  NLL    
Sbjct: 159 NRYQTDPFLFHTS-EGDSDSSEGSDRSDVSERVLKTRASTRPSIYSLGSQSTLNLLQRHP 217

Query: 246 LDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIVPQNG 305
            D    A  +   R SMFISPTEI+KN  N  S  S A      TP  ++     V    
Sbjct: 218 QDN---AHITTANRGSMFISPTEIIKNSANNKSLMSLA------TPTSENFNITPVLNTD 268

Query: 306 LNKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDL 352
           L    DP +  K+L   D           PN   ++ RPPS HL+ +
Sbjct: 269 LTSHFDPIY-QKSLPAND-----------PNNVNRKARPPSVHLEKM 303

>ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [966
           bp, 321 aa]
          Length = 321

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 15/151 (9%)

Query: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIRERE 186
           IPS  NN+ +  +  PSG +F AFG                   RSW  ARKE++ +   
Sbjct: 121 IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA 180

Query: 187 NKYQLDPYYFQNGXXXXXXXXXXXXXXXXXEKILKKKA----SRMSLYSLGGGSAFNLLS 242
           ++Y       QN                  + +LK +     +R+SLYSLG  S+     
Sbjct: 181 SRY-------QNAALYNLSSDSADSAPYDSDLVLKVRKMDQLNRLSLYSLGSMSSLGGGE 233

Query: 243 SEKLDTKPPAPPSNNPRLSMFISPTEILKNE 273
             K   +     S   R SM+ISPT +++++
Sbjct: 234 HSKDANR----RSLENRASMYISPTNLIQHQ 260

>CAGL0J10076g complement(985926..987062) weakly similar to sp|P53947
           Saccharomyces cerevisiae YNL058c, hypothetical start
          Length = 378

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 122 VGPIYIPSAQNNKYVYHATHPSGTVFTAFGSC 153
           V  I  PSA+NN Y++  +  SGTVF A GS 
Sbjct: 93  VANIVPPSAENNPYIFRTSALSGTVFIAVGSI 124

>Scas_694.26
          Length = 382

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 82/216 (37%), Gaps = 31/216 (14%)

Query: 128 PSAQNNKYVY-HATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNA-RKEYQIRER 185
           PSA NN Y+   + HP GTVF A G+                   S +NA R  Y+  +R
Sbjct: 91  PSADNNPYILGKSKHPDGTVFIAVGTLVGFIFLALLVRWVTLSVLSRRNAKRSSYEPTDR 150

Query: 186 ENKYQLDPYYFQNGXXXXXXXXXXXXXXXXXEKILKKKASRMSLYSLGGGSAFNLLSSEK 245
           +  YQ     ++N                    +L +K  +  L   G    FN ++S+ 
Sbjct: 151 DFVYQQGSTNYENPFLLDEEKLSYDGG------LLDEKLRKSQLNITGSHHHFNSITSKS 204

Query: 246 LDTKPPAPPSNNPRLSMFISPTEILKNEGN-TWSTDSSAFN--------------SLTST 290
           +D++      N      +     I  ++ N   + D + FN              SL  +
Sbjct: 205 IDSE------NQEECREYHQGGYITDDDDNFMGAVDHARFNPIQDHIPSYYNNRKSLFIS 258

Query: 291 PREQSVANIIVPQNGLNKLGDPPFTGKNLSNMDISS 326
           P  +   N+    N L+ L DP   G+N+S + I++
Sbjct: 259 PTLELKQNL--DPNPLSNLNDPFRDGRNVSRISIAT 292

>KLLA0F03465g complement(325270..326349) no similarity, hypothetical
           start
          Length = 359

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCXXXXXXXXXXXXXXXXXRSWKNARKEYQIRERE 186
           +PSA+ N  ++ +  P+GTVF A GS                   S+  A++  +    E
Sbjct: 94  LPSAKGNPNIWSSNKPTGTVFIAVGSAAGFIFLALLVWFIINTWMSYSQAKQLKKFNNME 153

Query: 187 NKYQ---LDPYYFQNG 199
            ++Q   +D   F +G
Sbjct: 154 KQFQNPFIDDIDFSSG 169

>Kwal_23.4878
          Length = 307

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 128 PSAQNNKYVYHATHPSGTVFTAFGSC 153
           PS + N +++ +  PSGTVF A GS 
Sbjct: 57  PSIKGNPHIWSSNKPSGTVFIAVGSI 82

>Kwal_56.23702
          Length = 416

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 258 PRLSMFISPTEILKNEG-----NTWSTDSSAFNSLTSTPREQSVANIIVPQNGLNKLGDP 312
           PRL +F   T++L+N G      +W+  ++A++ + S   ++ V  ++  +NGLN+    
Sbjct: 270 PRL-VFEQQTQLLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYVFELLYGKNGLNQTSKD 328

Query: 313 PFTG 316
            F G
Sbjct: 329 LFIG 332

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,533,771
Number of extensions: 309368
Number of successful extensions: 822
Number of sequences better than 10.0: 26
Number of HSP's gapped: 800
Number of HSP's successfully gapped: 27
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)