Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E02387g19519210181e-143
YOL008W2071875472e-71
KLLA0C06050g2051765221e-67
Scas_644.122101935031e-64
Sklu_2419.52051734812e-61
ACL012W2041614586e-58
Kwal_56.224961941834438e-56
YDR457W (TOM1)326875700.46
Scas_692.28d14880650.96
YDR180W (SCC2)149392642.6
Kwal_56.2293667054623.6
Kwal_47.1883116130604.9
Scas_641.2649634615.0
Scas_596.1468483607.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02387g
         (192 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces c...   396   e-143
YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the UP...   215   2e-71
KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyce...   205   1e-67
Scas_644.12                                                           198   1e-64
Sklu_2419.5 YOL008W, Contig c2419 6103-6720                           189   2e-61
ACL012W [1037] [Homologous to ScYOL008W - SH] complement(336674....   181   6e-58
Kwal_56.22496                                                         175   8e-56
YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required f...    32   0.46 
Scas_692.28d                                                           30   0.96 
YDR180W (SCC2) [1023] chr4 (821288..825769) Cohesin, protein req...    29   2.6  
Kwal_56.22936                                                          28   3.6  
Kwal_47.18831                                                          28   4.9  
Scas_641.26                                                            28   5.0  
Scas_596.14                                                            28   7.3  

>CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces
           cerevisiae YOL008w, hypothetical start
          Length = 195

 Score =  396 bits (1018), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/192 (100%), Positives = 192/192 (100%)

Query: 1   MSYVGVRCLNRSLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKY 60
           MSYVGVRCLNRSLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKY
Sbjct: 1   MSYVGVRCLNRSLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKY 60

Query: 61  HEFIPYCEDSFVNERDDSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESL 120
           HEFIPYCEDSFVNERDDSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESL
Sbjct: 61  HEFIPYCEDSFVNERDDSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESL 120

Query: 121 SHNLFDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFAR 180
           SHNLFDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFAR
Sbjct: 121 SHNLFDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFAR 180

Query: 181 RVYHLKKAAVLE 192
           RVYHLKKAAVLE
Sbjct: 181 RVYHLKKAAVLE 192

>YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the
           UPF0083 uncharacterized protein family, has moderate
           similarity to uncharacterized C. albicans Orf6.6771p
           [624 bp, 207 aa]
          Length = 207

 Score =  215 bits (547), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 106/187 (56%), Positives = 135/187 (72%), Gaps = 8/187 (4%)

Query: 11  RSLLRPFG----TRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPY 66
           +++L+P G     R FF      H I+ Q+YVL K I   PS VY  VSEV++Y EFIPY
Sbjct: 16  KAMLKPIGRYPLKRNFFGLSGTNHTIREQRYVLRKAINAPPSTVYAAVSEVAQYKEFIPY 75

Query: 67  CEDSFVNERDD-SNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNLF 125
           C DSFV++R+   NKP +AGLRVGFKQYDE F+C+V CK        Y V AE++SHNLF
Sbjct: 76  CVDSFVDKRNPVDNKPLIAGLRVGFKQYDEEFICNVTCKDT---DHTYTVVAETISHNLF 132

Query: 126 DILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYHL 185
            +L S+WTI  HP R +A+ VELLL+FKFKSR+YNS+S IFAK+VTELVM+AFA+R YHL
Sbjct: 133 HLLISKWTIMPHPNRPNAAMVELLLRFKFKSRIYNSVSLIFAKTVTELVMNAFAKRAYHL 192

Query: 186 KKAAVLE 192
            + A+L+
Sbjct: 193 VRLAMLK 199

>KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyces
           cerevisiae YOL008w, start by similarity
          Length = 205

 Score =  205 bits (522), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 100/176 (56%), Positives = 126/176 (71%), Gaps = 2/176 (1%)

Query: 17  FGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCEDSFVNERD 76
            G R FF+          Q YVL + I+GTP++VY+VVSEVS Y +FIPYC +SFVN RD
Sbjct: 27  LGKRSFFNLTTEASSKDEQHYVLKRNIRGTPNEVYEVVSEVSNYKDFIPYCTESFVNLRD 86

Query: 77  DSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNLFDILSSQWTIST 136
           + N+P  AGLRVGF+QYDE+FVC V CK       V  V AESLSHNLF +L+S+W I  
Sbjct: 87  EKNRPVEAGLRVGFQQYDEKFVCKVQCKE--LSDLVKSVTAESLSHNLFHVLNSKWVIKA 144

Query: 137 HPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYHLKKAAVLE 192
           HP R D + VEL+L+++FKSRLY S++S+FAKSVTEL++ AF RRVY LKK   +E
Sbjct: 145 HPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKKGSIE 200

>Scas_644.12
          Length = 210

 Score =  198 bits (503), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 104/193 (53%), Positives = 135/193 (69%), Gaps = 7/193 (3%)

Query: 1   MSYVGVRC--LNRSLLRPFGT---RGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVS 55
           MS + V C  L +   +  GT   R  F       E+K Q+Y L K I   P+ VY+VVS
Sbjct: 1   MSIISVHCTLLKKVYGKSLGTVGRRNLFGLSLGSPEVKEQRYTLLKTINSPPTDVYNVVS 60

Query: 56  EVSKYHEFIPYCEDSFVNERDD-SNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYV 114
           EVS+Y++FIPYC +SFV +R+    KP +AGLRVGFKQYDE+FVC+V CK  ++ ++ + 
Sbjct: 61  EVSQYYKFIPYCTESFVEKRNLLDGKPTIAGLRVGFKQYDEKFVCEVSCKDLLADRD-FT 119

Query: 115 VRAESLSHNLFDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELV 174
           V A SLSHNLF +L S+WTI  HP R   + VEL L+FKFKSRLYN++SSIFAKSVT+LV
Sbjct: 120 VEANSLSHNLFHLLYSKWTIRPHPRRPQTTEVELSLRFKFKSRLYNAVSSIFAKSVTKLV 179

Query: 175 MDAFARRVYHLKK 187
           MDAF +RV+ LK+
Sbjct: 180 MDAFEKRVFELKR 192

>Sklu_2419.5 YOL008W, Contig c2419 6103-6720
          Length = 205

 Score =  189 bits (481), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 125/173 (72%), Gaps = 4/173 (2%)

Query: 20  RGFFDQLN-PFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCEDSFVNERD-D 77
           R  F   N  F+  + Q+YVL K I      VY+VVSEVS+Y EF+PYC +SFVN+R+ D
Sbjct: 28  RSLFGLSNHSFNNTREQRYVLCKTINAPTVNVYEVVSEVSQYKEFMPYCVESFVNKRNQD 87

Query: 78  SNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNLFDILSSQWTISTH 137
           + KP  AGL + FK Y E+FVC V+C SK+ G  +  V AESL+H LFD+L ++WTI+ H
Sbjct: 88  TGKPVEAGLMISFKHYVEKFVCKVECDSKLEG--IKTVVAESLTHTLFDLLYTKWTIAPH 145

Query: 138 PTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYHLKKAAV 190
           PTR + + VELLL+FKF S+LYNSISSIFAKSVT LVM AF +R++ LKK ++
Sbjct: 146 PTRPNVTEVELLLRFKFHSKLYNSISSIFAKSVTGLVMKAFEKRIFQLKKESM 198

>ACL012W [1037] [Homologous to ScYOL008W - SH]
           complement(336674..337288) [615 bp, 204 aa]
          Length = 204

 Score =  181 bits (458), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 91/161 (56%), Positives = 116/161 (72%), Gaps = 3/161 (1%)

Query: 31  EIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCEDSFVNER-DDSNKPKVAGLRVG 89
           + K Q+Y+L ++       VY  VSEVS Y  FIPYC DSFVN+R    N P  AGLRVG
Sbjct: 36  DTKEQRYILKRVFNAPLHYVYPAVSEVSLYKLFIPYCTDSFVNKRRPGDNMPTEAGLRVG 95

Query: 90  FKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNLFDILSSQWTISTHPTRKDASTVELL 149
           F+QYDE FVC VDC + + G +  VV AESL+H+LF+ L +QW +S HPTR DAS VEL+
Sbjct: 96  FQQYDETFVCRVDCTT-LPGNQRSVV-AESLAHHLFETLHTQWLLSPHPTRPDASVVELI 153

Query: 150 LKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYHLKKAAV 190
           L+FKFKS+LYNS+SSIF   VT++VM AF +RV+ L+K A+
Sbjct: 154 LRFKFKSQLYNSVSSIFGTRVTQVVMKAFEKRVFQLRKEAM 194

>Kwal_56.22496
          Length = 194

 Score =  175 bits (443), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 91/183 (49%), Positives = 124/183 (67%), Gaps = 8/183 (4%)

Query: 7   RCLNR-SLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIP 65
           RCLN  S  +    R F    +     K Q ++L + I    S VY VVS++S+YH+FIP
Sbjct: 9   RCLNAFSQSKIVQRRSFLTSTDS----KVQTFLLTRTINAPISDVYSVVSDISEYHKFIP 64

Query: 66  YCEDSFVNERDDS-NKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNL 124
           YC +SFVN++DD+  KP  AG+RVGF++YDE FVC ++C    S +  +VV A+SL+H+L
Sbjct: 65  YCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDR--HVVVADSLTHSL 122

Query: 125 FDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYH 184
           FD L ++WT+  HP+R +A+  EL LKFKFK  LYN+I+SIF KSVTE VM +F RR+Y 
Sbjct: 123 FDFLQTKWTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQ 182

Query: 185 LKK 187
           L K
Sbjct: 183 LAK 185

>YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required for
            the G2/M transition, has similarity to Rsp5p, a
            ubiquitin-protein ligase (E3 enzyme) [9807 bp, 3268 aa]
          Length = 3268

 Score = 31.6 bits (70), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 12/75 (16%)

Query: 9    LNRSLL-RPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEF---- 63
            +NRS   RP G  G  D +     I  +K     ++  +PSQ  DV+ E +++HEF    
Sbjct: 1524 INRSFTARPLG--GGDDAVRELTTILEEK---AHVVMRSPSQFIDVLCETARFHEFDDQG 1578

Query: 64   --IPYCEDSFVNERD 76
              + Y    F+ E+D
Sbjct: 1579 ALVDYSLKRFLGEKD 1593

>Scas_692.28d
          Length = 148

 Score = 29.6 bits (65), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 30/80 (37%), Gaps = 3/80 (3%)

Query: 30  HEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCEDSFVNERDDSNKPKVAGLRVG 89
           H+IK+      K+    PSQ Y  + E +  H    Y  D F     D +  +V  +  G
Sbjct: 41  HDIKSHMLDYLKMQMANPSQKYPDIIETAVLHN---YSNDDFTTLFLDIDGAEVTSMLTG 97

Query: 90  FKQYDERFVCDVDCKSKVSG 109
              Y  R +  ++      G
Sbjct: 98  VSWYSTRLLPAIEASLSARG 117

>YDR180W (SCC2) [1023] chr4 (821288..825769) Cohesin, protein
           required for mitotic sister chromatid cohesion [4482 bp,
           1493 aa]
          Length = 1493

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 50  VYDVVSEVSKYHEFIPYCEDSFVNERDDSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSG 109
           + D+VS  S Y EF     +++    DDS   +   LR+  K YDE      D  +KV  
Sbjct: 758 ILDLVSINSSYFEFYQQINNNY---NDDSIMVRKHVLRINEKMYDET----NDIVTKVYV 810

Query: 110 KEVYVVRAESLSHNLFD----ILSSQWTISTH 137
               +++ E    N+ D    IL ++W +  H
Sbjct: 811 IARILMKIEDEEDNIIDMARLILLNRWILKVH 842

>Kwal_56.22936
          Length = 670

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 9/54 (16%)

Query: 9  LNRSLLRPFGT---------RGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDV 53
          L R+LL PF            G+F+QL+  H IK   Y++P  +      ++ V
Sbjct: 17 LIRALLLPFVALAKILEHCFGGWFEQLDKKHRIKDDWYIIPYFVSAVVKYIWSV 70

>Kwal_47.18831
          Length = 161

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 47 PSQVYDVVSEVSKYHEFIPYCEDSFVNERD 76
          P  V   + E+ +YHEFIPY E   V  ++
Sbjct: 65 PDHVIKALEEL-EYHEFIPYLEQILVEHKE 93

>Scas_641.26
          Length = 496

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 137 HPTRKDASTVELLLKFKF-KSRLYNSISSIFAKS 169
           HP RKD   V LL  F F K  LYN + +I  ++
Sbjct: 407 HPDRKDGELVLLLQYFHFSKIALYNKLETILDEN 440

>Scas_596.14
          Length = 684

 Score = 27.7 bits (60), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 9/83 (10%)

Query: 10  NRSLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCED 69
           N   L+ FG        N    ++    + P II GTP ++ DV+ + S   +F  Y + 
Sbjct: 220 NNYGLKKFGCVSLVGGTNFGMAMRKMDQLRPNIIIGTPGRLIDVMDKYS--DKFFKYVDF 277

Query: 70  SFVNERDDSNKPKVAGLRVGFKQ 92
             ++E D         L +GFK+
Sbjct: 278 KILDEADRL-------LEIGFKE 293

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,068,583
Number of extensions: 250611
Number of successful extensions: 716
Number of sequences better than 10.0: 20
Number of HSP's gapped: 705
Number of HSP's successfully gapped: 20
Length of query: 192
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 96
Effective length of database: 13,272,781
Effective search space: 1274186976
Effective search space used: 1274186976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)