Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E02365g25725311291e-158
YOL009C (MDM12)2712656495e-85
Scas_644.112722556081e-78
Sklu_2419.42992535874e-75
Kwal_56.224972802565761e-73
ACL013C2632535696e-73
KLLA0C06028g3052535292e-66
Scas_638.2445559880.003
KLLA0F15796g43455681.1
Kwal_33.1516944255671.5
AAL166C44455652.7
Sklu_2275.545455626.2
YLL006W (MMM1)42656618.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02365g
         (253 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02365g complement(226360..227133) similar to sp|Q92328 Sac...   439   e-158
YOL009C (MDM12) [4807] chr15 complement(309324..310139) Mitochon...   254   5e-85
Scas_644.11                                                           238   1e-78
Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement        230   4e-75
Kwal_56.22497                                                         226   1e-73
ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH] (335717..3...   223   6e-73
KLLA0C06028g complement(532044..532961) some similarities with s...   208   2e-66
Scas_638.24                                                            39   0.003
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    31   1.1  
Kwal_33.15169                                                          30   1.5  
AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315...    30   2.7  
Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement         28   6.2  
YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential f...    28   8.2  

>CAGL0E02365g complement(226360..227133) similar to sp|Q92328
           Saccharomyces cerevisiae YOL009c MDM12, start by
           similarity
          Length = 257

 Score =  439 bits (1129), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/253 (87%), Positives = 222/253 (87%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS
Sbjct: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120
           SPLQDFYDAV             MHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM
Sbjct: 61  SPLQDFYDAVNEEYEEDNETSSEMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120

Query: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXXXXX 180
           SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISM            
Sbjct: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMLCDVSDPVLDDV 180

Query: 181 XXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240
                 NGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF
Sbjct: 181 DCVLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240

Query: 241 LRKELAWPSWVNL 253
           LRKELAWPSWVNL
Sbjct: 241 LRKELAWPSWVNL 253

>YOL009C (MDM12) [4807] chr15 complement(309324..310139)
           Mitochondrial inheritance protein which may function in
           a complex with Mdm10p at the mitochondrial surface [816
           bp, 271 aa]
          Length = 271

 Score =  254 bits (649), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 129/265 (48%), Positives = 171/265 (64%), Gaps = 13/265 (4%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSF+INW  L SD+ L   IR+ LN Y Q  +LPSYV  + ++DF  GK+ P ITL+EI+
Sbjct: 1   MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEIT 60

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVG------------ESGEEAVVEKKETDT 108
            PL +FYD++              +  D +++             +  E  VV     D 
Sbjct: 61  DPLDEFYDSIREEADQETEENND-NKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDI 119

Query: 109 QFLIEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISM 168
           QFL+E EYKGD+ +T+ A+LVLNYPVE+FMTLP+K+SIS+IGLHSLC+V+ L+KQ+F+S 
Sbjct: 120 QFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSF 179

Query: 169 XXXXXXXXXXXXXXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQ 228
                              GP+L A KPLERISI+RSMKIETEIG++++  GS LRSVG+
Sbjct: 180 LCDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGE 239

Query: 229 LEEFIVQKLKDFLRKELAWPSWVNL 253
           LE+F+    KDFLRKELAWPSW+NL
Sbjct: 240 LEQFLFTIFKDFLRKELAWPSWINL 264

>Scas_644.11
          Length = 272

 Score =  238 bits (608), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 165/255 (64%), Gaps = 21/255 (8%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSF INW ++ SD+ ++  +++ L+ Y Q + LPS+V  +++ DF FG IAP I L+EI+
Sbjct: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120
            PL DFY++V                         G+E       +DTQFLIE EYKGD+
Sbjct: 61  DPLPDFYESVNEGLV-------------------EGDEGWTIPSPSDTQFLIEVEYKGDL 101

Query: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXXXXX 180
            +T++ ELVLNYP + F+ LP+K++++NIG HSLCLV+YLAKQ+F+S+            
Sbjct: 102 FVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQ 161

Query: 181 XXX--XXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLK 238
                   NG  +   KP ERISIIRSM I+TEIG +++ +GSTL++VG+LE+F+++K K
Sbjct: 162 NSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFK 221

Query: 239 DFLRKELAWPSWVNL 253
           D LRKE+AWPSW+NL
Sbjct: 222 DLLRKEIAWPSWINL 236

>Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement
          Length = 299

 Score =  230 bits (587), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 163/253 (64%), Gaps = 6/253 (2%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSFEINW+KL  D+ +  +I++  N + + + LPSYV  +++ +F  G I P+ITL++I 
Sbjct: 19  MSFEINWDKLQEDTRINQSIKDFFNDHLRSISLPSYVNNVQVTNFSLGNIPPHITLKQID 78

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120
            PL++FY  +                 D Q         V++ K+ D QFL+E +YKGDM
Sbjct: 79  DPLEEFYGYISKESNEKIESTSDEIEHDPQC------PIVMDGKQNDIQFLVEIDYKGDM 132

Query: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXXXXX 180
            + + AELVLNYP   FMTLP+K+SIS+IG+HSLCL++YL+KQ+FIS             
Sbjct: 133 LIEVGAELVLNYPSPTFMTLPVKLSISDIGMHSLCLIAYLSKQLFISFLCDVSDPILDNS 192

Query: 181 XXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240
                 NGP  ++ + LERIS+IRS+KI++EIG+    +GSTLRSVG+LE+F+V+  ++ 
Sbjct: 193 ESILDTNGPNFMSKRSLERISLIRSIKIQSEIGEYKDGEGSTLRSVGKLEQFLVEIFRNA 252

Query: 241 LRKELAWPSWVNL 253
           LRKE AWPSW+NL
Sbjct: 253 LRKEAAWPSWINL 265

>Kwal_56.22497
          Length = 280

 Score =  226 bits (576), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 165/256 (64%), Gaps = 4/256 (1%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSFEINWE L  D  + ++I++ LN + Q + LPSYV ++ + DF  G   P ITLREIS
Sbjct: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60

Query: 61  SPLQDFYDAVXXX--XXXXXXXXXXMHGRDGQNVGESGEEAVVEK-KETDTQFLIEFEYK 117
           +PL++FY+ +               + G D  + GE+ +    EK  ++D QFL+E +YK
Sbjct: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFH-GENDDSGKDEKDSDSDLQFLVEIDYK 119

Query: 118 GDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXX 177
           GDM +T++AEL LNYP   FMTLP+K++IS++G+H+LCLV+YL+KQ+FIS          
Sbjct: 120 GDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPIL 179

Query: 178 XXXXXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKL 237
                         L N+ LERIS+IRS+KI++EIG++   +GS LRSVG+LE+F+++  
Sbjct: 180 DAQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVF 239

Query: 238 KDFLRKELAWPSWVNL 253
           +  L+ E AWPSW+NL
Sbjct: 240 RTILKTEAAWPSWINL 255

>ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH]
           (335717..336511) [795 bp, 264 aa]
          Length = 263

 Score =  223 bits (569), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 114/253 (45%), Positives = 156/253 (61%), Gaps = 25/253 (9%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MSF+INW K++ DS +    R  LN + + L+LPSYV  I++ DF  G I P ITL++I 
Sbjct: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120
           +PL DFY+A+                 +G ++G             D QFL+E +YKGDM
Sbjct: 61  NPLDDFYEALRL---------------EGASIG----------GRDDVQFLMEVDYKGDM 95

Query: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXXXXX 180
            + L+AELVLNYP   FM LP+K++IS+I +HSLCLV+YL +Q+FIS             
Sbjct: 96  LIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNV 155

Query: 181 XXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240
                 NGP  L +K +ERIS+IRS+KI+TEIG +   +G+ LRSVG+LE+F+    K+ 
Sbjct: 156 ESPLDSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNL 215

Query: 241 LRKELAWPSWVNL 253
           LRKE AWPSW+NL
Sbjct: 216 LRKEAAWPSWINL 228

>KLLA0C06028g complement(532044..532961) some similarities with
           sp|Q92328 Saccharomyces cerevisiae YOL009c MDM12
           involved in mitochondrial inheritance singleton,
           hypothetical start
          Length = 305

 Score =  208 bits (529), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 153/253 (60%), Gaps = 20/253 (7%)

Query: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60
           MS EI+W+ +  D  +   +++ LN   QE ELPSYV  +++ +F  G + PN+ L+++ 
Sbjct: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60

Query: 61  SPLQDFYDAVXXXXXXXXXXXXXMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120
            PL +FY  +                      G+  +EA  + K TD Q L+E +YKGDM
Sbjct: 61  DPLDEFYSYLLQE-------------------GDISKEAA-KDKNTDVQLLVELDYKGDM 100

Query: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMXXXXXXXXXXXX 180
           S+ L+A+LVLNYP  +FM LP+K+ IS+IG+H LCL++YL KQ+FIS             
Sbjct: 101 SIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEND 160

Query: 181 XXXXXXNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240
                 +GP  +  + LERIS+IR++KI TE+G   + +GS LRSVG+LEEF+V   ++ 
Sbjct: 161 KLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNL 220

Query: 241 LRKELAWPSWVNL 253
           +RKE AWPSW++L
Sbjct: 221 IRKEAAWPSWIDL 233

>Scas_638.24
          Length = 455

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 109 QFLIEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFIS 167
           Q  I+ +    ++  +  EL+LNYP   F TLP+K++++ +       VS+   + FIS
Sbjct: 289 QAKIDIDMNDRLAFGVETELMLNYPRAAFATLPIKLNVAIVRFQGCLNVSFTTAEDFIS 347

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 29/55 (52%)

Query: 112 IEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFI 166
           I+ +    ++L +  +L+LNYP      LP+K+++S +   +   VS    + F+
Sbjct: 278 IDIDLSDRLALGIETKLLLNYPKPFSAALPIKLTVSIVRFQACLTVSLTTDEQFV 332

>Kwal_33.15169
          Length = 442

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 30/55 (54%)

Query: 112 IEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFI 166
           I+ +    ++L +  +L++NYP      LP+++++S +   +   VS  A + F+
Sbjct: 289 IDIDLSDRLALGIETKLLINYPKPFTAALPVQLTVSVVRFQACLTVSLTAAEEFV 343

>AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315)
           [1335 bp, 444 aa]
          Length = 444

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 29/55 (52%)

Query: 112 IEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFI 166
           I+ +    ++L +   L++NYP     +LP+K+++S +   +   VS    + F+
Sbjct: 288 IDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVSLTTAEEFV 342

>Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement
          Length = 454

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 12/55 (21%), Positives = 29/55 (52%)

Query: 112 IEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFI 166
           I+ +    ++L +  +L++NYP      LP+++++S +   +   VS    + F+
Sbjct: 297 IDIDLSDRLALGIETKLLMNYPKPFTAALPVQLTVSIVRFQACLTVSLTTDEEFV 351

>YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential for
           establishment and maintenance of mitochondrial shape and
           structure, involved in coupling mitochondria to the
           actin cytoskeleton, required for maintenance of
           mitochondrial genome [1281 bp, 426 aa]
          Length = 426

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 27/56 (48%)

Query: 112 IEFEYKGDMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFIS 167
           I+ +    ++L +  +L+LNYP      LP+ + +S +   +   VS    + F S
Sbjct: 278 IDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFAS 333

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,006,900
Number of extensions: 252850
Number of successful extensions: 635
Number of sequences better than 10.0: 14
Number of HSP's gapped: 623
Number of HSP's successfully gapped: 14
Length of query: 253
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 154
Effective length of database: 13,168,927
Effective search space: 2028014758
Effective search space used: 2028014758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)