Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E02321g70467134750.0
YOL011W (PLB3)68659422150.0
Scas_644.870460721160.0
Scas_611.164657919890.0
CAGL0J11770g65958119680.0
Kwal_56.2251064157019460.0
YMR008C (PLB1)66459119430.0
Sklu_1900.165857819110.0
Scas_685.367757518080.0
YMR006C (PLB2)70658418050.0
KLLA0C05940g64057217580.0
CAGL0J11748g69557616240.0
Scas_92.0d2362137262e-91
Kwal_0.1735074205512e-62
AAL027W5924155554e-62
YNL012W (SPO1)6316575574e-62
Sklu_2442.195844355282e-58
KLLA0F12232g6804145032e-54
CAGL0H03575g5145564531e-48
Scas_695.105533804251e-44
KLLA0F14553g37759730.95
YDR273W (DON1)36534702.3
Sklu_2411.5519123675.2
Sklu_2418.427343665.5
AGL187W167360676.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02321g
         (693 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...  1343   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   857   0.0  
Scas_644.8                                                            819   0.0  
Scas_611.1                                                            770   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   762   0.0  
Kwal_56.22510                                                         754   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   753   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        740   0.0  
Scas_685.3                                                            701   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   699   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   681   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   630   0.0  
Scas_92.0d                                                            284   2e-91
Kwal_0.173                                                            216   2e-62
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   218   4e-62
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   219   4e-62
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     207   2e-58
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   198   2e-54
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   179   1e-48
Scas_695.10                                                           168   1e-44
KLLA0F14553g 1350504..1351637 similar to sp|P53294 Saccharomyces...    33   0.95 
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    32   2.3  
Sklu_2411.5 YKL047W, Contig c2411 10852-12411                          30   5.2  
Sklu_2418.4 YJR111C, Contig c2418 8325-9146 reverse complement         30   5.5  
AGL187W [4125] [Homologous to ScYDR141C (DOP1) - SH] complement(...    30   6.0  

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/671 (96%), Positives = 647/671 (96%)

Query: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ 82
           ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ
Sbjct: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ 82

Query: 83  LFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTG 142
           LFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTG
Sbjct: 83  LFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTG 142

Query: 143 CSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIK 202
           CSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIK
Sbjct: 143 CSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIK 202

Query: 203 TARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQA 262
           TARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQA
Sbjct: 203 TARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQA 262

Query: 263 GDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPV 322
           GDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPV
Sbjct: 263 GDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPV 322

Query: 323 AHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVA 382
           AHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVA
Sbjct: 323 AHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVA 382

Query: 383 VYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNS 442
           VYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNS
Sbjct: 383 VYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNS 442

Query: 443 ADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTS 502
           ADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTS
Sbjct: 443 ADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTS 502

Query: 503 LKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCI 562
           LKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCI
Sbjct: 503 LKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCI 562

Query: 563 ACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQDVHHSFINPXXXXXXXX 622
           ACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQDVHHSFINP        
Sbjct: 563 ACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQDVHHSFINPEEDKDGDG 622

Query: 623 XXXXXXXXXXXXXXXXYHFFHYSNVDEIHHAATYTGKLLPTGAIDKGSNKPLINLSSKLG 682
                           YHFFHYSNVDEIHHAATYTGKLLPTGAIDKGSNKPLINLSSKLG
Sbjct: 623 IDDYSDEDFTDDDVDDYHFFHYSNVDEIHHAATYTGKLLPTGAIDKGSNKPLINLSSKLG 682

Query: 683 IPATSIAYAIV 693
           IPATSIAYAIV
Sbjct: 683 IPATSIAYAIV 693

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/594 (66%), Positives = 490/594 (82%), Gaps = 19/594 (3%)

Query: 24  DQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQL 83
           D Y P    CP DDINLVREA+ +SQNE+ WL++R+  T  AL +FL RAT++  + +++
Sbjct: 31  DSYVPGTVSCP-DDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATANFSDSSEV 89

Query: 84  FHRIFDAGM---VPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYM 140
             ++F+ G    +P+I +AVSGGGYRSMLTGAG+L+A DNRT GA +HGLGG+LQSTTY+
Sbjct: 90  LSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYL 149

Query: 141 TGCSGGNWLVASLSWNNWTSVQDILD-MNYDRKTARKQGKITKDPIWDLSDSIVSPGGLN 199
           +G SGGNWLV +L+ NNWTSVQDIL+ M  D            D IWDLSDSIV+PGG+N
Sbjct: 150 SGASGGNWLVGTLALNNWTSVQDILNNMQND------------DSIWDLSDSIVTPGGIN 197

Query: 200 IIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPI 259
           I KTA+RWDHI+NAV++KQ A +NTSLAD+WGRAL+Y FFP+L RGGI  TWSS+RD P+
Sbjct: 198 IFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPV 257

Query: 260 FQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNG 319
           FQ  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWDPSLN+F +VKYLGTNV+NG
Sbjct: 258 FQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNG 317

Query: 320 KPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFN 379
            P+     KC  GFDN  FIMGTSS LFNQFLLRINSTHLP+F+T+ A + LK  + +FN
Sbjct: 318 VPLER--GKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFN 375

Query: 380 DVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAI 439
           D+AVY+PNPFKDT+++  +++TSIVDS+ L+LVDGGEDDENVP++PL+Q++RD+DIIFA+
Sbjct: 376 DIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAV 435

Query: 440 DNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATN 499
           DNSAD +L WPDGSSLVHTYERQFV QGQ ++FP++PDTNTF+NLGLNK+PTFFGC+A N
Sbjct: 436 DNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANN 495

Query: 500 MTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFI 559
           +T L+YIPPLVVY PN+EYSFNSNQSAFKLSYS  Q  +MI NGFEIATRNNFTDDPEF+
Sbjct: 496 LTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFM 555

Query: 560 GCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQDVHHSFIN 613
           GC+ CAI++RKQ+AL++ LP ECE C   YCW+GT+D TPL ++++DVHHSFIN
Sbjct: 556 GCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVEKDVHHSFIN 609

>Scas_644.8
          Length = 704

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/607 (64%), Positives = 482/607 (79%), Gaps = 29/607 (4%)

Query: 23  ADQYAPKLAYCP-------SDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATS 75
           ++ YAP    C        ++D +L+REA  +S NE+ WLQ+R   T+E L  FL R+ +
Sbjct: 26  SNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLNRSLT 85

Query: 76  SSQ-----NFTQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDH 128
           S       +   L   +   D+   P+IGIAVSGGGYRSMLTGAGIL+A DNRTRGA  H
Sbjct: 86  SLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHH 145

Query: 129 GLGGILQSTTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDL 188
           GLGG+LQSTTY++G SGGNWLV +L++NNWTSVQ I+D N++            D IWDL
Sbjct: 146 GLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIID-NFNES----------DSIWDL 194

Query: 189 SDSIVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGID 248
           S+SIVSPGG NI K+ARRWDHI++A++ KQ+AGF+TSLADVWGRALSYKFFP+L RGG+ 
Sbjct: 195 SESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVA 254

Query: 249 YTWSSLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTD 308
           YTWSSLRDSP+F  G MP PI+VADGRYPGS  + LNATVFEFNPFEMGSWDPSLN FTD
Sbjct: 255 YTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTD 314

Query: 309 VKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINST--HLPNFVTKW 366
           VK+LGTNV+ GKP+   +++C++GFDNTAFIMGTSS LFNQFLLRINST  HLP F+TK 
Sbjct: 315 VKFLGTNVSAGKPI--DSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKL 372

Query: 367 ATNLLKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPL 426
           AT+ LK  + +FNDVA Y+PNPFKD  ++  N++ SIV+S+ LYLVDGGEDDEN+PL+PL
Sbjct: 373 ATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPL 432

Query: 427 LQRDRDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGL 486
           +QR+RDLDI+FAIDNS D KL WPDGSSLVHT+ERQFV QGQ +AFP++P T+TF+NLGL
Sbjct: 433 IQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGL 492

Query: 487 NKRPTFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEI 546
           N++PTFFGC+A N+T L+YIPPLV+Y PN +YSF SNQSAFKLSY+ +Q   MISNGFEI
Sbjct: 493 NQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEI 552

Query: 547 ATRNNFTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQD 606
           ATRNNFTDDP+F+GCI CAI++RKQ++L+L LP  C  C   YCW+GT+D TPL + K+D
Sbjct: 553 ATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPDNKKD 612

Query: 607 VHHSFIN 613
           +H+SFIN
Sbjct: 613 IHNSFIN 619

>Scas_611.1
          Length = 646

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/579 (61%), Positives = 454/579 (78%), Gaps = 17/579 (2%)

Query: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ 82
           ++ Y P    C  D+INL+REA+ LS +E  WL +RD  T EAL +FL+R+TS+  + T 
Sbjct: 24  SNSYVPANVTC-DDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSD-TS 81

Query: 83  LFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYM 140
           L  ++F  ++   PRIG+A SGGGYR+ML+GAG+++A DNRT GA +HGLGG+LQ  TY+
Sbjct: 82  LISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYL 141

Query: 141 TGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNI 200
            G SGGNWL ++L WNNWTSVQ IL+                D IWD+S SI++PGG NI
Sbjct: 142 AGLSGGNWLTSTLGWNNWTSVQAILN-----------NMTNDDSIWDISHSIINPGGWNI 190

Query: 201 IKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIF 260
           ++T  RWDHI++AV+AKQ+AGFN SLADVWGRALSY FFP+L RGG  YTWS+LRD+ +F
Sbjct: 191 LETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVF 250

Query: 261 QAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGK 320
           +  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWDP+LN FTDVKYLGTNV+NGK
Sbjct: 251 KNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGK 310

Query: 321 PVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFND 380
           P+  T  KCI GFDNT FI GTSS LFNQFLL INST LP+F+TK A++ L   + ++ND
Sbjct: 311 PI--TEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYND 368

Query: 381 VAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAID 440
           +A+Y+PNPF+D  ++  N+S SIV S+ L+LVDGGED++N+PL+PLLQ++R+LD+IFA+D
Sbjct: 369 IAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALD 428

Query: 441 NSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNM 500
           NSAD    WPDG+SLV+TYERQF +QG  +AFP++PD NTF+NLGLNKRPTFFGC+A N+
Sbjct: 429 NSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNL 488

Query: 501 TSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIG 560
           T L+YIPPLVVY PN+ +SFN NQS FK+SYS  +  +MI NGFE ATR NFTDD +F+G
Sbjct: 489 TDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLG 548

Query: 561 CIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599
           CI CAIM+RKQ++++  LP+EC +C   YCW+GT+D+TP
Sbjct: 549 CIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTP 587

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/581 (60%), Positives = 450/581 (77%), Gaps = 19/581 (3%)

Query: 24  DQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATS---SSQNF 80
           + Y P    CP +DINL+R A+GLSQ+E  WL++RDV T+EAL +FL+R TS   S+ + 
Sbjct: 27  NSYVPANVTCP-NDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVTSNFTSNSSA 85

Query: 81  TQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTT 138
           + L  ++F  ++  +P+IGIA SGGGYR+ML+GAG++SA DNRT GA +HGLGG+LQ+ T
Sbjct: 86  SNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAAT 145

Query: 139 YMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGL 198
           Y+ G SGGNWL  +LSWNNWTSVQDI+D + D  +A          IWD+S SIVSPGG+
Sbjct: 146 YLAGLSGGNWLTTTLSWNNWTSVQDIVD-SQDNDSA----------IWDISHSIVSPGGI 194

Query: 199 NIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSP 258
           NI KT  RWDHI++AV+ KQ+AGFN SLADVWGRALSY+FFPTL RGG+ Y WS LR+S 
Sbjct: 195 NIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESD 254

Query: 259 IFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTN 318
           +F+  +MP+PI+VADGRYPG+  I LN+TVFE++PFE+GSWDPSL+AFTDV+YLGT V++
Sbjct: 255 VFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSD 314

Query: 319 GKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEF 378
           GKP      KCI GFDN  F+MGTSS LFNQFLLRIN T +P F+   AT+ LK  + ++
Sbjct: 315 GKPAEE--GKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHFLKDLSEDY 372

Query: 379 NDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFA 438
           +D+AVY PNPF+D  YV  N S S+ +SE+L+LVDGGED +NVPL+PL+Q++RDLDI+FA
Sbjct: 373 DDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFA 432

Query: 439 IDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNAT 498
           +DNSAD +  WPDG+SL+HTY RQF  QGQ + FP +P T+TF+NLGLNK+PTFFGC+A 
Sbjct: 433 LDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDAR 492

Query: 499 NMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEF 558
           NMT L+YIPPL+VY PNS +S+N N S FKLSYS  +   +I NGFE AT NN T D  F
Sbjct: 493 NMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNF 552

Query: 559 IGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599
            GCI CAIM+RKQ+AL+L LP ECE C   YCW+GT+D+TP
Sbjct: 553 AGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTP 593

>Kwal_56.22510
          Length = 641

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/570 (60%), Positives = 442/570 (77%), Gaps = 15/570 (2%)

Query: 24  DQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQL 83
           D Y P    C +DDINLVR+AS LS NET+WL++RD  TKEAL  FL RATS+  N + L
Sbjct: 22  DSYVPGNVSC-ADDINLVRKASSLSPNETEWLKKRDAYTKEALRTFLDRATSNFSN-SSL 79

Query: 84  FHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGC 143
              ++ +G +PRI +A SGGGYR+ML+GAG+LSA DNRT GA +HGLGG+LQSTTY+ G 
Sbjct: 80  VDNVWKSGKIPRIAVACSGGGYRAMLSGAGMLSAMDNRTNGATEHGLGGLLQSTTYLAGL 139

Query: 144 SGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIKT 203
           SGGNWLV SL+WNNWTSVQ I+D            + T D +WD+S+SI++PGG+NI+ +
Sbjct: 140 SGGNWLVGSLAWNNWTSVQHIIDT-----------RGTDDELWDISNSILNPGGVNILTS 188

Query: 204 ARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAG 263
           A RWD I++AV+AK +AGFNTSLADVWGRALSY FFPTL +GG+ YTWS+LRD+ +F+ G
Sbjct: 189 ANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLRDADVFKNG 248

Query: 264 DMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVA 323
           +MP PI+VADGRYPG+  I LN+T+FEFNPFEMGSWDPSLNAFTDVKYLGT V NG PV 
Sbjct: 249 EMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTEVKNGTPV- 307

Query: 324 HTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVAV 383
            T  +C+ GFDNT F+MGTSS LFNQFLL++N+T + +F+  +  + L+  + + ND+A+
Sbjct: 308 -TQGQCVAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLSEDSNDIAI 366

Query: 384 YNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSA 443
           YNPNPF+DT YV +N++  IV+SE+L+LVDGGED EN+PL+PL+Q+DRD+D+IFA+DNSA
Sbjct: 367 YNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDVIFALDNSA 426

Query: 444 DNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSL 503
           D    WP G SL+HTYERQF  QG+ IAFP++PD +TF+N GLN +P FFGC+ATN + L
Sbjct: 427 DTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGCDATNTSDL 486

Query: 504 KYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIA 563
            Y PPL+VY PN+  S+NSN S FK+SYS  Q   M  NGFE  TRNN TDD  F+GC+A
Sbjct: 487 AYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDDSNFMGCVA 546

Query: 564 CAIMKRKQEALDLELPSECERCLARYCWDG 593
           CA+++RKQE+ ++  P EC +C   YCWDG
Sbjct: 547 CAVLRRKQESQNMTFPEECTKCFQNYCWDG 576

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/591 (58%), Positives = 456/591 (77%), Gaps = 21/591 (3%)

Query: 23  ADQYAPKLAYCPS-----DDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSS 77
            + ++P  +Y P+     DDINLVREASGLS NET+WL++RD  TKEALH+FL RATS+ 
Sbjct: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79

Query: 78  QNFTQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQ 135
            + T L   +F  ++  +P+I +A SGGGYR+ML+GAG+L+A DNRT GA +HGLGG+LQ
Sbjct: 80  SD-TSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQ 138

Query: 136 STTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSP 195
             TY+ G SGGNWL ++L+WNNWTSVQ I+D   +  +           IWD+S SI++P
Sbjct: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNS-----------IWDISHSILTP 187

Query: 196 GGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLR 255
            G+NI KT  RWD I++ V+ K++AGFN SLADVWGRAL+Y F+P+L RGG+ YTWS+LR
Sbjct: 188 DGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLR 247

Query: 256 DSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTN 315
           ++ +F+ G+MP PITVADGRYPG+  I LNAT+FEFNPFEMGSWDP+LNAFTDVKYLGTN
Sbjct: 248 EADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTN 307

Query: 316 VTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWA 375
           VTNGKPV     +CI GFDNT FI  TSS LFNQFLLR+NST LP+F+   AT+ L+  +
Sbjct: 308 VTNGKPV--NKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLS 365

Query: 376 HEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDI 435
              +D+A+Y PNPFK+  ++ +N ++SI++SE+L+LVDGGED++N+PL+PLLQ++R+LD+
Sbjct: 366 DNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDV 425

Query: 436 IFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGC 495
           IFA+DNSAD    WPDG+SLV+TY+RQF  QG  ++FP++PD NTF+NLGLNK+PTFFGC
Sbjct: 426 IFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGC 485

Query: 496 NATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDD 555
           +A N+T L+YIPPL+VY PNS +SFN NQS FK+SYS  +   MI NGFE AT  NFTDD
Sbjct: 486 DARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDD 545

Query: 556 PEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQD 606
            +F+GC+ CAI++RKQ+ L+  LPSEC +C   YCW+GT+D   +  +  D
Sbjct: 546 SDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGND 596

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/578 (60%), Positives = 438/578 (75%), Gaps = 27/578 (4%)

Query: 24  DQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFT-- 81
           + Y P    C  DDINLVREA GLS +E++WL++R+V T  AL +FL RAT   +NFT  
Sbjct: 21  NSYTPGNVTC-DDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRAT---ENFTDN 76

Query: 82  QLFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMT 141
            +   +F++   PRIG+A SGGGYR+ML+GAG+L+A DNRTRG+++HGLGG+LQSTTY+ 
Sbjct: 77  SIVKTLFNSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGGLLQSTTYLA 136

Query: 142 GCSGGNWLVASLSWNNWTSVQDILD-MNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNI 200
           G SGGNWLV +L+WNNWTSVQ ILD M  D            D IWD+S+SI+SPGG N+
Sbjct: 137 GLSGGNWLVGTLAWNNWTSVQHILDTMGQD------------DDIWDISNSIISPGGTNV 184

Query: 201 IKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIF 260
           ++T  RWD I++AV AKQ+AGFN SL DVWGRALSY FFPTL  GG  YTWS+LR++ +F
Sbjct: 185 LETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVF 244

Query: 261 QAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGK 320
           +  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWD SL AFT+VKYLGT V NG 
Sbjct: 245 KNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGT 304

Query: 321 PVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINST------HLPNFVTKWATNLLKSW 374
           P   T  +CI GFDNT FIMGTSS+LFNQF L+ NST       LP+++ K+A   L   
Sbjct: 305 P--ETKGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGL 362

Query: 375 AHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLD 434
           + +++D+A+Y PNPFK T YV EN++ SIV+SE LYLVDGGED +N+PLIPLLQ +R+LD
Sbjct: 363 SKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELD 422

Query: 435 IIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFG 494
           +IFA+DNSAD    WP+G SL  TYERQF  QG  IAFP++PD +TF+ LGLNKRPTFFG
Sbjct: 423 VIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFG 482

Query: 495 CNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTD 554
           C+ATN+T L YIPPLVVY PN++ SFNSNQS FKLSYS +    MI NGFE  TRNN TD
Sbjct: 483 CDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTD 542

Query: 555 DPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWD 592
           D +F+ C+ACA+++RKQ++++  LP ECE+C   YCW+
Sbjct: 543 DSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580

>Scas_685.3
          Length = 677

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/575 (57%), Positives = 425/575 (73%), Gaps = 19/575 (3%)

Query: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSS-SQNFT 81
           ++ YAP    C +DD+NL+REAS LS++E  WL++R+  T E+L  FL R+T + S + +
Sbjct: 23  SNGYAPANVTC-ADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKNFSDSSS 81

Query: 82  QLFHRIF-DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYM 140
            L +++F D   VP+IGIA SGGGYR+ML GAG+L+A DNRT GA DHGLGG+LQS+TY+
Sbjct: 82  SLLNKLFQDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLLQSSTYL 141

Query: 141 TGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNI 200
            G SGGNWL  +L+WNNWTSVQDI+D               ++ IWD+ +S+ S   ++ 
Sbjct: 142 AGLSGGNWLTTTLAWNNWTSVQDIID-----------NITVENSIWDIDNSLFS---ISE 187

Query: 201 IKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIF 260
           +  +  W  I N VKAKQ+AGFN +LAD+WGRAL+Y FFP L  GG  YTWS+LRDS +F
Sbjct: 188 MANSSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVF 247

Query: 261 QAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGK 320
           +  +MP PITVADGRYPG+  I+LNATVFEFNPFEMGSWDP+LN+FTDVKYLGTNV+NGK
Sbjct: 248 KNAEMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGK 307

Query: 321 PVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFND 380
           P+   A +C+ GFDN  F++GTS+ LFN   L   S+ LP  ++    N   S A  +ND
Sbjct: 308 PI--DAGQCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTYND 365

Query: 381 VAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAID 440
           +A+Y+PNPF+D   V  NFS +IVDS+ L+LVDGGED E +PL+PLLQ  R LD++FA+D
Sbjct: 366 IAIYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALD 425

Query: 441 NSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNM 500
            ++D    WPDGSSLV TY+RQF  QG+ ++FP++PDT TFI  GLN +PTFFGC+A N+
Sbjct: 426 FNSDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNL 485

Query: 501 TSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIG 560
           T L+YIPPL+VY PNS YSFNSN S  +LSY+  Q   MI NGFE ATR NFTDDPEF+G
Sbjct: 486 TDLEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLG 545

Query: 561 CIACAIMKRKQEALDLELPSECERCLARYCWDGTV 595
           CI CAIM+RKQ++L+  LPSECE+C   YCW+GT+
Sbjct: 546 CIGCAIMRRKQQSLNETLPSECEQCFTNYCWNGTL 580

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/584 (55%), Positives = 430/584 (73%), Gaps = 16/584 (2%)

Query: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ 82
            D YAP +  CPSDD +LVR ASGLS  ET WL++RD  TKEALH+FL RATS+  + T 
Sbjct: 27  GDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRATSNFSD-TS 85

Query: 83  LFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYM 140
           L   +F  ++  VP+IGIA SGGGYR+ML GAG+++A DNRT GA +HGLGG+LQS+TY+
Sbjct: 86  LLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHGLGGLLQSSTYL 145

Query: 141 TGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNI 200
           +G SGGNWL  +L+WNNWTSVQ+I+D   +            D IW+++ SIV+PGG N+
Sbjct: 146 SGLSGGNWLTGTLAWNNWTSVQEIVDHMSE-----------SDSIWNITKSIVNPGGSNL 194

Query: 201 IKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIF 260
             T  RW+ I   V+AK +AGFN SL+D+W RALSY FFP+L   G   TWSSLRD  +F
Sbjct: 195 TYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVF 254

Query: 261 QAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGK 320
           + G+MPLPITVADGRYPG+  I LNAT+FEF PFEMGSWDPSLNAFTDVKYLGTNVTNGK
Sbjct: 255 KNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGK 314

Query: 321 PVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFND 380
           PV     +C+ G+DN  F++ TS++LFN+F L  +++     +  +A   + + + + +D
Sbjct: 315 PV--NKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDD 372

Query: 381 VAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAID 440
           +A+Y  NPFKDT +V  N+++SIVD++ L+LVDGGED +N+PL+PL++++RDLD++FA+D
Sbjct: 373 IAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALD 432

Query: 441 NSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNM 500
            S +    WP G  + +TYERQ+  QG+ +AFP++PD NTF+NLGL  +PTFFGC+A N+
Sbjct: 433 ISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNL 492

Query: 501 TSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIG 560
           T L+YIPPLVVY PN+++SFN NQS  K++Y+  +   MI NGFE AT  NFTDD  F+G
Sbjct: 493 TDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLG 552

Query: 561 CIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELK 604
           CI CAI++RKQE+L+  LP EC +C A YCW+GT+  +   EL 
Sbjct: 553 CIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPELS 596

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/572 (55%), Positives = 418/572 (73%), Gaps = 15/572 (2%)

Query: 26  YAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQLFH 85
           YAP +  C  ++INLVR+A  +S +E  WL+ R   T  AL +FLQR      N T +  
Sbjct: 32  YAPGVVDC-DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSIID 90

Query: 86  RIFDA-GMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCS 144
           ++       P++ IA SGGGYR+ML+GAG++SA DNRT GA DHGLGG+LQS+TY+ G S
Sbjct: 91  KLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLS 150

Query: 145 GGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIKTA 204
           GGNWLV +L++NNWTSVQ I++   D  +           IWD+S+SIV+PGG+NI  + 
Sbjct: 151 GGNWLVGTLAYNNWTSVQAIINNMTDDNS-----------IWDISNSIVNPGGINIFSSI 199

Query: 205 RRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAGD 264
            RWD I++AV+ K++AGFNTS+ DVWGRALSY FFP+L+ GG+ YTW++LRD  +F+ G+
Sbjct: 200 SRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGE 259

Query: 265 MPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAH 324
           MP PI+VA GRYPG+  + LNATVFEFNPFEMGSWD +L+ FTDV+Y GTNVTNG P  +
Sbjct: 260 MPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTP--N 317

Query: 325 TAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVAVY 384
              KC+ GFDNT F+MGTSS+LFNQFLL++N+T LP+F+       L   + +++D++++
Sbjct: 318 VTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIW 377

Query: 385 NPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSAD 444
            PNPF +   +  N+S SI + + LYLVDGGED +N+PL PLLQ +R++D+IFA+DNSAD
Sbjct: 378 APNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSAD 437

Query: 445 NKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSLK 504
               WPDG SL  TY RQF LQG+ IAFP++PD NTF NLGLN RPTFFGC+A N+T L+
Sbjct: 438 TDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLE 497

Query: 505 YIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIAC 564
            IPPLVVY PN+  SFNSN S FK+SYS  +   MI NGFE  T  N T D  F+GCI+C
Sbjct: 498 SIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISC 557

Query: 565 AIMKRKQEALDLELPSECERCLARYCWDGTVD 596
           AI++RKQE+L+  LPSEC+ C  +YCW+GTVD
Sbjct: 558 AILRRKQESLNYTLPSECDACFEKYCWNGTVD 589

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 412/576 (71%), Gaps = 19/576 (3%)

Query: 26  YAPKLAYCPSDDINLVREAS-GLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQLF 84
           Y P+   CP D+ N +R A+ GLS  E +WL++RD  T++AL  FL+RA ++    T++ 
Sbjct: 22  YTPQNVSCP-DNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEIT 78

Query: 85  HRIF-DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGC 143
             +F D   VP++GIAV+GGGYR+M  GAG  +A DNRT GA +HGLGG+LQ+ TYM G 
Sbjct: 79  SALFNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGL 138

Query: 144 SGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLNIIKT 203
           SGGNWL  +L++NN+TSVQ IL+          +G    D IW++++S ++P   +  KT
Sbjct: 139 SGGNWLTGTLAYNNFTSVQQILE----------EGD-KADAIWNITNSFLNPYDKDFSKT 187

Query: 204 ARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAG 263
             RW  I + V+ K++AGFN ++ D+W RAL+Y +FPTL   G   TWSSLRD+ IF  G
Sbjct: 188 LARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNG 247

Query: 264 DMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVA 323
           +MP+PI+VADGRYPG+  I LNATVFE  PFE+GSWDPSLNAF+D+KYLGT VT+GKP  
Sbjct: 248 EMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-- 305

Query: 324 HTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFNDVAV 383
              ++CI GFD+ +FIMGTSS+LFN+F +  +S     ++   ++ L+K    E ND+A+
Sbjct: 306 -ETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAM 364

Query: 384 YNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSA 443
           Y PNPFK ++YV  N++TSIVDS+ L+LVDGGED + +P +PLL+++RDLDIIFAID   
Sbjct: 365 YAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDT 424

Query: 444 DNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSL 503
           +    +P G  ++ TYERQF  QG+ +AFP++PD  TF+NLGL  +P+F+GC+A N+T L
Sbjct: 425 ETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDL 484

Query: 504 KYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIA 563
           +YIPPL+VY PNS +SF SN S FKL+Y+  +   MI N FE  TRNN T+D +++ C+ 
Sbjct: 485 EYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVG 544

Query: 564 CAIMKRKQEALDLELPSECERCLARYCWDGTVDDTP 599
           CAI++RKQ++L+L LP  C++C   YCW+GT+D+TP
Sbjct: 545 CAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580

>Scas_92.0d
          Length = 236

 Score =  284 bits (726), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 167/213 (78%), Gaps = 2/213 (0%)

Query: 245 GGIDYTWSSLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLN 304
           GG  YTWS+LR++ +F+  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWD SL 
Sbjct: 19  GGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLR 78

Query: 305 AFTDVKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVT 364
           AFT+VKYLGT V NG P   T  +CI GFDNT FIMGTSS+LFNQFLL++N+T LP+F+ 
Sbjct: 79  AFTNVKYLGTKVNNGTP--ETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIY 136

Query: 365 KWATNLLKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLI 424
           K A   L   + +++D+A+Y PNPFK T +V+EN++ SIV+SE LYLVDGGED +N+PL+
Sbjct: 137 KLANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLV 196

Query: 425 PLLQRDRDLDIIFAIDNSADNKLQWPDGSSLVH 457
           PLLQ +R+LD+IFA+DNSAD    WP+G    H
Sbjct: 197 PLLQEERELDVIFALDNSADTNQYWPNGFEFHH 229

>Kwal_0.173
          Length = 507

 Score =  216 bits (551), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 222/420 (52%), Gaps = 66/420 (15%)

Query: 214 VKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRD-SPIFQAGDMPLPITVA 272
           VK+K+ +GF  S  D WG AL     PT   G I    S+  D S  FQ  ++PLPI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSI----SAFADKSQRFQRYEVPLPIFVA 168

Query: 273 DGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKCIEG 332
           + +        L   VFEF PFE GSW  ++  F  ++YLG+ +T G P     +KCI G
Sbjct: 169 NCKNDN-----LRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTP-----QKCIIG 217

Query: 333 FDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWA---------------TNLLKSWAHE 377
           FD   F+  TSS+LFN  L+ +     P+  T+ A               T + K  A+ 
Sbjct: 218 FDEVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANI 277

Query: 378 FN--DVAVYNPNPFKDTRYVMENFSTSIVDSEH--LYLVDGGEDDENVPLIPLLQRDRDL 433
            +  + A+Y PNPF       ++ +TS V ++H  LYLVDGGED EN+P+ PLL  +R L
Sbjct: 278 MSHPEYAIYQPNPF------YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKL 331

Query: 434 DIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPH-----IPDTNTFINLGLNK 488
           D+IFA+D+S+D    +P+G+ L + Y+  +     K   P+     IP +  F+   L  
Sbjct: 332 DVIFALDSSSD-VCSFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLS 390

Query: 489 RPTFFGC--------NATNM---TSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMA 537
           RP  FGC        N+TN    +S   +PP+++Y+ N+ +SF SN S FKL YS+ ++ 
Sbjct: 391 RPVAFGCHMESYPTLNSTNWVRNSSHLELPPILIYHANANHSFASNLSTFKLKYSKIEVE 450

Query: 538 NMISNGFEIATRNNFTDDPEFIGCIACAIMKRKQE-----ALDLELPSECERCLARYCWD 592
            M+ NG  I +   F D P++  C+AC ++KR  +       ++ LP  C+ C + YC++
Sbjct: 451 QMLRNGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  218 bits (555), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 141/415 (33%), Positives = 212/415 (51%), Gaps = 57/415 (13%)

Query: 214 VKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAGDMPLPITVAD 273
           V+ K+  GF  S  D WGRAL  K +  +    I         S I    + PLPI +A+
Sbjct: 199 VRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITNNYEAPLPIIIAN 256

Query: 274 GRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKCIEGF 333
            +    N   +NA VFEF PFE GSW+  L  F ++KYLG+N T G      A+ C++GF
Sbjct: 257 CK----NEDLVNA-VFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEG-----VAQSCVQGF 306

Query: 334 DNTAFIMGTSSNLFNQFLL---RINSTH-------LPNFVTKWATNLLKSWAHEF----N 379
           D+  FI  TSS+LFN  L+   ++ S         +    + +  NL K+  + F    +
Sbjct: 307 DDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNL-KNKPNSFFGTRS 365

Query: 380 DVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAI 439
           D A++ PNPF    Y      + + +S+ LYLVDGGED EN+PL P LQ +R +D+IFA+
Sbjct: 366 DFALFQPNPF----YRYPGVDSPLTNSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFAL 421

Query: 440 DNSADNKLQWPDGSSLVHTYERQFVLQGQKIA------------FPHIPDTNTFINLGLN 487
           D+S+  ++ +P G  L + Y+      G                 P+IP    F   GL 
Sbjct: 422 DSSS-GRINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGLL 480

Query: 488 KRPTFFGC--------NATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANM 539
           KRP  FGC        NA+   +   +PP+V Y+ N   ++NSN S FKL Y+  ++  M
Sbjct: 481 KRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQGM 540

Query: 540 ISNGFEIATRNNFTDDPEFIGCIACAIMKRKQEALD--LELPSECERCLARYCWD 592
           + NG  + T +N T    +  C+ C ++KR  + ++   +LP  C++C  RYC++
Sbjct: 541 LENGASLFTHDNNT---AYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  219 bits (557), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 189/657 (28%), Positives = 306/657 (46%), Gaps = 137/657 (20%)

Query: 27  APKLAYCPSDDINLVREAS-GLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQLFH 85
           AP    CPS    L+REA   L   ET +L+++ ++TK  L  FL+  T +  + ++ + 
Sbjct: 19  APFQVQCPSSP--LIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFS-SKFYK 75

Query: 86  RIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCSG 145
           R+      P+IGIA+SGGGYRSML G G +S  +       D+GL    + + Y+ G SG
Sbjct: 76  RVLKDP--PKIGIAISGGGYRSMLVGTGFISQMN-------DYGL---FEYSDYIAGLSG 123

Query: 146 G----------NWLVASLSWNNWTSVQDIL------DMNY--------------DRKTAR 175
           G          N+ V SL    W   +D+L      D++               D K  +
Sbjct: 124 GSWILMDLVVQNFEVKSL-LQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKK 182

Query: 176 KQGK--ITK-----DPIWDLSDSI--------VSPGGLNIIKTARR-------------- 206
           +QG   IT      + I ++ +SI        ++   LN +   ++              
Sbjct: 183 RQGGSLITSSSNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAK 242

Query: 207 ----------WDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERG-GIDYTWSSLR 255
                     +  +   +K K+  GF  S  D WG+A+  +     +      +++S L 
Sbjct: 243 IETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLV 302

Query: 256 DS-PIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGT 314
           +S   F+   +P+PI VA+ +    N + L+  +FEF PFE GSW+  L  F  + YLG+
Sbjct: 303 NSSKKFKECSVPIPIFVANCK----NGL-LSNVIFEFTPFEFGSWENILRLFVKLPYLGS 357

Query: 315 NVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRI-NSTHLPNFVTKWATNLL-- 371
            + +GK     A+KCI  FD+  FI  TSS++FN  L+ I N     +     A N++  
Sbjct: 358 KIVSGK-----AEKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMG 412

Query: 372 -------------KSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDD 418
                        K  +    D AVY PNPF    Y+       + +  HLYLVDGGED 
Sbjct: 413 IFGLGKEEIFSISKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVDGGEDG 468

Query: 419 ENVPLIPLLQRDRDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDT 478
           EN+PL  L+  +R+LD+IF +D+S+D    +P+GS L   +E+   L  + + +    + 
Sbjct: 469 ENIPLRTLVIPERELDVIFVLDSSSDID-NYPNGSKLKRIFEK---LDEENVHYQFPNNV 524

Query: 479 NTFINLGLNKRPTFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMAN 538
            TF +      P   GCNAT  T      P+++Y+ N+ +   SN S FK++Y++ ++++
Sbjct: 525 KTFTH------PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSS 578

Query: 539 MISNGFEIATRNNFTDDPE--FIGCIACAIMKRKQEAL--DLELPSECERCLARYCW 591
           M+  G     R  F++D +  +  C+ C + KR  + L    +    C +C   YC+
Sbjct: 579 MLPTG-----RGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCY 630

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  207 bits (528), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/435 (31%), Positives = 215/435 (49%), Gaps = 59/435 (13%)

Query: 199 NIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSP 258
           N  +T   + ++   V+ K+  GF+ S  D WGRAL  K    L           L +  
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 259 IFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTN 318
            F+   +P PI V++ +   S  +     VFEF PFE GSWD  LN F  +KYLG+ + +
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVS 282

Query: 319 GKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRI-----NSTH-----LPNFVTKWAT 368
           GK       +C  GFD+  FI  TSS++FN  L+ +     NS+      +   ++ +  
Sbjct: 283 GKTF-----RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGL 337

Query: 369 NLLKSWAHE--------FNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDEN 420
            L+K    +          D A+Y PNPF    Y +   +  +    HLYLVDGGE+ EN
Sbjct: 338 RLVKDMGAKDVPNNPLTRPDYALYRPNPF----YKLLTVNNELTKENHLYLVDGGENGEN 393

Query: 421 VPLIPLLQRDRDLDIIFAIDNSADNKLQWPDGSSLVHTY------ERQFVLQGQKIA--- 471
           +P+ PLL   R LD+IFA+D+S+D+   +P+G+ L + Y      +    +  + I    
Sbjct: 394 IPIRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNI 452

Query: 472 --FPHIPDTNTFINLGLNKRPTFFGCNATNM----------TSLKYIPPLVVYYPNSEYS 519
              P+IP++ +F+   L  RP  FGC+ ++           T    +PP+V+YY N  +S
Sbjct: 453 DLLPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHS 512

Query: 520 FNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIACAIMKRK--QEALDLE 577
           ++SN S FK SY+  ++  M+ NG +I     F  +  +  C+ C I+KR+  +     E
Sbjct: 513 YSSNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAE 569

Query: 578 LPSECERCLARYCWD 592
           LP  C +C   YC++
Sbjct: 570 LPEFCHQCYQDYCFN 584

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 12/57 (21%)

Query: 108 MLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCSGGNWLVASLSWN--NWTSVQ 162
           MLTG+G ++  +            G+L    Y++G SGG+W++ SL  +  N+ S+Q
Sbjct: 1   MLTGSGFITKMEEY----------GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQ 47

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  198 bits (503), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 138/414 (33%), Positives = 207/414 (50%), Gaps = 55/414 (13%)

Query: 214 VKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPIFQAGDMPLPITVAD 273
           V+ K+EAGF  SL D  G+AL  +  P  ++  +    S+   S  F+  D P+P+ VA+
Sbjct: 287 VRQKKEAGFPISLTDYLGQALLDRL-PAQKQDHLK-QLSNFVQSESFKKFDAPIPVFVAN 344

Query: 274 GRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKCIEGF 333
            +   S    L+  VFEF PFE GSW  +++ F   KYLG+    GK       KC+ GF
Sbjct: 345 AK--TSKGPELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGK-----LTKCVNGF 397

Query: 334 DNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEF--------NDVAVYN 385
           DN  FI  TSS+LFN  L  I  T   N  +      +K+    F        +D A+Y 
Sbjct: 398 DNLGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQ 457

Query: 386 PNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSADN 445
           PNPF     V+      I D+  L+LVDGGED EN+PL  L    R  D+IF +D+S+D 
Sbjct: 458 PNPFYKDPEVL----NLISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSD- 512

Query: 446 KLQWPDGSSLVHTYERQFVLQGQK--IAF----------PHIPDTNTFI--NLGLNKRPT 491
           K   PD + L  TY+    ++ QK  +A           P+IP +   +  N  L+  P 
Sbjct: 513 KENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLST-PI 571

Query: 492 FFGCN-------------ATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMAN 538
            FGC+              T  TS   +PP+++Y+ N   +F SN S FKL+Y++D+   
Sbjct: 572 AFGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNG 631

Query: 539 MISNGFEIATRNNFTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWD 592
           M++NG  +   NN     E++ C+ C ++ R+ + L   + S C+ C+ + C++
Sbjct: 632 MLNNGHHLF--NNDDTQGEYLQCLGCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 56/131 (42%), Gaps = 18/131 (13%)

Query: 23  ADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNFTQ 82
           A  YAP    CP D      +   LS  E  +L +R    K     F +       N   
Sbjct: 18  ASLYAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIKGKFEKFYEDLAIPGINV-- 75

Query: 83  LFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTG 142
                 D+   PRI +A+SGGG+RSML  +G +        G   HGL    + T+Y+ G
Sbjct: 76  ------DSLQFPRIAVAISGGGFRSMLISSGFV-------LGMQQHGL---WECTSYVAG 119

Query: 143 CSGGNWLVASL 153
            SGG+W +  L
Sbjct: 120 ISGGSWTLLKL 130

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 157/556 (28%), Positives = 247/556 (44%), Gaps = 117/556 (21%)

Query: 108 MLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCSGGNWLVASL------------SW 155
           ML   G L   D     AM     G+   + Y+ G SGG+W V  L             W
Sbjct: 1   MLLSTGFLRGLD-----AM-----GLYHYSDYIAGISGGSWSVMDLVVNKFQLGKLISGW 50

Query: 156 NNWTSVQD--------------ILDMNYD----------RKTARKQGKITKDPIWDLSDS 191
           +  TS+                I DM+ D          +++  K+  +   P+  +   
Sbjct: 51  DLSTSMLPGMPDVDIGDDDTDFISDMHLDHLLQPNIATQKRSLFKRDNVVPSPLLKIKQI 110

Query: 192 IVSPGGLNIIKTARRWDHITNA----------VKAKQEAGFNTSLADVWGRAL----SYK 237
           +     L       +     NA          +++K+  GF  S  D W +AL     Y+
Sbjct: 111 LFPNNTLASENLFEKLSKFKNALQFYIDLHLHIRSKRINGFPISFTDYWAQALVQNIKYR 170

Query: 238 FFPTLERGGIDYTWS-SLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEM 296
             PT        T+S S+R S  F+   +P+PI VA+ R    N   L   +FEF P+E 
Sbjct: 171 QLPT------HLTYSKSVRTSNYFKNYLVPIPIIVANCR----NGF-LKNVIFEFTPWEF 219

Query: 297 GSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRI-- 354
           GSW+  L  F +++YLG+ + NG  V+H   +C +G D+  FI  TSS++FN  L+ +  
Sbjct: 220 GSWEQVLGLFVNIEYLGSRIING--VSH---QCYKGLDDLGFIAATSSSIFNNALIYVWK 274

Query: 355 ------------NSTHLPNF---VTKWATNLLKS---WAHEFNDVAVYNPNPFKDTRYVM 396
                         T L  F    TK+ + L  S    A    D AVY  NPF    Y  
Sbjct: 275 LASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQITAALDTDYAVYRHNPF----YKY 330

Query: 397 ENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAIDNSADNKLQWPDGSSLV 456
            N    +  +++LYLVDGGED EN+P+  L+   R++D+I  +D+S+D K  + +G  L 
Sbjct: 331 SNIKNELAQNDYLYLVDGGEDGENIPIRTLV--PRNVDMIMIMDSSSDKK-NYANGDKLK 387

Query: 457 HTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATNMTSLKYIPPLVVYYPNS 516
               +    +G    +P    T+        KRPT  GC     +  K + P++VYYPNS
Sbjct: 388 IVLNQMKEKEGIYYRYPTKIVTS-------QKRPTIIGCKPPRTSDTK-LAPILVYYPNS 439

Query: 517 EYSFN--SNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFIGCIACAIMKRKQEAL 574
           E S    +N S FK+ Y+ ++   +I +G+ + T +    + ++  C+AC ++KR  +  
Sbjct: 440 ERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVTGHG---EHDYQKCMACILVKRSYDQA 496

Query: 575 DLELPSECERCLARYC 590
            +  P +C  C ++YC
Sbjct: 497 SIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/380 (31%), Positives = 185/380 (48%), Gaps = 57/380 (15%)

Query: 214 VKAKQEAGFNTSLADVWGRALSYKFFPTLERGGI---DYTWSSLRDSPI-FQAGDMPLPI 269
           V+ K+  GF  S  D WG AL  +     ++        ++S L +S + F   + P+PI
Sbjct: 184 VRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSFSKLIESNLKFSKFEAPIPI 243

Query: 270 TVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVAHTAKKC 329
            VA+ R        L   +FEF+PFE GSW+  L  F  + YLG+ + NG     TAK C
Sbjct: 244 FVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNG-----TAKIC 293

Query: 330 IEGFDNTAFIMGTSSNLFNQFLL----RINSTHLPNFVTKWAT----------------N 369
            + FD+  FI  TSS++FN  L+    +++ + L    +  A                  
Sbjct: 294 YKEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLT 353

Query: 370 LLKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQR 429
           L  +      D AVY  NPF   RY   N   ++   +HLYLVDGGED EN+PL  L+  
Sbjct: 354 LSNTAIAPETDYAVYYHNPF--FRY--PNIDNALTKDDHLYLVDGGEDGENIPLRSLIIP 409

Query: 430 DRDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKR 489
           +R +D+IFAID+S+D    + +G+ L+ T  R     G     P I              
Sbjct: 410 ERKVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKRI-------NH 460

Query: 490 PTFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATR 549
           P  FGCNA ++       P+++Y+ N+E+S+ SN S FK++Y+  ++  M+ NG +I   
Sbjct: 461 PLIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNGMDIFND 513

Query: 550 NNFTDDPEFIGCIACAIMKR 569
           N   ++  +  C+ C + KR
Sbjct: 514 N---ENIYYQNCLGCILSKR 530

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%), Gaps = 12/85 (14%)

Query: 94  PRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTYMTGCSGGNWLVASL 153
           P IG+A+SGGGYRSMLTG G +     +          G+    +Y++G SGG+W++  L
Sbjct: 9   PNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVLMDL 58

Query: 154 SWNNWTSVQDILDMNYDRKTARKQG 178
             NN+   + I   N+D      QG
Sbjct: 59  IVNNFNITKMI--NNWDLTEGLLQG 81

>KLLA0F14553g 1350504..1351637 similar to sp|P53294 Saccharomyces
           cerevisiae YGR169c, start by similarity
          Length = 377

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 174 ARKQGKITKDPIWDLSDSIVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGR 232
           AR+   IT DP ++L +S        II+T   W  +TN    K    F   L DVW +
Sbjct: 264 ARQGHPITNDPFYNLDNSTYPLRSRFIIETPD-WTQLTNERIEKLRKRFEVELDDVWDQ 321

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 445 NKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDT 478
           N L +P    LV + E+  VL+  KIAFP + DT
Sbjct: 67  NILDYPTIGDLVSSVEKLCVLKELKIAFPEVDDT 100

>Sklu_2411.5 YKL047W, Contig c2411 10852-12411
          Length = 519

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 21/123 (17%)

Query: 305 AFTDVKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTS-------SNLFNQFL-LRINS 356
             TD+ YL + V+    +A +A    + +D   FI  TS       + L+++ L L+ + 
Sbjct: 295 GITDIDYLTSLVSES--MATSA----DNYDIPGFIACTSDEILLFKNELYDKCLKLKDDG 348

Query: 357 THLPNFVTKWATNLLKSWAHEF----NDVAVYNPNPFKDTRYVMENFSTSIVD-SEHLYL 411
             +P FVT   +++L++  HE+      V VY      +TR V   FS+SI   S   YL
Sbjct: 349 KDIPEFVTASDSSVLRATPHEWELYRKLVHVYLGEELSETRCV--TFSSSIEPLSWSQYL 406

Query: 412 VDG 414
           +DG
Sbjct: 407 IDG 409

>Sklu_2418.4 YJR111C, Contig c2418 8325-9146 reverse complement
          Length = 273

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 21/43 (48%)

Query: 205 RRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGI 247
           + W HI + V  K     N+S  D+W   +S+ + P L   G+
Sbjct: 166 KHWSHIYSKVSEKVINNLNSSYPDLWYYTISHVYGPLLSFDGV 208

>AGL187W [4125] [Homologous to ScYDR141C (DOP1) - SH]
           complement(344546..349567) [5022 bp, 1673 aa]
          Length = 1673

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 363 VTKWATNL---------LKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVD 413
           VT+WA  +         L+SW  +F +V  Y P P++ +R +  + S  +    HL  +D
Sbjct: 39  VTEWADYISSLGKLLKALQSWTPQFQNVKYYVPFPYQVSRRLASSLSPDLPSGVHLKTLD 98

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,014,382
Number of extensions: 1046835
Number of successful extensions: 2396
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2368
Number of HSP's successfully gapped: 38
Length of query: 693
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 584
Effective length of database: 12,822,747
Effective search space: 7488484248
Effective search space used: 7488484248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)