Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0E02299g54553728660.0
YOL013C (HRD1)55142710371e-135
Scas_644.65104159671e-125
Kwal_56.225225134387951e-99
KLLA0C05874g5534905503e-63
ACL019C5754134631e-50
Scas_248.12602253721e-40
YKL034W (TUL1)758571391e-08
CAGL0L01947g757571353e-08
Kwal_26.8099750571311e-07
AFR275W753631301e-07
KLLA0F25674g757581301e-07
Scas_625.4761571264e-07
Sklu_2102.1751571255e-07
KLLA0E03960g704321122e-05
AGR034W159651052e-05
Scas_713.45570841077e-05
CAGL0E01441g717291032e-04
CAGL0M08690g328571004e-04
Kwal_56.2390058937997e-04
Sklu_1676.310151908e-04
Scas_705.4142856950.002
YDR143C (SAN1)61029960.002
CAGL0K02563g58630930.004
Kwal_27.1054610436850.004
YDR265W (PEX10)33757910.005
AER390W31651900.005
Kwal_55.1999915264850.009
KLLA0E16720g30551880.010
Kwal_26.809052096890.010
Sklu_2317.249337880.012
ABR104W32829870.013
CAGL0B05049g147027880.014
YBR062C11528810.019
CAGL0H07315g28970840.030
Scas_625.1127424820.044
CAGL0H10274g11461780.046
Scas_615.1333057820.048
YHL010C58552830.051
KLLA0F18458g14028780.057
KLLA0F25740g51748820.069
Sklu_2432.9147568820.084
CAGL0L06336g60054810.093
CAGL0K08052g30556800.093
Scas_573.9150227800.12
YPR093C28827780.14
Kwal_14.1287151896800.14
Kwal_26.803066030790.16
Sklu_2416.811026730.20
Kwal_55.2205411126730.20
CAGL0B02013g112033780.22
KLLA0F12166g152826780.23
Kwal_56.2311213527730.30
Scas_560.6*11828720.31
Scas_677.20283105750.32
KLLA0E18601g65030760.33
KLLA0E07139g11053710.34
KLLA0E07568g33172750.34
YOL138C134125760.37
Scas_585.5*10926700.44
CAGL0I04576g14927720.44
YOL133W (HRT1)12126700.49
YLR247C155626750.50
KLLA0E17787g16227720.55
AER016C147135710.58
KLLA0C15697g30428720.77
AAL030C153923730.82
Kwal_55.2120627527720.88
Sklu_2337.232229720.96
Sklu_1785.333136711.2
ADL181W10822671.2
AGL191W58244721.2
Scas_718.7712829671.5
KLLA0C08756g42724701.6
Kwal_33.15058192944711.7
Kwal_27.1041930031691.7
Kwal_56.2354396538701.8
Scas_665.139238692.3
YDR128W114833683.1
CAGL0J04796g59982683.1
YOL054W40659683.3
CAGL0J03586g41150673.4
AGL079C50624673.6
Scas_702.3333261664.6
YBL102W (SFT2)21571646.1
KLLA0B02563g80863666.2
Kwal_23.628545830656.3
KLLA0E21043g132126666.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02299g
         (537 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...  1108   0.0  
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...   404   e-135
Scas_644.6                                                            377   e-125
Kwal_56.22522                                                         310   1e-99
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...   216   3e-63
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...   182   1e-50
Scas_248.1                                                            147   1e-40
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    58   1e-08
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    57   3e-08
Kwal_26.8099                                                           55   1e-07
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    55   1e-07
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    55   1e-07
Scas_625.4                                                             53   4e-07
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          53   5e-07
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    48   2e-05
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    45   2e-05
Scas_713.45                                                            46   7e-05
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    44   2e-04
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    43   4e-04
Kwal_56.23900                                                          43   7e-04
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         39   8e-04
Scas_705.41                                                            41   0.002
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    42   0.002
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    40   0.004
Kwal_27.10546                                                          37   0.004
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    40   0.005
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    39   0.005
Kwal_55.19999                                                          37   0.009
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    39   0.010
Kwal_26.8090                                                           39   0.010
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            39   0.012
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    38   0.013
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    39   0.014
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    36   0.019
CAGL0H07315g <715897..716766 similar to tr|Q06651 Saccharomyces ...    37   0.030
Scas_625.11                                                            36   0.044
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    35   0.046
Scas_615.13                                                            36   0.048
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    37   0.051
KLLA0F18458g complement(1697871..1698293) some similarities with...    35   0.057
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    36   0.069
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              36   0.084
CAGL0L06336g 713059..714861 some similarities with sp|P32917 Sac...    36   0.093
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    35   0.093
Scas_573.9                                                             35   0.12 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    35   0.14 
Kwal_14.1287                                                           35   0.14 
Kwal_26.8030                                                           35   0.16 
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          33   0.20 
Kwal_55.22054                                                          33   0.20 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    35   0.22 
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    35   0.23 
Kwal_56.23112                                                          33   0.30 
Scas_560.6*                                                            32   0.31 
Scas_677.20                                                            33   0.32 
KLLA0E18601g complement(1645113..1647065) some similarities with...    34   0.33 
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    32   0.34 
KLLA0E07568g 685564..686559 weakly similar to sp|Q04370 Saccharo...    33   0.34 
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    34   0.37 
Scas_585.5*                                                            32   0.44 
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    32   0.44 
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    32   0.49 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    33   0.50 
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    32   0.55 
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    32   0.58 
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    32   0.77 
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    33   0.82 
Kwal_55.21206                                                          32   0.88 
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         32   0.96 
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         32   1.2  
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    30   1.2  
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    32   1.2  
Scas_718.77                                                            30   1.5  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    32   1.6  
Kwal_33.15058                                                          32   1.7  
Kwal_27.10419                                                          31   1.7  
Kwal_56.23543                                                          32   1.8  
Scas_665.1                                                             31   2.3  
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    31   3.1  
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    31   3.1  
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    31   3.3  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    30   3.4  
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    30   3.6  
Scas_702.33                                                            30   4.6  
YBL102W (SFT2) [101] chr2 (24098..24745) Membrane protein requir...    29   6.1  
KLLA0B02563g complement(222951..225377) similar to sp|P34230 Sac...    30   6.2  
Kwal_23.6285                                                           30   6.3  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    30   6.3  

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/537 (100%), Positives = 537/537 (100%)

Query: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60
           MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST
Sbjct: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60

Query: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120
           LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV
Sbjct: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120

Query: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180
           FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF
Sbjct: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180

Query: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNN 240
           TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNN
Sbjct: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNN 240

Query: 241 PTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLML 300
           PTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLML
Sbjct: 241 PTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLML 300

Query: 301 VKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSE 360
           VKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSE
Sbjct: 301 VKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSE 360

Query: 361 NPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQ 420
           NPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQ
Sbjct: 361 NPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQ 420

Query: 421 TNLNPGENPDQRDEADDELEDDTSIADLPITDNISAIPLTSDYPFSIRNVGQEVCKELGG 480
           TNLNPGENPDQRDEADDELEDDTSIADLPITDNISAIPLTSDYPFSIRNVGQEVCKELGG
Sbjct: 421 TNLNPGENPDQRDEADDELEDDTSIADLPITDNISAIPLTSDYPFSIRNVGQEVCKELGG 480

Query: 481 TSEEMTHDVDEEILEFEIEDSTTGRALPARMTIKKRSHTNKVSVPSESIIASHPEQD 537
           TSEEMTHDVDEEILEFEIEDSTTGRALPARMTIKKRSHTNKVSVPSESIIASHPEQD
Sbjct: 481 TSEEMTHDVDEEILEFEIEDSTTGRALPARMTIKKRSHTNKVSVPSESIIASHPEQD 537

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score =  404 bits (1037), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/427 (51%), Positives = 296/427 (69%), Gaps = 32/427 (7%)

Query: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60
           M+    +++  IF  +TY+LT YCV SA ++SVSFLQ+ LKL+EGFN++++++F LLNST
Sbjct: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120
           LLWQ LT +LFGELR+IEHEHIFERLPF +INT+FM S F+E+YFFT+A   L+LLY+KV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180
           FHWIL+DRL+ LLQ IN+ T  K L+ +R+  NL+LL V+D  +I+ C+       SSI+
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCI-------SSIY 173

Query: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRK--FSQ 238
           T   + I         +   +Y++Q MEFT L+IDL+NL L T L F+EF+ S++   ++
Sbjct: 174 TNQKSDI---------ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNE 224

Query: 239 NNPTFNSISAEDADTESEDGD-------------SQFNGLEGKFMYEKLIDVVTRFLQTL 285
           NN   +    ++   ES+                 QF GLEGKFMYEK IDV TRFL+T 
Sbjct: 225 NNHIVHGDPTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTA 284

Query: 286 VHVVMAMVLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPN 345
           +H+ M +   +P+ML+KD+  D+  LY +  SL  IW+N+KQLD  L T+T + L N  N
Sbjct: 285 LHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSAN 344

Query: 346 FDNVCIVCMDELV-SENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVF 404
            DN+CI+CMDEL+ S N    ++  KKPK+LPCGH+LHLSCLKNWMERSQTCPICRLPVF
Sbjct: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVF 404

Query: 405 DENGEIL 411
           DE G ++
Sbjct: 405 DEKGNVV 411

>Scas_644.6
          Length = 510

 Score =  377 bits (967), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/415 (47%), Positives = 276/415 (66%), Gaps = 21/415 (5%)

Query: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65
            + + + FTAI YVLTI C+I++   S SFL ++LKL++GFN++IIT+F LLN+ LLW+F
Sbjct: 5   RRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLWKF 64

Query: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125
           L  +LF ELR+IE EHI ERLPF +IN IF+ + FNEK+F T+A    +LLYMK+F+WIL
Sbjct: 65  LNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWIL 124

Query: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185
           +DRL+ L+Q  N +      + +++  NL++L  I+  +I  C+   Y     ++   T+
Sbjct: 125 KDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTS 183

Query: 186 SI--VLGGGSPLTQRAL--------IYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRK 235
            +  ++   SP +  A         IY+M AMEF  L+I+ +NL L++ L  YE + S +
Sbjct: 184 ILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYKSNQ 243

Query: 236 FSQNNPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLN 295
           + Q N     I  E+ D +    D  FNGLE KF+YEK+ID+ TR L T++H+ +A+ LN
Sbjct: 244 YDQLNAIIEDIEDENDDDDDTPAD--FNGLENKFIYEKIIDLFTRSLMTMIHISLALPLN 301

Query: 296 LPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMD 355
           LP++++KDI  D+  LY N K L  I KN+K LD+KLP M  +DL +    DNVCIVCMD
Sbjct: 302 LPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS---DNVCIVCMD 358

Query: 356 ELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEI 410
           +L+SE     +   KK K+LPCGH LHLSCLKNWMERSQTCPICRLPVFDE+G +
Sbjct: 359 DLLSE-----EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV 408

>Kwal_56.22522
          Length = 513

 Score =  310 bits (795), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 157/438 (35%), Positives = 257/438 (58%), Gaps = 42/438 (9%)

Query: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60
           M   + +R+F  +   +Y    + +I   Q S+SFL+++ +L EG N++++  F  +N  
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120
           LLW+ LT +LFGELR++E+EHIFERL F ++N  FM S F+E  F ++   +  L+++KV
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180
           FHW+LRDRL+ + Q  +E T +  LL++R+  N+ LL  +D  +  FC+      + S F
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYE-FHLSRKFSQN 239
            + + S              +++M A+EF  L++D+  + + + +   E +   R F++ 
Sbjct: 181 YSSSLS--------------VHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFAR- 225

Query: 240 NPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLM 299
                            DG+  + GLEGKFMYEK++ ++ +  +  +H+++ M  ++PLM
Sbjct: 226 -----------------DGED-YTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLM 267

Query: 300 LVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVS 359
           + KDI  D + ++  +KSLL  WK+++Q+D KLP ++   L      D +CIVCMD++++
Sbjct: 268 IAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAASD--DKMCIVCMDDMLA 325

Query: 360 ENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVS 419
             P    +  +KPK+LPC H LHL CLK+WMERSQTCPICR+PVFD+ G ++  S     
Sbjct: 326 --PSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVTS----D 379

Query: 420 QTNLNPGENPDQRDEADD 437
           QTN  PG +      AD+
Sbjct: 380 QTNNQPGTSSAVESTADE 397

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score =  216 bits (550), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 236/490 (48%), Gaps = 65/490 (13%)

Query: 8   REFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLT 67
           ++F+ ++ ++Y    + +     +S S+L    K++EG + +I     LLNS L+ + + 
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 68  SMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWILRD 127
            MLFG+LR+IE+EHI ER+ + VI  +   S+ N         C L  +  +  HWIL+D
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVITLLLSCSSMNGLISVMQIHCVL-FVCCRTLHWILKD 142

Query: 128 RLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNSI 187
           R+++  Q  +     KD+L++R++ NLL+L  +D  ++++ V               N I
Sbjct: 143 RMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYV---------------NKI 187

Query: 188 VLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNSIS 247
           +      +T    I    A+    L  DL+ +IL TGL  +E        QN       +
Sbjct: 188 LYKSNIDVTYTLFIISQYAI----LGTDLLQVILRTGLNLFEL----STIQNRARIRRNA 239

Query: 248 AEDADTESEDGDSQFN---------------GLEGKFMYEKLIDVVTRFLQTLVHVVMAM 292
               D    + + + N               GLEGKF+YEKLIDV    ++ ++    + 
Sbjct: 240 DHHVDEPVINHEERPNAVAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFASSF 299

Query: 293 VLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIV 352
                +M+   +  +    + +++ L   WK+SK LD  L  M + D+  +    ++CIV
Sbjct: 300 STGRVMMVT--VLWEAITTFKSARGLWKNWKSSKSLDASL--MDATDIQIESGEIDICIV 355

Query: 353 CMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEIL- 411
           CM++ +    H  +SDGKK K LPC H LHLSCLKNW+ RS TCPICRLP+FDENG ++ 
Sbjct: 356 CMEDFLPS--HQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMP 413

Query: 412 -----------------APSSA--NVSQTNLNPGENPDQRDEADDELEDDTSIADLPITD 452
                            +P  A    SQTN+N  E  +Q      +     ++A LP  +
Sbjct: 414 YQDHSQSTDPNTTAQEISPGIAVETNSQTNINTLETTNQNITLSPDNSTAQNLAFLPTRN 473

Query: 453 NISAIPLTSD 462
               IP+  +
Sbjct: 474 TSLIIPIQRE 483

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score =  182 bits (463), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 210/413 (50%), Gaps = 42/413 (10%)

Query: 10  FLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLTSM 69
           + +F   TY L  +   S   S    L      S G + +I   F +++  L    +  +
Sbjct: 10  WAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRV 69

Query: 70  LFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMK--VFHWILRD 127
           LFG+L  IE++HIFERL   ++    +  T  + Y   +A    +L Y    V HW+LRD
Sbjct: 70  LFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY---MAGHMTILFYTLCLVAHWVLRD 126

Query: 128 RLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNSI 187
           R+D + Q    D+    +L +R++ +LL+L ++D  ++ FCV               N+ 
Sbjct: 127 RMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQ--------------NTN 172

Query: 188 VLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNSIS 247
           V G      +R  +Y+M A+ F  L++D+++++L T L  +E   SR+    N  +    
Sbjct: 173 VDG------KRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVY---- 222

Query: 248 AEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDIFVD 307
             +  T  +D D +   LEGK++YE + D+    L+ ++ ++  + +   + +V  IFV 
Sbjct: 223 --EGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVR 280

Query: 308 VWVLYMNSKSLLAI---WKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHH 364
                   +S L +   WKN+K+L  KL  ++ + L++    D++CI+CMD+++      
Sbjct: 281 S---IKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDMLPTTETT 334

Query: 365 HQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSAN 417
             +  ++ K LPCGH+LH  CLK+WMERSQTCPICRL VF  +    A + A 
Sbjct: 335 KMN--RRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAR 385

>Scas_248.1
          Length = 260

 Score =  147 bits (372), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 142/225 (63%), Gaps = 18/225 (8%)

Query: 7   KREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFL 66
           + +F++++  TY   I+ V  +  SSV+FLQ  +KL EG N++I+  F LLN  LLW+ L
Sbjct: 42  RGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKLL 101

Query: 67  TSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWILR 126
           T +LFGELR+IE+EH+FERL F ++N+IF+ S F E+ F T+     VL+++KVFHWIL+
Sbjct: 102 TRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWILK 161

Query: 127 DRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNS 186
           DRL+ + Q  NE+T  K +L +R+  NLL L  +D  ++ +C+S +  I++  +T+ +  
Sbjct: 162 DRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNS--ISNDQWTSSS-- 217

Query: 187 IVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFH 231
                         +Y+M  ++F  L++D +++ L+  + F E +
Sbjct: 218 --------------VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVY 248

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 350 CIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           C +CM ++   + E P  H+ D       PC HV H SCL+NWM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 350 CIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           C +CM E    V E P  HQ D       PC H+ H SCL++WM     CP+CR P+
Sbjct: 698 CAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>Kwal_26.8099
          Length = 750

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 350 CIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           C +CM E+   V + P  H+ D       PC H+ H  CL++WM     CP+CR P+
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 347 DNVCI---VCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           DN C+   +CM EL   V + P  H+++       PC H+ H  CL+NWM     CP+CR
Sbjct: 688 DNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

Query: 401 LPV 403
            P+
Sbjct: 748 APL 750

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 349 VCIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           VC +CM ++   V E    H+ D +     PC H+ H  CL+NWM     CP+CR P+
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>Scas_625.4
          Length = 761

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 350 CIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           C +CM E+   + E    H  D       PC H+ H  CL+NWM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 350 CIVCMDEL---VSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           C +CM ++   VS+    H+ D       PCGH+ H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 375 LPCGHVLHLSCLKNWMERSQTCPICRLPVFDE 406
           LPCGHV    CL  W     +CPICR P+  E
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSE 248

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 9/65 (13%)

Query: 347 DNVCIVCMDELVSENPHHHQSDGKKPKKLP-CGHVLHLSCLKNWMERSQTCPICRLPVFD 405
           DN  I C   L  E P           +LP CGH   L C+  W+ RS TCP+CR  V  
Sbjct: 88  DNCAICCCGYLEDEYP--------LVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLV 139

Query: 406 ENGEI 410
              EI
Sbjct: 140 RKPEI 144

>Scas_713.45
          Length = 570

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 35/84 (41%), Gaps = 9/84 (10%)

Query: 365 HQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQT--- 421
           H +    P KLPCGH+    CL  W +   TCP+CR  + + +        A   Q    
Sbjct: 223 HPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCRHVIAEVDTTQHQAQDAASDQAFER 282

Query: 422 ------NLNPGENPDQRDEADDEL 439
                 N NP  N DQ   A D+L
Sbjct: 283 IRNLVYNTNPTSNDDQPTSAQDQL 306

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 372 PKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           P K+PCGH+   SCL  W     +CP+CR
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 12/57 (21%)

Query: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           P     CI+C+ E+              P  LPCGHV    C+ +W + +  CP+CR
Sbjct: 271 PTESRNCILCLMEMTD------------PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>Kwal_56.23900
          Length = 589

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 372 PKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENG 408
           P +LPC HV    C++ W     TCPICR  +   +G
Sbjct: 222 PVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           CI+C+ E+            K P   PCGH+   +C+ NW +    CP+CR
Sbjct: 51  CILCLTEM------------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89

>Scas_705.41
          Length = 428

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query: 347 DNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQT--CPICR 400
           DN+C +C D+L       + +D  + K  PC H  H  C++ W   S    CP+CR
Sbjct: 9   DNICPICFDDL-------NDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 372 PKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           P KLPCGH+    C+  W     +CP+CR
Sbjct: 252 PIKLPCGHIFGRECIYKWSRLENSCPLCR 280

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 375 LPCGHVLHLSCLKNWMERSQTCPICRLPVF 404
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>Kwal_27.10546
          Length = 104

 Score = 37.4 bits (85), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 368 DGKKP--KKLP-CGHVLHLSCLKNWMERSQTCPICR 400
           D K P   +LP C H   L C+  W+ +S+TCP+CR
Sbjct: 44  DDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCR 79

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 12/57 (21%)

Query: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           P     CI+C+  +         SD   P   PCGH+   SCL +W +    CP+CR
Sbjct: 280 PEASRKCILCLMNM---------SD---PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 12/51 (23%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           CI+C+            +D   P  LPCGH+   +C+  W      CP+CR
Sbjct: 266 CILCL------------ADMTDPSCLPCGHMFCWACVMQWCNERNECPLCR 304

>Kwal_55.19999
          Length = 152

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 12/64 (18%)

Query: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPV 403
           P+    CI+C+  ++             P   PCGHV    CL +W      CP+CR   
Sbjct: 96  PSDSRKCILCLGFMLD------------PSCAPCGHVFCWKCLLSWCNERPECPLCRQTC 143

Query: 404 FDEN 407
             +N
Sbjct: 144 HAQN 147

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 12/51 (23%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           C++C++ ++             P   PCGH+    C+  W    Q CP+CR
Sbjct: 255 CVLCLNYMLD------------PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>Kwal_26.8090
          Length = 520

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 34/96 (35%), Gaps = 25/96 (26%)

Query: 329 DTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKN 388
           DT+LPT               C VC++ L SE              +PC H  H  CL  
Sbjct: 221 DTELPT---------------CPVCLERLDSEVT--------GLATIPCQHTFHCVCLNK 257

Query: 389 WMERSQTCPICRLPVFDENGEILAPSSANVSQTNLN 424
           W +    CP+CR          LA   A  S   +N
Sbjct: 258 WGD--NRCPVCRYSGLKLTKSSLARQGARCSTCGVN 291

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 372 PKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENG 408
           P +L CGH     C+  W +   +CPICR  +    G
Sbjct: 136 PTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 172

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 375 LPCGHVLHLSCLKNWME---RSQTCPICR 400
           +PCGH  HL+C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 377  CGHVLHLSCLKNWMERSQTCPICRLPV 403
            CGH+   SC+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 35.8 bits (81), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400
           +LP C H   L CL  W+ RS TCP+CR
Sbjct: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCR 88

>CAGL0H07315g <715897..716766 similar to tr|Q06651 Saccharomyces
           cerevisiae YDR313c PIB1
          Length = 289

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 11/70 (15%)

Query: 325 SKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLS 384
           ++ L  K+PT T+ +  N+P     C +C +E+V          G+K  +L C  V H S
Sbjct: 211 NRMLVYKIPTTTAPE--NEPQGYQECPICFEEMVP---------GEKVGRLECLCVYHYS 259

Query: 385 CLKNWMERSQ 394
           C+K+W  + +
Sbjct: 260 CIKSWFRKKR 269

>Scas_625.11
          Length = 274

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICR 400
           C H  H  C+K W++++  CP+CR
Sbjct: 231 CSHHFHFECIKLWLQKNSLCPLCR 254

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 34.7 bits (78), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 20/61 (32%)

Query: 347 DNVCIVCM-----DE--LVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPIC 399
           D+ C +C      DE  LV E PH             CGH     C+  W+ ++ TCP+C
Sbjct: 40  DDTCPICCSNFIADEYPLVVELPH-------------CGHKFDFECVSMWLTKNTTCPMC 86

Query: 400 R 400
           R
Sbjct: 87  R 87

>Scas_615.13
          Length = 330

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 12/57 (21%)

Query: 344 PNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           P     CI+C+  +              P   PCGH+    C+ +W +    CP+CR
Sbjct: 274 PEDARKCILCLAYMTD------------PSCSPCGHIFCWECILDWCKERPECPLCR 318

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%)

Query: 349 VCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
            C VC++ + SE              +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSETT--------GLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 34.7 bits (78), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400
           K+P C H   L CL  W++ + TCP+CR
Sbjct: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 4/48 (8%)

Query: 376 PCGHVLHLSCLKNWMERSQTCPICRLPVF-DENGEILAPSSANVSQTN 422
           PC H  H  CL  W  ++  CP+CR     D N E L P      +TN
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNNEPL-PRCLECGETN 277

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 20/68 (29%)

Query: 377  CGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQTNLNPGENPDQRDEAD 436
            CGH    SC+  W++   TCP+C+                    TN+ P E  + R +  
Sbjct: 1180 CGHFFCYSCIHTWLKEHNTCPLCK--------------------TNVTPSEVYNFRYKEG 1219

Query: 437  DELEDDTS 444
            +EL +D +
Sbjct: 1220 EELPEDGA 1227

>CAGL0L06336g 713059..714861 some similarities with sp|P32917
           Saccharomyces cerevisiae YDR103w STE5 pheromone signal
           transduction pathway protein, hypothetical start
          Length = 600

 Score = 35.8 bits (81), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 347 DNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400
           +++C +C      + P  ++S G+K  +L CGH+ H+ CL  ++  S   PIC+
Sbjct: 37  NHICTLC------DEPIAYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICK 83

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 348 NVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQ--TCPICRL 401
            VC +C++++  ++   +          PCGH  H  C++ W   ++   CP+CR+
Sbjct: 4   KVCAICLEDICGKSSTSYLK--------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>Scas_573.9
          Length = 1502

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 375  LPCGHVLHLSCLKNWMERSQTCPICRL 401
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 377 CGHVLHLSCLKNWMERS--QTCPICRL 401
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>Kwal_14.1287
          Length = 1518

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 22/96 (22%)

Query: 314  NSKSLLAIWKNSKQ---LDTKLPTMTS-----DDLNNDPNFDNVCIVCMDELVSENPHHH 365
            N+K    I KN+++   L ++L  + +     ++LN +  F   C +C+ E+   +    
Sbjct: 1147 NTKDNTLIGKNTQKIHNLQSRLKYLETLLRLKENLNGEHKFS--CTICLGEIYMGSV--- 1201

Query: 366  QSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRL 401
                     + CGH     C+ +W++   +CP+C++
Sbjct: 1202 ---------IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>Kwal_26.8030
          Length = 660

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 376 PCGHVLHLSCLKNWMERSQTCPICRLPVFD 405
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 32.7 bits (73), Expect = 0.20,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 77  CNHAFHLHCINKWLQTRNACPLDNQP 102

>Kwal_55.22054
          Length = 111

 Score = 32.7 bits (73), Expect = 0.20,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQP 103

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 377  CGHVLHLSCLKNWMERSQTCPI---CRLP-VFD 405
            C HVLHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 375  LPCGHVLHLSCLKNWMERSQTCPICR 400
            L CGH     C+ +W +++ +CP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>Kwal_56.23112
          Length = 135

 Score = 32.7 bits (73), Expect = 0.30,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 377 CGHVLHLSCLKNWMERSQT---CPICR 400
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>Scas_560.6*
          Length = 118

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400
           +LP C H   L C+  W+ +S TCP+CR
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCR 93

>Scas_677.20
          Length = 283

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 10/105 (9%)

Query: 118 MKVFHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVID-----SYVISFCVSTA 172
           +KVF    R+R  +LL G   DTR+ D +  ++  N  +  V+D      YV   C + +
Sbjct: 118 LKVFQ--SRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYV--ECSALS 173

Query: 173 YNIASSIFTAGTNSIVLGGGSPLTQRALIYIMQA-MEFTNLMIDL 216
                 +F     ++V G G    +R  +   +     TN  +D+
Sbjct: 174 QMGIKDVFEEAVKAVVYGDGIETPERGAMAAQKTRTTSTNTALDV 218

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 376 PCGHVLHLSCLKNWMERSQTCPICRLPVFD 405
           PCGH +H  C   +++ S  CP C + V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 32.0 bits (71), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 5/53 (9%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLP 402
           C+ C  E    + H   +   +     C H  HL C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGE-----CNHAFHLHCITQWIKSRNVCPLDNKP 102

>KLLA0E07568g 685564..686559 weakly similar to sp|Q04370
           Saccharomyces cerevisiae YMR026c PEX12 required for
           biogenesis of peroxisomes - peroxin singleton, start by
           similarity
          Length = 331

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 14/72 (19%)

Query: 332 LPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWME 391
           LP + S+  NND    +VC +C +E+             +P  +  G+V +L C K W+ 
Sbjct: 265 LPGVASEVDNNDTT--DVCPLCGEEIT------------EPAMISSGYVANLECAKKWVS 310

Query: 392 RSQTCPICRLPV 403
              TC    +P+
Sbjct: 311 TENTCFATGVPI 322

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 375  LPCGHVLHLSCLKNWM--ERSQTCP 397
            LPCGH  H  C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>Scas_585.5*
          Length = 109

 Score = 31.6 bits (70), Expect = 0.44,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 76  CNHAFHLHCINKWIKTRDACPLDNQP 101

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 32.3 bits (72), Expect = 0.44,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 377 CGHVLHLSCLKNWMERSQT---CPICR 400
           CGH  H+ C+  W++   +   CP+CR
Sbjct: 65  CGHNFHVHCISRWVDTPTSKGLCPMCR 91

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 31.6 bits (70), Expect = 0.49,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 375  LPCGHVLHLSCLKNWMERSQTCPICR 400
            + CGH    SC+  W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 32.3 bits (72), Expect = 0.55,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 377 CGHVLHLSCLKNWMERSQT---CPICR 400
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
           (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 32.0 bits (71), Expect = 0.58,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 50/135 (37%), Gaps = 25/135 (18%)

Query: 322 WKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQSDGKKPKKL-PCGHV 380
           W   K+L    P    +D       ++VC +C        P+        P  +  C H 
Sbjct: 16  WDVPKELKRDSPVYEDEDE------EDVCGICRGSYNGTCPNCKLPGETCPLIVGSCHHN 69

Query: 381 LHLSCLKNWMERSQT---CPICRL------------PVFDENGEIL--APSSANVSQTNL 423
            H+ C+  W+  S +   CP+CR             P  D+  ++L  A   + VS    
Sbjct: 70  FHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMKARQQSVVSVAGA 129

Query: 424 NPGENPDQRDEADDE 438
           NP   PDQ D   D+
Sbjct: 130 NP-VGPDQDDVIIDQ 143

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
           Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 375 LPCGHVLHLSCLKNWMERSQ--TCPICR 400
           LPC H  H+SC++ W   S    CP CR
Sbjct: 21  LPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 378  GHVLHLSCLKNWMERSQTCPICR 400
            GH     C+ +W+E  Q+CP+C+
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCK 1257

>Kwal_55.21206
          Length = 275

 Score = 32.3 bits (72), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 375 LPCGHVLHLSCLKNWMER-SQTCPICR 400
           L C HV H  C+  W+ R S  CP+C+
Sbjct: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%)

Query: 375 LPCGHVLHLSCLKNWMERSQ--TCPICRL 401
           + C H  HL C++ W   SQ   CP CR+
Sbjct: 21  VTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 372 PKKLPCGHVLHLSCLKNWMERSQ----TCPICRLPV 403
           P    CGH     C+ NW+  +     TCP CR  V
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 30.4 bits (67), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 11/22 (50%)

Query: 377 CGHVLHLSCLKNWMERSQTCPI 398
           C H  HL C+  W+     CP+
Sbjct: 75  CNHAFHLHCINKWLLTRNACPL 96

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 4/44 (9%)

Query: 356 ELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPIC 399
           E  +E  H+  S    P +LPCGHV    C+  W +   +   C
Sbjct: 209 EEEAEQSHYKHS----PTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>Scas_718.77
          Length = 128

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 377 CGHVLHLSCLKNWMERSQ---TCPICRLP 402
           C H  H+ C+  W+  +     CP+CR P
Sbjct: 74  CQHAFHVHCVVPWLATAAARGACPMCRQP 102

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 376 PCGHVLHLSCLKNWMERSQTCPIC 399
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>Kwal_33.15058
          Length = 1929

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 363  HHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQ------TCPICR 400
            + + S+G +   + C H +H SC K + ++ +       CP+C+
Sbjct: 1250 NEYGSNGSRKVFVSCNHYIHYSCFKRYAQKKRFSTNSFICPLCQ 1293

>Kwal_27.10419
          Length = 300

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 377 CGHVLHLSCLKNWMERSQ----TCPICRLPV 403
           CGH     C+ NW+  +     TCP CR P+
Sbjct: 9   CGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>Kwal_56.23543
          Length = 965

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 369 GKKPKKLPCGHVLHLSCLKNWMERSQTC------PICR 400
           G+K   L CGH++H  CL  + E   +C      P CR
Sbjct: 175 GEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>Scas_665.1
          Length = 392

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 372 PKKLPCGHVLHLSCLKNWM----ERSQTCPICRLPVFD 405
           P    CGH     CLK+W+    ++   CP CR  + D
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing five
            WD domains (WD-40 repeat), which may mediate
            protein-protein interactions, has a region of low
            similarity to a region of S. cerevisiae Sec27p, which a
            coatomer (COPI) complex beta' chain (beta'-COP) of
            secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 377  CGHVLHLSCLKNWMERSQTCPI---CRLP-VFD 405
            C HVLH SC + W E    CP    C  P +FD
Sbjct: 1115 CQHVLHSSCARIWWEIGDECPSGCGCNCPEMFD 1147

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 34/82 (41%), Gaps = 35/82 (42%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWME----------------RS 393
           C +C++E+              P+ + CGH+  +SCL+N+ E                + 
Sbjct: 152 CPICLNEIPVA-----------PRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKF 200

Query: 394 QTCPICRLPVFDENGEILAPSS 415
           + CP+C        G I+ P++
Sbjct: 201 KECPLC--------GSIVKPNN 214

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 21/59 (35%), Gaps = 16/59 (27%)

Query: 349 VCIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWM----ERSQTCPICRLPV 403
           VC +C D +              P   PCGH     CL  W     ++   CP CR  +
Sbjct: 29  VCSICHDYMFV------------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 12/50 (24%)

Query: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPIC 399
           C +C D L            K P   PCGH     C++ ++     CP+C
Sbjct: 27  CHICKDFL------------KNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 12/24 (50%), Gaps = 2/24 (8%)

Query: 377 CGHVLHLSCLKNWMERSQTCPICR 400
           C H  H  CL  W  +   CP+CR
Sbjct: 231 CQHTFHCQCLDKW--KDGRCPVCR 252

>Scas_702.33
          Length = 332

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 12/61 (19%)

Query: 285 LVHVVMAMVLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDP 344
           L+ +V+ MVL           +  W+LY  +K      KN  + DT +P++TS    NDP
Sbjct: 280 LLTIVVTMVL---------FMMTAWILYFRTKKRYMELKNQDRSDTNIPSLTS---MNDP 327

Query: 345 N 345
           +
Sbjct: 328 S 328

>YBL102W (SFT2) [101] chr2 (24098..24745) Membrane protein required
           for ER to Golgi transport, can suppress
           temperature-sensitive mutants of SED5 when overexpressed
           [648 bp, 215 aa]
          Length = 215

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 59  STLLWQFLTSMLFGELRIIEHEHIFERLPFAV--INTIFM---FSTFNEKYFFTLATCAL 113
            +LL+     +L G L  ++H    ERLPF++    T FM   F+ F++    T+ TCAL
Sbjct: 119 GSLLFVLAFGVLMGPLAYLKHLTARERLPFSMFFFATCFMTIYFAAFSKNTVLTI-TCAL 177

Query: 114 VLLYMKVFHWI 124
           + L   +++ I
Sbjct: 178 LELVAVIYYAI 188

>KLLA0B02563g complement(222951..225377) similar to sp|P34230
           Saccharomyces cerevisiae YKL188c PXA2 ABC transporter,
           peroxisomal, start by similarity
          Length = 808

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 8   REFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLT 67
           ++ L    + Y   I+ V+  C S+VS  ++  K+ +    L ITV ++ + T LW F T
Sbjct: 675 QQRLAMARMYYHKPIFAVLDECTSAVS-PEMEQKMYKHAQDLGITVLSVCHRTTLWHFHT 733

Query: 68  SML 70
            +L
Sbjct: 734 HLL 736

>Kwal_23.6285
          Length = 458

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 370 KKPKKLPCGHVLHLSCLKNWMERSQTCPIC 399
           K P   PC H     C++ ++ R   CP+C
Sbjct: 45  KSPVLTPCAHTFCSLCIREYLNRELRCPLC 74

>KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomyces
            cerevisiae YOL138c, hypothetical start
          Length = 1321

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)

Query: 375  LPCGHVLHLSCLKNWM--ERSQTCPI 398
            L CGH  H  CLK W   E    CP+
Sbjct: 1289 LNCGHEGHFECLKKWFFDENMDVCPL 1314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,009,152
Number of extensions: 833251
Number of successful extensions: 3550
Number of sequences better than 10.0: 133
Number of HSP's gapped: 3600
Number of HSP's successfully gapped: 133
Length of query: 537
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 431
Effective length of database: 12,926,601
Effective search space: 5571365031
Effective search space used: 5571365031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)