Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D06578g86854504e-60
Sklu_2189.295833578e-46
YLL018C-A (COX19)98813533e-45
KLLA0D03971g99833325e-42
Scas_347.289813247e-41
ADL041C99833065e-38
KLLA0F23012g58144620.59
AGR043W364541591.3
YDR031W11737562.8
AFR564W33453564.2
YJR098C65519564.4
YJL176C (SWI3)82548547.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D06578g
         (85 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D06578g 625655..625915 no similarity, hypothetical start         177   4e-60
Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement      142   8e-46
YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protei...   140   3e-45
KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyce...   132   5e-42
Scas_347.2                                                            129   7e-41
ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH] (617549....   122   5e-38
KLLA0F23012g 2138821..2140566 similar to ca|CA2828|IPF17026 Cand...    28   0.59 
AGR043W [4353] [Homologous to ScYDR150W (NUM1) - SH] complement(...    27   1.3  
YDR031W (YDR031W) [882] chr4 (503494..503847) Protein of unknown...    26   2.8  
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...    26   4.2  
YJR098C (YJR098C) [2990] chr10 complement(613103..615070) Protei...    26   4.4  
YJL176C (SWI3) [2747] chr10 complement(92051..94528) Component o...    25   7.6  

>CAGL0D06578g 625655..625915 no similarity, hypothetical start
          Length = 86

 Score =  177 bits (450), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MSSGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDY 60
          MSSGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDY
Sbjct: 1  MSSGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDY 60

Query: 61 LKCRMDHQLMDKDEWKNLGLPPDDK 85
          LKCRMDHQLMDKDEWKNLGLPPDDK
Sbjct: 61 LKCRMDHQLMDKDEWKNLGLPPDDK 85

>Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement
          Length = 95

 Score =  142 bits (357), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 66/83 (79%), Positives = 74/83 (89%)

Query: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62
          SGNPG +LRALSPTPPERGSFPLDHDGEC++ MQ YLQC++L   ENA NCRLLAK+YLK
Sbjct: 2  SGNPGNSLRALSPTPPERGSFPLDHDGECSKQMQDYLQCIKLVRGENAPNCRLLAKNYLK 61

Query: 63 CRMDHQLMDKDEWKNLGLPPDDK 85
          CRMD+QLMD+DEWKNLGLP D K
Sbjct: 62 CRMDNQLMDRDEWKNLGLPDDKK 84

>YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protein
          that may function in metal transport required for
          cytochrome oxidase assembly, localizes to the
          mitochondrial intermembrane space and to the cytoplasm
          [297 bp, 98 aa]
          Length = 98

 Score =  140 bits (353), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (87%)

Query: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62
          SGNPG +L AL PTPPERGSFPLDHDGEC +YMQ+YL+CM+L  NENA NCRLLAKDYL+
Sbjct: 2  SGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYLR 61

Query: 63 CRMDHQLMDKDEWKNLGLPPD 83
          CRMDHQLMD DEW +LGLP D
Sbjct: 62 CRMDHQLMDYDEWSHLGLPED 82

>KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyces
          cerevisiae YLL018ca COX19, start by similarity
          Length = 99

 Score =  132 bits (332), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (86%)

Query: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62
          S NPG +L+ALSPTPPERGSFPLDHDG+C + MQ+YL C++L   ENA NCRLLAK+YLK
Sbjct: 2  SANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYLK 61

Query: 63 CRMDHQLMDKDEWKNLGLPPDDK 85
          CRMD++LMD+D+WK+LGLP D K
Sbjct: 62 CRMDNKLMDRDDWKHLGLPSDKK 84

>Scas_347.2
          Length = 89

 Score =  129 bits (324), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 59/81 (72%), Positives = 68/81 (83%)

Query: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62
          SGNPG +LRALSPTPPERGSFPLDHD EC + M  YL+CM+L   +NA NCRLLAK+YL+
Sbjct: 2  SGNPGSSLRALSPTPPERGSFPLDHDNECFQQMSAYLECMKLVKGQNAPNCRLLAKEYLQ 61

Query: 63 CRMDHQLMDKDEWKNLGLPPD 83
          CRMDHQLMD D+W +LGLP D
Sbjct: 62 CRMDHQLMDVDDWSHLGLPGD 82

>ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH]
          (617549..617848) [300 bp, 99 aa]
          Length = 99

 Score =  122 bits (306), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (79%)

Query: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62
          SGNP  AL ALSPTP ERG FPLDH+GEC  +M +YL CM+L   ENA NCRLL ++YLK
Sbjct: 2  SGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYLK 61

Query: 63 CRMDHQLMDKDEWKNLGLPPDDK 85
          CRMDH+LMD+DEW +LGLP D +
Sbjct: 62 CRMDHRLMDRDEWAHLGLPDDKR 84

>KLLA0F23012g 2138821..2140566 similar to ca|CA2828|IPF17026 Candida
           albicans unknown function, hypothetical start
          Length = 581

 Score = 28.5 bits (62), Expect = 0.59,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 12/44 (27%)

Query: 33  EYMQKYLQCMRLAANENAH-----NC-------RLLAKDYLKCR 64
           EY+   ++C++LA  ++       NC       RLL+KDYLK R
Sbjct: 299 EYLHMLIECLKLAFYDSDEYVSDPNCQEADILHRLLSKDYLKSR 342

>AGR043W [4353] [Homologous to ScYDR150W (NUM1) - SH]
           complement(787126..798063) [10938 bp, 3645 aa]
          Length = 3645

 Score = 27.3 bits (59), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 45  AANENAHNCRLLAKDYLKCRMDHQLMDKDEWKNLGLPPDDK 85
           A N+ A++  L         +DH L+DKDE+++L  PP +K
Sbjct: 664 ALNKKANSPTLEHLKSASAALDHVLVDKDEYEHLLNPPLEK 704

>YDR031W (YDR031W) [882] chr4 (503494..503847) Protein of unknown
          function, has low similarity to uncharacterized C.
          albicans Orf6.2478p [354 bp, 117 aa]
          Length = 117

 Score = 26.2 bits (56), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 29 GECAEYMQKYLQCMR--LAANENAHNCRLLAKDYLKC 63
           EC+E M+KY QC+R  +       NC    +D  KC
Sbjct: 61 SECSEPMKKYDQCIRDNMGTRTINENCLGFLQDLRKC 97

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score = 26.2 bits (56), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 23  FPLDHDGECAEY---MQKYLQCMRLAANENAHNCRLLAKDYLKCRMDHQLMDK 72
            PL+H+ +   +   MQ+ L C      +        A D+LKCR+D +L+ K
Sbjct: 246 LPLNHNMKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRIDPELLKK 298

>YJR098C (YJR098C) [2990] chr10 complement(613103..615070) Protein
           of unknown function [1968 bp, 655 aa]
          Length = 655

 Score = 26.2 bits (56), Expect = 4.4,   Method: Composition-based stats.
 Identities = 10/19 (52%), Positives = 10/19 (52%)

Query: 64  RMDHQLMDKDEWKNLGLPP 82
           R D    D D WK LGL P
Sbjct: 441 RYDFDFFDTDVWKTLGLSP 459

>YJL176C (SWI3) [2747] chr10 complement(92051..94528) Component of
           SWI-SNF global transcription activator complex; acts to
           assist gene-specific activators through chromatin
           remodeling [2478 bp, 825 aa]
          Length = 825

 Score = 25.4 bits (54), Expect = 7.6,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 40  QCMRLAANENAHNCRLLAKDYLKCRMDH--QLMDKDEWKNLGLPPDDK 85
           +C+ L ++ N +N  +  K+ ++ ++DH   ++ K E  ++G  P +K
Sbjct: 742 KCLNLISDSNINNSSVAEKEEIRSQIDHFKSMLSKPETLSIGKNPFNK 789

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,370,056
Number of extensions: 117470
Number of successful extensions: 211
Number of sequences better than 10.0: 16
Number of HSP's gapped: 211
Number of HSP's successfully gapped: 16
Length of query: 85
Length of database: 16,596,109
Length adjustment: 57
Effective length of query: 28
Effective length of database: 14,622,883
Effective search space: 409440724
Effective search space used: 409440724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)