Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D05808g77676439060.0
YLL001W (DNM1)75777328460.0
KLLA0F12892g77578127800.0
AAL174C75677527560.0
Kwal_33.1520077378026920.0
Scas_690.2075577126810.0
YKR001C (VPS1)70476414360.0
CAGL0L02299g70076614040.0
ABL001W68575613980.0
Scas_668.2872276414010.0
Sklu_2326.469056013391e-175
Kwal_26.792469156213371e-175
KLLA0B13277g68455812641e-164
Kwal_26.86138612744229e-43
Sklu_1555.28842774087e-41
ACR164C8682773935e-39
KLLA0D06721g8832753845e-38
CAGL0L02783g8911563171e-29
YOR211C (MGM1)9021603133e-29
Scas_605.178911563081e-28
Kwal_56.2255980082790.24
YOR165W (SEY1)77628731.2
YCR095C362109711.8
AGR264C79128721.8
ADR018C120364721.9
CAGL0L04532g79586712.2
Sklu_2179.478228702.7
KLLA0D07898g1126224703.2
Sklu_2434.1157721693.4
Scas_657.9811120684.7
Scas_690.5233108674.7
AGR259C798116684.9
Kwal_27.1224576775685.7
CAGL0F06347g91085676.7
Scas_707.111038123669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D05808g
         (764 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1509   0.0  
YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1100   0.0  
KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1075   0.0  
AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1066   0.0  
Kwal_33.15200                                                        1041   0.0  
Scas_690.20                                                          1037   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   557   0.0  
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   545   0.0  
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   543   0.0  
Scas_668.28                                                           544   0.0  
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           520   e-175
Kwal_26.7924                                                          519   e-175
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   491   e-164
Kwal_26.8613                                                          167   9e-43
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         161   7e-41
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   155   5e-39
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   152   5e-38
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   126   1e-29
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   125   3e-29
Scas_605.17                                                           123   1e-28
Kwal_56.22559                                                          35   0.24 
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    33   1.2  
YCR095C (YCR095C) [618] chr3 complement(288166..289254) Member o...    32   1.8  
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    32   1.8  
ADR018C [1759] [Homologous to ScYIR006C (PAN1) - SH] (735263..73...    32   1.9  
CAGL0L04532g 522091..524478 highly similar to sp|P13188 Saccharo...    32   2.2  
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         32   2.7  
KLLA0D07898g 675451..678831 similar to sp|P53893 Saccharomyces c...    32   3.2  
Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement      31   3.4  
Scas_657.9                                                             31   4.7  
Scas_690.5                                                             30   4.7  
AGR259C [4570] [Homologous to ScYOR168W (GLN4) - SH] (1227069..1...    31   4.9  
Kwal_27.12245                                                          31   5.7  
CAGL0F06347g 625184..627916 similar to sp|P37296 Saccharomyces c...    30   6.7  
Scas_707.11                                                            30   9.9  

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1509 bits (3906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/764 (97%), Positives = 743/764 (97%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120
           VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120

Query: 121 SAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKI 180
           SAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKI
Sbjct: 121 SAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKI 180

Query: 181 YSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNS 240
           YSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNS
Sbjct: 181 YSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNS 240

Query: 241 ESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQM 300
           ESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQM
Sbjct: 241 ESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQM 300

Query: 301 NKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLI 360
           NKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLI
Sbjct: 301 NKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLI 360

Query: 361 SQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYY 420
           SQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYY
Sbjct: 361 SQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYY 420

Query: 421 IYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS 480
           IYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS
Sbjct: 421 IYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS 480

Query: 481 QQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           QQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR
Sbjct: 481 QQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540

Query: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600
           AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE
Sbjct: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600

Query: 601 PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKXXXXXXXXXX 660
           PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYK          
Sbjct: 601 PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKDDFSSQFQQL 660

Query: 661 XXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV 720
                      AFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV
Sbjct: 661 NFNSNLNSDDDAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV 720

Query: 721 NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764
           NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV
Sbjct: 721 NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/773 (72%), Positives = 640/773 (82%), Gaps = 37/773 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120
           VTRRPLVLQLNNIS +SPLI+E+ + +    N     + ++GF+                
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNSV----NPHDEVTKISGFE---------------- 100

Query: 121 SAIGGSNATEIR------RDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKI 174
               G+   E R       DEWGEFLHIPG+RFYDF +I+REIE+ETARIAGK+KGISKI
Sbjct: 101 ---AGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKI 157

Query: 175 PINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPAN 234
           PINLK++SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDY+ATPNC+ILAVSPAN
Sbjct: 158 PINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPAN 217

Query: 235 VDLVNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRS 294
           VDLVNSESLKLAREVDP G RTIGVITKLDLMDSGTNALDILSGK+YPLKLGFVGVVNRS
Sbjct: 218 VDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRS 277

Query: 295 QQDIQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKT 354
           QQDIQ+NKTVEE+L+KEE+YF +HPVYRT+S +CGTRYLAKLLNQTL+SHI++KLPDIKT
Sbjct: 278 QQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKT 337

Query: 355 RLNTLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSG 414
           +LNTLISQTEQEL++YG  G  T E+RA LVLQLMNKF+T FISSIDGTSS+I+TKEL G
Sbjct: 338 KLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCG 397

Query: 415 GARIYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIK 474
           GARIYYIYNN+FGN+LKSIDPT+NL++LD+RTAIRNSTGPRPTLFVPELAFDLLVKPQIK
Sbjct: 398 GARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIK 457

Query: 475 LLLEPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVES 534
           LLLEPSQ+CVELVYEEL+KICHKCG+ EL+RYPKLKS LIEV+S+LLRERL PTRSYVES
Sbjct: 458 LLLEPSQRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVES 517

Query: 535 LIDIHRAYINTNHPNFLTATDAMSDIIQSR-KRNQENQRAQKMLEKEKQNEIQENGTASQ 593
           LIDIHRAYINTNHPNFL+AT+AM DI+++R KRNQE  ++ K+ ++E       NGT+S 
Sbjct: 518 LIDIHRAYINTNHPNFLSATEAMDDIMKTRRKRNQELLKS-KLSQQENGQTNGINGTSSI 576

Query: 594 NSKSDIEPSIDGTELDSSKDA--TKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKX 651
           +S  D + + +    D   DA   ++KD FLNYFFGKDKK Q      D + S + G   
Sbjct: 577 SSNIDQDSAKNSDYDDDGIDAESKQTKDKFLNYFFGKDKKGQPVFDASDKKRS-IAG--D 633

Query: 652 XXXXXXXXXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQI 711
                                 ENA  P LTERE+LECELI+RLIVSYFDI+REMIEDQ+
Sbjct: 634 GNIEDFRNLQISDFSLGDIDDLENA-EPPLTEREELECELIKRLIVSYFDIIREMIEDQV 692

Query: 712 PKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764
           PKA+MCLLVN+CKDSVQNRLVT+LY+E++FEELLVEDQTL QDRE  +KSL V
Sbjct: 693 PKAVMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGV 745

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/781 (70%), Positives = 630/781 (80%), Gaps = 37/781 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQN-NNESTTSLNDNNGA 119
           VTRRPLVLQLNNI  +SPL+  N D     N++S S   +N   +   E   +L D+   
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVY-NYD-----NSSSTSLEQVNDEPDARTEKEMTLEDH--- 111

Query: 120 SSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179
                 SN     ++EWGEFLHIPGRRFYDFSEIRREIE+ETARIAGK KGIS+IPINLK
Sbjct: 112 --LRKNSNYKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLK 169

Query: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239
           IYSPHVLNLTLVDLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNCIILA+SPANVDLVN
Sbjct: 170 IYSPHVLNLTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVN 229

Query: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299
           SESLKLARE+DPHG RTIGVITKLDLMD GTNALDILSGKLYPLKLGFVGVVNRSQQDIQ
Sbjct: 230 SESLKLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 289

Query: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359
            NK+VEEALN EE++F +HPVYRT+S RCGTRYLAKLLNQ L++HI++KLPDIK RLNTL
Sbjct: 290 QNKSVEEALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTL 349

Query: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419
           I QTEQEL+ YGD   ITKENRAGLVLQLMNKFAT FISSIDGTSSEISTKEL GGARIY
Sbjct: 350 IGQTEQELATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIY 409

Query: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479
           YIYN +FG +L  I+PT+NL++ DIRTAIRNSTGPRP+LFVPELAFDLLVKPQI+LLL+P
Sbjct: 410 YIYNTLFGKSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDP 469

Query: 480 SQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIH 539
           SQ+CVELVYEEL+KICH CG+PEL+RYPKL+SKL+EVVS+LLRERL PTRSYVESLIDIH
Sbjct: 470 SQRCVELVYEELMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIH 529

Query: 540 RAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDI 599
           +AYINTNHPNF +AT+AM++I+++RK  ++ +R QK  E EKQ  +++     +  KSD 
Sbjct: 530 KAYINTNHPNFPSATEAMAEIVEARKNKKQTERLQKQREYEKQLLLEQQQAEREMKKSD- 588

Query: 600 EPSIDGTE----LDSSKDAT------------KSKDTFLNYFFGKDKKSQ-LSLSNRDGR 642
             S+D TE    LDS   AT            +SKD+FLNYFFGK++KS    LS+R   
Sbjct: 589 --SVDETEQDLKLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRIDY 646

Query: 643 FSELNGYKXXXXXXXXXXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDI 702
               N Y                      A       + TERE+LECELIRRLIVSYF I
Sbjct: 647 NGSDNSYDIENLQIQDFKDKSADAHTKSEA-----ATEFTEREELECELIRRLIVSYFSI 701

Query: 703 VREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSL 762
           VREMIEDQ+PKA+MCLLVN+ K+SVQNRLVT+LY+ES+F+ELL+EDQTL QDRE  +  L
Sbjct: 702 VREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLL 761

Query: 763 E 763
           E
Sbjct: 762 E 762

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1066 bits (2756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/775 (67%), Positives = 625/775 (80%), Gaps = 44/775 (5%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120
           VTRRPLVLQLNNI A SPLI        +   A  ++ +L             N   G S
Sbjct: 61  VTRRPLVLQLNNIKADSPLI--------TAYTAEEAEPTLE------------NRLRGQS 100

Query: 121 SAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKI 180
            A          RD WGEFLH+PGRRFYDF+EIR EIE+ETARIAGKNKGIS+IPINLKI
Sbjct: 101 GA----------RDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKI 150

Query: 181 YSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNS 240
           YSPHVLNLTL+DLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNCIILAVSPANVDLVNS
Sbjct: 151 YSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNS 210

Query: 241 ESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQM 300
           ESLKLAR+VDPHG RTIGV+TKLDLMDSGTNA DIL+GKLYPL+LGFVGVVNRSQQDIQ 
Sbjct: 211 ESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQE 270

Query: 301 NKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLI 360
           NK+VE+AL +EEE+F++HP YRT+S +CGTR+LAK LNQ L++HI+EKLPDIK RLNTLI
Sbjct: 271 NKSVEDALAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLI 330

Query: 361 SQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYY 420
            QTEQEL+ YG +  I+ E+RAGLVLQ+MNKFAT F+SSI+GTSS+ISTKEL GGARIYY
Sbjct: 331 GQTEQELASYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYY 390

Query: 421 IYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS 480
           IYNNIFGN+LKSI+PT NL+I DIRTAIRNSTGPRP+LFVPELAFDLLVKPQIKLLL+PS
Sbjct: 391 IYNNIFGNSLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPS 450

Query: 481 QQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           Q+CVELVYEEL+KICH CG+P L+RYP+L++KLIEVVSDLLRERL PTRSYVESLIDIHR
Sbjct: 451 QRCVELVYEELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHR 510

Query: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600
           A+INTNHPNFL+AT+AM+DI ++R++ Q+N +    L+K++Q E+++     + +  +  
Sbjct: 511 AFINTNHPNFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPS 570

Query: 601 PSIDGT--------ELDSSKDATKSKDTFLNYFFGKDKKSQ----LSLSNRDGRFSELNG 648
           P +D          E +  +D  ++KD+FLNYFFGKD++ +    ++ S  D +   ++ 
Sbjct: 571 PKVDSDSTITSSDSEGEDERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDS 630

Query: 649 YKXXXXXXXXXXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIE 708
           +                      A   A HP+LTERE+LECELIRRLI+SYF IVREM+E
Sbjct: 631 F--FQQEADFMAMETLKIQDTVAAPVEAEHPELTEREELECELIRRLIISYFGIVREMVE 688

Query: 709 DQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLE 763
           DQIPKA+MC LVNFCK+ VQNRLV++LY+ES+FEELL+ED+TL QDR   +K LE
Sbjct: 689 DQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLE 743

>Kwal_33.15200
          Length = 773

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/780 (67%), Positives = 617/780 (79%), Gaps = 37/780 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GIDTLDLP+LAV+GSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTT---SLNDNN 117
           VTRRPLVLQLNNI+  SPLI          N+  +   +    ++  E  T    L  N 
Sbjct: 61  VTRRPLVLQLNNIAPDSPLI----------NDYDQETDTPQDHESVPEELTLEDHLRKNQ 110

Query: 118 GASSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPIN 177
           G              +DEWGEFLH+PGRRFY+F +IR+EIE+ETARIAGKNKGIS+IPIN
Sbjct: 111 GLEPQ---------GKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPIN 161

Query: 178 LKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDL 237
           LK++SP VLNLTLVDLPGITKVPIGEQP DIEKQIKNLIL+YVA PNCIILAVSPANVDL
Sbjct: 162 LKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDL 221

Query: 238 VNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQD 297
           VNSESLKLAR+VDPHG RTIGVITK+DLMDSGTNALDILSGKLYPL+LGFVG+VNRSQQD
Sbjct: 222 VNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQD 281

Query: 298 IQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLN 357
           IQ N+TVEEALN EE +F+RHPVYRT+S RCGTRYLAKLLNQ L++HI++KLPDIK RLN
Sbjct: 282 IQANRTVEEALNNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLN 341

Query: 358 TLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGAR 417
           TL+ QTEQEL+ YG  G ITKENRAGLVLQLMNKFA  FISSI+GTSS+ISTKEL GGAR
Sbjct: 342 TLMGQTEQELTTYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGAR 401

Query: 418 IYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLL 477
           IYYIYN+IFG++L+SI+PT NL+  DIRTAIRNSTGPRP+LFVPELAFDLLVKPQI LLL
Sbjct: 402 IYYIYNDIFGHSLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLL 461

Query: 478 EPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLID 537
           EPSQ+CVELVYEEL+KICH CG+PEL+RYPKL++KLIEVVS+LLRERL PTRSYVESLID
Sbjct: 462 EPSQRCVELVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLID 521

Query: 538 IHRAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKM--------LEKEKQNEIQENG 589
           IHRAYINTNHPNFL+AT+AMSDI ++++ NQE    + +        L  +   +  EN 
Sbjct: 522 IHRAYINTNHPNFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENH 581

Query: 590 TASQNSKSDIEPSI----DGTELDSSKDATKSKDTFLNYFFGKDKK--SQLSLSNRDGRF 643
             + + K+D   +       +E D      +SKD+FLNYFFGKD++        + + +F
Sbjct: 582 ILNTSKKADSGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQF 641

Query: 644 SELNGYKXXXXXXXXXXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIV 703
           S  N Y+                       E  + P+LTERE LECELIRRLIVSYF IV
Sbjct: 642 SNFNRYEQTEHQKHLANFENLKISDPVVE-ERNDTPQLTEREQLECELIRRLIVSYFGIV 700

Query: 704 REMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLE 763
           REMI+DQIPKA+MCLLVNF K+ +QNRLVT+LY+ES+FE+LL+EDQ L QDR+  +K L+
Sbjct: 701 REMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLD 760

>Scas_690.20
          Length = 755

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/771 (69%), Positives = 614/771 (79%), Gaps = 37/771 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY SGIDTLDLPILAVVGSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120
           VTRRPLVLQLNN+   S    EN      + + +      +G   NN+   SL+      
Sbjct: 61  VTRRPLVLQLNNLPKDSSQANEN------IGSDANPDPFSSGSTKNNQLEDSLS---FVE 111

Query: 121 SAIGG-SNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179
             I G +N  +  R EWGEFLHIPGRRFYDF+EIRREIE+ETAR+AGKNKGISK+PINLK
Sbjct: 112 DGINGQTNNNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLK 171

Query: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239
           I+SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNC+ILAVSPANVDLVN
Sbjct: 172 IFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVN 231

Query: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299
           SESLKLAREVDP G RTIGVITKLDLMDSGTNALDILSGKLYPLK GFVG+VNRSQQDIQ
Sbjct: 232 SESLKLAREVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQ 291

Query: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359
           +NK+V+EALN EEEYF RHP+YRT+S++CGTRYLAKLLN+ L++HIK+KLPDIKT+LNTL
Sbjct: 292 LNKSVQEALNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTL 351

Query: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419
           ++QTEQEL  YG +   TKENRA L+LQLMNKFAT+FISSI+G SS+I+TKEL GGARIY
Sbjct: 352 VTQTEQELYSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIY 411

Query: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479
           YIYNN+FG +LKSIDPTTNLT +DIRTAIRNSTGPRPTLFVPE AFDLLV+PQ+ LLLEP
Sbjct: 412 YIYNNVFGKSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEP 471

Query: 480 SQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIH 539
           SQ+CVELVYEEL+KICH CG+PEL RYP+LKS LIEVV DLL+ERL PTR YVESLIDIH
Sbjct: 472 SQRCVELVYEELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIH 531

Query: 540 RAYINTNHPNFLTATDAMSDIIQS--RKRNQENQRAQKMLEKEKQNEIQENGTASQNSKS 597
           +AYINTNHP+FL AT+A SDI++S   ++++EN+  + + EK       ENG + ++S S
Sbjct: 532 KAYINTNHPSFLKATEAYSDIMKSNQERKDKENKNTEVITEK-------ENG-SDRSSSS 583

Query: 598 DIEPSIDGTELDSSKDATKSKDTFLNYFFG---KDKKSQLSLSNRDGRF--SELNGYKXX 652
           +    IDG   + SK+A +SK  F + FF    +D    L+ ++ D      +LNG    
Sbjct: 584 EETGYIDGKN-NISKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLG 642

Query: 653 XXXXXXXXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIP 712
                                     P L+ERE LECELIRRLI+SYF I+REMIEDQIP
Sbjct: 643 NLHITENSQTTYDL-----------EPHLSEREQLECELIRRLIISYFGIIREMIEDQIP 691

Query: 713 KAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLE 763
           KAIM  LVN+CK+SVQNRLVT+LY+ESM EELLVEDQT+ QDR N  + LE
Sbjct: 692 KAIMFFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLE 742

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/764 (40%), Positives = 442/764 (57%), Gaps = 77/764 (10%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASS 121
           TRRPLVLQL N     P   E+      +N  +     LN   ++ +   S    N   S
Sbjct: 63  TRRPLVLQLIN---RRPKKSEH----AKVNQTANELIDLNINDDDKKKDESGKHQNEGQS 115

Query: 122 AIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIY 181
                   E  ++EWGEFLH+PG++FY+F EIR+EI  ET ++ G N GIS +PINL+IY
Sbjct: 116 --------EDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIY 167

Query: 182 SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSE 241
           SPHVL LTLVDLPG+TKVP+G+QPPDIE+QIK+++L Y++ PN IIL+V+ AN DL NS+
Sbjct: 168 SPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSD 227

Query: 242 SLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQMN 301
            LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  
Sbjct: 228 GLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHK 287

Query: 302 KTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLIS 361
           KT+ EAL  E ++F  HP Y + +H CGT YLAK LN  L+ HI++ LP+IK ++   + 
Sbjct: 288 KTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLK 347

Query: 362 QTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYYI 421
           + + EL   G     T ++ + +VL ++  F+  +   +DG + E+S++ELSGGARI Y+
Sbjct: 348 KYQNELINLGPE---TMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYV 404

Query: 422 YNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           ++  F N + S+DP   +   DIRT + NS+G  P+LFV   AF++LVK QI+   EPS 
Sbjct: 405 FHETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSL 464

Query: 482 QCVELVYEELVKICHK-CGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           + V LV++ELV++  +    P+ SRYP L+  +       L++   PT  +V  +I   +
Sbjct: 465 RLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQ 524

Query: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600
            YINT HP+ L  + AM                  ++ +EK +  Q             +
Sbjct: 525 TYINTAHPDLLKGSQAM------------------VMVEEKLHPRQVAVDPKTGKPLPTQ 566

Query: 601 PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKXXXXXXXXXX 660
           PS       S     + K  F   FF    K +L+         +  G            
Sbjct: 567 PS------SSKAPVMEEKSGFFGGFFSTKNKKKLAALESPPPVLKATG------------ 608

Query: 661 XXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV 720
                              ++TERE +E E+I+ LI SYF IV+  I D IPKA+M  L+
Sbjct: 609 -------------------QMTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLI 649

Query: 721 NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764
              K  +Q  L+ +LY +   EEL  E+   +Q R+   K +E+
Sbjct: 650 VKSKTDIQKVLLEKLYGKQDIEELTKENDITIQRRKECKKMVEI 693

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/766 (40%), Positives = 445/766 (58%), Gaps = 85/766 (11%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLN--DNNGA 119
           TRRPLVLQL N                      RS+ S    Q  ++    LN  D++  
Sbjct: 63  TRRPLVLQLIN---------------------RRSKKSDKEVQKASDQLLDLNMDDHSKK 101

Query: 120 SSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179
               G    +E   +EWGEFLH+P ++FY+F EIR EI  ET ++ G N GIS IPINL+
Sbjct: 102 EDPAGKKGQSEDNAEEWGEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLR 161

Query: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239
           IYSPHVL LTLVDLPG+TKVP+G+QPPDIEKQIK+++L Y++ PN IIL+V+ AN DL N
Sbjct: 162 IYSPHVLTLTLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLAN 221

Query: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299
           S+ LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+
Sbjct: 222 SDGLKLAREVDPEGTRTIGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIE 281

Query: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359
             KT+  AL  E+++F  HP Y + +H CGT YLAK LN  L+ HI++ LPDIK ++ + 
Sbjct: 282 HKKTIRAALQDEKKFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIEST 341

Query: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419
           + +   EL   G     T ++ + +VL ++  F+  +   +DG + E++++ELSGGARI 
Sbjct: 342 LKKYVNELESLGPE---TMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARIS 398

Query: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479
           ++++ IF N + S+DP   +   DIRT + NS+G  P+LFV   AF++LVK QI+   EP
Sbjct: 399 FVFHEIFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEP 458

Query: 480 SQQCVELVYEELVKICHKC-GTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDI 538
           S + V LV++ELV++  +    P+ +RYP L+  +     D L+E + PT  +V+ +I  
Sbjct: 459 SLRLVTLVFDELVRMLKQIISQPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKS 518

Query: 539 HRAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSD 598
            + YINT          A  D+++         +A  M+E++    +    TA       
Sbjct: 519 EQTYINT----------AHPDLLK-------GSQAMSMVEEK----LHPRPTAVDPKTGK 557

Query: 599 IEPSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKXXXXXXXX 658
             P+    +      A + K  F   FF    K +L+         +  G          
Sbjct: 558 PLPNQPPAK---PMPAVEEKSGFFGGFFSTKNKKKLAALESPPPVLKATG---------- 604

Query: 659 XXXXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCL 718
                                ++TERE +E E+I+ LI SYF+IV+  I D +PKA+M  
Sbjct: 605 ---------------------QMTERETMETEVIKLLINSYFNIVKRTIADLVPKALMLK 643

Query: 719 LVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764
           L+   K+ +Q  L+ +LY     +EL  E+   +Q R+   + +E+
Sbjct: 644 LIVKSKNDMQKVLLQKLYGNQDIDELTKENDITIQRRKECQRMIEI 689

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/756 (40%), Positives = 434/756 (57%), Gaps = 96/756 (12%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASS 121
           TRRPLVLQL                   +N   +     N   +  E   + +   G S 
Sbjct: 63  TRRPLVLQL-------------------INRRGKKGDKRNAHGDLLELDVAADQKTGQS- 102

Query: 122 AIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIY 181
                   E   +EWGEFLH PG++FY+F +IR+EI +ET ++ GKN GIS IPINL+IY
Sbjct: 103 --------EDNAEEWGEFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIY 154

Query: 182 SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSE 241
           SPHVL LTLVDLPG+TKVP+G+QP DIE QIKN+I+ Y++ PN IILAV+ AN DL NS+
Sbjct: 155 SPHVLTLTLVDLPGLTKVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSD 214

Query: 242 SLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQMN 301
            LKLAREVDP G RTIGV+TK+DLMD GT+ +DILSG++ PL+ G+V V+NR Q+DI+  
Sbjct: 215 GLKLAREVDPEGTRTIGVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESR 274

Query: 302 KTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLIS 361
           KT+ EALN E+ +F  HP Y + ++ CGT YLAK LN  L+ HI++ LP+IK ++   + 
Sbjct: 275 KTIREALNDEKRFFENHPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLK 334

Query: 362 QTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYYI 421
           + + EL   G     T ++   +VL ++  F+  +   +DG + E+S++ELSGGARI ++
Sbjct: 335 KYQAELLALGPE---TLDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFV 391

Query: 422 YNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           ++ IF   + ++DP   +   DIRT + NS+G  P+LFV   AF++LVK QI+   +PS 
Sbjct: 392 FHEIFKGGVYALDPFDQIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSL 451

Query: 482 QCVELVYEELVKICHK-CGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           + V L+++ELV+I  +    P+ +RYP L+  +       L+ER+ P   +V  +I   +
Sbjct: 452 RLVALIFDELVRILREIISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQ 511

Query: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600
            YINT HP+ L  + AM+ + +     Q + +  K L                       
Sbjct: 512 TYINTAHPDLLKGSQAMAMVEERLHPKQVDPKTGKSL----------------------P 549

Query: 601 PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKXXXXXXXXXX 660
           P++  T+  SS         F  +F  K+KK   +L                        
Sbjct: 550 PTVQHTDKGSS-------GIFGGFFASKNKKKLTALEAPPSVLKATG------------- 589

Query: 661 XXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV 720
                              ++TERE LE E+I+ LI SYF IV+  + D IPKA+M  L+
Sbjct: 590 -------------------QMTERETLETEVIKLLIESYFSIVKRTVADLIPKAVMLKLI 630

Query: 721 NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRE 756
              K+ +Q  L+ +LY     EEL  E+   +Q R+
Sbjct: 631 VKSKNDIQKILLEKLYGNQDIEELTKENDITIQRRK 666

>Scas_668.28
          Length = 722

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/764 (41%), Positives = 454/764 (59%), Gaps = 59/764 (7%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASS 121
           TRRPLVLQL  I+  S   KE      + N+ S+    L+   + ++     +D      
Sbjct: 63  TRRPLVLQL--INRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDADKKEAPASDKTKKGE 120

Query: 122 AIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIY 181
             G ++ +E   +EWGEFLH+PG++F++F EIR+EI  ET ++ G N GIS IPINL+IY
Sbjct: 121 K-GATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIY 179

Query: 182 SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSE 241
           SP+VL LTLVDLPG+TKVP+G+QPPDIEKQIKN++L Y++ PN IIL+V+ AN DL NS+
Sbjct: 180 SPYVLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSD 239

Query: 242 SLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQMN 301
            LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  
Sbjct: 240 GLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGK 299

Query: 302 KTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLIS 361
           KT+  AL  E+ +F  HP Y + +H CGT YLAK LN  L+ HI++ LPDIK ++   + 
Sbjct: 300 KTIRSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLK 359

Query: 362 QTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYYI 421
           + + EL   G     T ++   +VL ++  F+  +   +DG + E++++ELSGGARI ++
Sbjct: 360 KYQNELISLGPE---TMDSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFV 416

Query: 422 YNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           ++ +F N + S+DP   +   DIRT + NS+G  P+LFV   AF++LVK QIK   EPS 
Sbjct: 417 FHEVFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSL 476

Query: 482 QCVELVYEELVKICHKCGT-PELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           + V LV++ELV+I  +  T P+ +RYP L+  +     D L+E + PT  +V  +ID  +
Sbjct: 477 RLVNLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQ 536

Query: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600
            YINT HP+ L  +                 RA  M+E E+ +  ++     +  K    
Sbjct: 537 TYINTAHPDLLKGS-----------------RAMAMVE-ERLHPPRQIALDPKTGKP--L 576

Query: 601 PSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKXXXXXXXXXX 660
           P     + + S D   S+D   N FFG             G F+  N  K          
Sbjct: 577 PQQQQQQQNPSNDVLVSEDK--NGFFG-------------GFFTTKNKKKLAALESPPPV 621

Query: 661 XXXXXXXXXXXAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLV 720
                              ++TERE  E E+I+ LI SYF IV+  + D IPKA+M  L+
Sbjct: 622 LKATG--------------QMTERETTETEVIKLLIESYFGIVKRTVADIIPKALMLKLI 667

Query: 721 NFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEV 764
              +  +Q  L+ +LY     ++L  E++  +Q R+   + +++
Sbjct: 668 VKSRTDIQKVLLEKLYSSGQLKDLTKENELTIQRRKECNRMVDI 711

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 267/560 (47%), Positives = 370/560 (66%), Gaps = 34/560 (6%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASS 121
           TRRPLVLQL                   +N  ++  S+L   +N       L D N A  
Sbjct: 63  TRRPLVLQL-------------------INKRTKKDSTLQSAKNE------LLDLNVADD 97

Query: 122 AIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIY 181
              G   +E   +EWGEFLHIPG++FY+F +IR+EI  ET +  GKN GIS IPINL+IY
Sbjct: 98  QKKGQ--SEDNAEEWGEFLHIPGKKFYNFDQIRQEIVIETEKTTGKNAGISPIPINLRIY 155

Query: 182 SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSE 241
           SPHVL LTLVDLPG+TKVP+G+QP DIEKQIK+++L Y++ PN IIL+V+ AN DL NS+
Sbjct: 156 SPHVLTLTLVDLPGLTKVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSD 215

Query: 242 SLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQMN 301
            LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+ +
Sbjct: 216 GLKLAREVDPEGTRTIGVLTKVDLMDHGTDVIDILAGRVIPLRYGYIPVINRGQKDIEAH 275

Query: 302 KTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLIS 361
           KT+  AL  E+++F  HP Y + +H CGT YLAK LN  L+ HI++ LP+IK ++   + 
Sbjct: 276 KTIRAALEDEKKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLK 335

Query: 362 QTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYYI 421
           + + EL   G     T ++   +VL ++  F+  +   +DG + E+S++ELSGGARI ++
Sbjct: 336 KYQAELLSLGPE---TMDSPNSIVLSMITDFSKEYTGILDGEARELSSQELSGGARISFV 392

Query: 422 YNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           ++ IF N + ++DP   +   DIRT + NS+G  P+LFV   AF++LVK QI+   EPS 
Sbjct: 393 FHEIFKNGVNALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSL 452

Query: 482 QCVELVYEELVKICHK-CGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           + V LV++ELV+I  +    P+ SRYP L+  L       L+E + PT  +V  +I   +
Sbjct: 453 RLVSLVFDELVRILKQIISHPKYSRYPGLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQ 512

Query: 541 AYINTNHPNFLTATDAMSDI 560
            YINT HP+ L  + AM+ +
Sbjct: 513 TYINTAHPDLLKGSQAMATV 532

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%)

Query: 680 KLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRES 739
           ++TERE +E E+I+ LI SYF IV+  + D IPKAIM  L+   K+ +Q  L+ +LY   
Sbjct: 595 QMTERETMETEVIKLLIDSYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYGNQ 654

Query: 740 MFEELLVEDQTLMQDRENALKSLEV 764
              EL  E+   +Q R+   K +E+
Sbjct: 655 DIAELTKENDITIQRRKECHKMVEI 679

>Kwal_26.7924
          Length = 691

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 265/562 (47%), Positives = 366/562 (65%), Gaps = 39/562 (6%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVG+QSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLND--NNGA 119
           TRRPLVLQL N  +S                              N S +S ND    G 
Sbjct: 63  TRRPLVLQLVNKRSS----------------------------KGNTSQSSKNDLLELGN 94

Query: 120 SSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179
               GG +   +  DEWGEFLH+PG++F++F EIR+EI +ET +  GKN GIS +PINLK
Sbjct: 95  QEQKGGQSEDNV--DEWGEFLHLPGKKFFNFDEIRQEIVNETEKTTGKNAGISPVPINLK 152

Query: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239
           I SPHVL LTLVDLPG+TKVP+G+QP DIEKQIK+++L Y++ PN IIL+V+ AN DL N
Sbjct: 153 ICSPHVLTLTLVDLPGLTKVPVGDQPADIEKQIKDMLLRYISKPNAIILSVNAANTDLAN 212

Query: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299
           S+ LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+
Sbjct: 213 SDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIE 272

Query: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359
           + KT+  AL  E  YF  HP Y + +H CGT YLAK LN  L+ HI++ LPDIK ++   
Sbjct: 273 VKKTIRAALEDERRYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELT 332

Query: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419
           + + + EL   G     T ++   ++L ++  F+  +   +DG + E+S++ELSGGARI 
Sbjct: 333 LKKYQAELMSLGPE---TMDSPNSIILSMITDFSKEYTGILDGEAKELSSQELSGGARIS 389

Query: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479
           ++++ I+ N ++++DP   +   DIRT + NS+G  P+LFV   AF++LVK QI    EP
Sbjct: 390 FVFHEIYKNGVRALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQINRFEEP 449

Query: 480 SQQCVELVYEELVKICHK-CGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDI 538
           S + V LV++ELV+I  +    P+  RYP L+  +       L+E + PT S+V  +I  
Sbjct: 450 SLRLVSLVFDELVRILKQIISQPKYGRYPGLREAMSNYFIQFLKEAIIPTNSFVTDIIQA 509

Query: 539 HRAYINTNHPNFLTATDAMSDI 560
            + YINT HP+ L  + AM+ I
Sbjct: 510 EQTYINTAHPDLLKGSQAMAMI 531

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%)

Query: 680 KLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRES 739
           ++TERE +E E+I+ LI SYF+IV+  + D IPKA+M  L+   K+ +Q  L+ +LY   
Sbjct: 596 QMTERETMETEVIKLLIESYFNIVKRTVADVIPKAVMLKLIVKSKNDIQKILLEKLYGNQ 655

Query: 740 MFEELLVEDQTLMQDRENALKSLEV 764
              EL  E+   +Q R+   K  E+
Sbjct: 656 DIAELTKENDITIQRRKECHKMTEI 680

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  491 bits (1264), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 257/558 (46%), Positives = 361/558 (64%), Gaps = 37/558 (6%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASS 121
           TRRPL+LQL N        K   + ++ L+N     S+ NG QN + +            
Sbjct: 63  TRRPLILQLINRRVKKE-TKHATEELLDLDN-----SAANGGQNEDNA------------ 104

Query: 122 AIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIY 181
                       +EWGEF H+PG++ ++F+EIR+EI  ET +  GKN GIS +PI L++Y
Sbjct: 105 ------------EEWGEFGHLPGKKLFNFNEIRKEIVLETDKSTGKNAGISAVPITLRVY 152

Query: 182 SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSE 241
           SPHVL LTLVDLPG+TKVP+G+QP DIE+QIK++IL Y+  PN IILAV+PAN DL NS+
Sbjct: 153 SPHVLTLTLVDLPGLTKVPVGDQPADIERQIKDMILTYIKKPNAIILAVNPANADLANSD 212

Query: 242 SLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQMN 301
            LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PLK G++ V+NR Q+DI+ N
Sbjct: 213 GLKLAREVDPDGSRTIGVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQKDIEKN 272

Query: 302 KTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLIS 361
           KT+  AL  E+ +F  HP Y   +  CGT YL K LN  L+ HI++ LPDIK ++   + 
Sbjct: 273 KTIRSALEDEKRFFENHPSYSARALYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLK 332

Query: 362 QTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYYI 421
           + + EL   G     +  + + +VL ++  F+  +   +DG + E+++KELSGGAR+ ++
Sbjct: 333 KYQTELLSLGPE---SLSSSSSIVLSMITDFSKEYTGILDGEARELTSKELSGGARVSFV 389

Query: 422 YNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           ++ IF N + ++DP   +   DIRT + N +G  P+LFV   AF++LVK QI    +PS 
Sbjct: 390 FHEIFKNGVYALDPFDQIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSL 449

Query: 482 QCVELVYEELVKICHK-CGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540
           + V LV++ELV+I  +    P+ SRYP L+  +       L+E + PT  +V  +I   +
Sbjct: 450 RLVNLVFDELVRILKQIINQPKYSRYPSLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQ 509

Query: 541 AYINTNHPNFLTATDAMS 558
            YINT HP+ L  + AM+
Sbjct: 510 TYINTAHPDLLKGSQAMA 527

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%)

Query: 680 KLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRES 739
           ++TERE LE E+I+ LI SYF IV+  + D IPKA+M  L+   K+ +Q  L+ +LY   
Sbjct: 589 QMTEREKLETEVIKLLIDSYFSIVKRSVADFIPKAVMLKLIVKSKNDIQKILLEKLYSSE 648

Query: 740 MFEELLVEDQTLMQDRENALKSLEV 764
             +EL  E     Q R+   K + +
Sbjct: 649 NLDELTKESDLTTQRRKECQKMVNI 673

>Kwal_26.8613
          Length = 861

 Score =  167 bits (422), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 103/274 (37%), Positives = 150/274 (54%), Gaps = 59/274 (21%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPL 79
           DS   +L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N S S   
Sbjct: 201 DSSSASLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTSGS--- 257

Query: 80  IKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEF 139
                                      NE+T                           +F
Sbjct: 258 ---------------------------NETT--------------------------ADF 264

Query: 140 LHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITKV 199
             +      DF+E++R I  E       ++ +S  PI L I S  V +L+LVDLPG  +V
Sbjct: 265 PSLRAYNIKDFNEVKR-ILMELNMAVPSSEAVSADPIQLTIKSSRVPDLSLVDLPGYIQV 323

Query: 200 PIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIGV 259
              +QP +++ +I+ +   Y+A PN IILA+S A+VDL NS +L+ ++  DP G+RTIGV
Sbjct: 324 EAADQPYELKSKIRQVCETYLAEPN-IILAISAADVDLANSSALRASKVADPKGLRTIGV 382

Query: 260 ITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNR 293
           ITKLDL++    A +IL+ K YPLK+G+VGV+ +
Sbjct: 383 ITKLDLVEPA-RAKEILNSKKYPLKMGYVGVITK 415

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  161 bits (408), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 104/277 (37%), Positives = 148/277 (53%), Gaps = 65/277 (23%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L         
Sbjct: 215 DSSSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTL--------- 265

Query: 80  IKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEF 139
                                                      +   N+ EI  D     
Sbjct: 266 -------------------------------------------VNTPNSNEITAD----- 277

Query: 140 LHIPGRRFY---DFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGI 196
              P  R Y   DF E++R I  E       ++ +S+ PI L I +  V +L+LVDLPG 
Sbjct: 278 --FPALRVYNLQDFKEVKR-ILMELNMAVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGY 334

Query: 197 TKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRT 256
            +V   +QP +++ +I+ L   Y+A PN IILA+S A+VDL NS +L+ ++ VDP G RT
Sbjct: 335 IQVEAADQPLELKSKIRLLCEKYLAEPN-IILAISAADVDLANSAALRASKVVDPLGERT 393

Query: 257 IGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNR 293
           IGVITKLDL++    A +IL+ K YPLK+G+VGV+ +
Sbjct: 394 IGVITKLDLVEPA-KAREILNNKKYPLKMGYVGVITK 429

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  155 bits (393), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 147/277 (53%), Gaps = 65/277 (23%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPL 79
           D+    + LP + VVGSQSSGKSS+LE++VGRDFLP+G                   S +
Sbjct: 200 DTNTPGVTLPSIVVVGSQSSGKSSVLESIVGRDFLPKG-------------------SNM 240

Query: 80  IKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEF 139
           +   P  +  +N  S S+++ +                                      
Sbjct: 241 VTRRPIELTLVNTPSGSETTAD-------------------------------------- 262

Query: 140 LHIPGRRFY---DFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGI 196
              P  R Y   DF E++R I  E       ++ IS+ PI L I SP V +L+LVDLPG 
Sbjct: 263 --FPTHRIYNLKDFREVKR-ILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGY 319

Query: 197 TKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRT 256
            +V   +QP +++ +I+N+   Y+A PN IILA+S A+VDL NS +L+ ++  DP G+RT
Sbjct: 320 IQVEAADQPMELKSKIRNVCQKYLAEPN-IILAISAADVDLANSAALRASKLADPQGLRT 378

Query: 257 IGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNR 293
           IGVITKLDL++  + A D+L  K YPLK+G+VGV+ +
Sbjct: 379 IGVITKLDLVEP-SAARDLLMNKKYPLKMGYVGVITK 414

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  152 bits (384), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 147/275 (53%), Gaps = 59/275 (21%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG+DFLP+GT +VTRRP+ L L N   S  +
Sbjct: 213 DSTSANLALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVNTPTSQEV 272

Query: 80  IKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEF 139
             + P   M + N       L  F+      T +N                         
Sbjct: 273 TADFP--TMRIYN-------LKDFKEVKRILTEMN------------------------- 298

Query: 140 LHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITKV 199
           + +P         I+  I+S            S++P           +L+LVDLPG  +V
Sbjct: 299 MAVPSTEAVSDDPIQLTIKS------------SRVP-----------DLSLVDLPGYIQV 335

Query: 200 PIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIGV 259
              +QP +++ +I+ L   Y+  PN IILA+S A+VDL NS +L+ ++  DP G+RTIGV
Sbjct: 336 EAVDQPIELKSKIRQLCDKYLEEPN-IILAISAADVDLANSAALRASKVADPQGLRTIGV 394

Query: 260 ITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRS 294
           +TKLDL+D+ T A  IL+ + YPLK+G+VGV+ +S
Sbjct: 395 VTKLDLVDAKT-ARAILNNRKYPLKMGYVGVITKS 428

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 102/156 (65%), Gaps = 6/156 (3%)

Query: 142 IPGRRFY---DFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITK 198
            P  R Y   DF E++R + +E       ++ +S+ PI L I S HV +L+LVDLPG  +
Sbjct: 276 FPSLRVYNMKDFREVKRML-TELNLAVPASEAVSEEPIQLTIKSAHVPDLSLVDLPGYIQ 334

Query: 199 VPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIG 258
           V   +QP +++ +I+ L   Y+A PN IILA+S A+VDL NS +L+ ++  DP G+RTIG
Sbjct: 335 VEAADQPMELKSKIRMLCDKYLAEPN-IILAISAADVDLANSSALRASKVADPQGLRTIG 393

Query: 259 VITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRS 294
           VITKLDL+ S   A  IL+ + YPL +G+VGV+ +S
Sbjct: 394 VITKLDLV-SAEEARKILTNRKYPLTMGYVGVITKS 428

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNN 72
           DS    L LP + V+GSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L N
Sbjct: 213 DSASANLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVN 265

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 101/160 (63%), Gaps = 6/160 (3%)

Query: 142 IPGRRFY---DFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITK 198
            P  R Y   DF E++R +  E       ++ +S+ PI L I S  V +L+LVDLPG  +
Sbjct: 286 FPSMRLYNIKDFKEVKRML-MELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQ 344

Query: 199 VPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIG 258
           V   +QP +++ +I++L   Y+  PN IILA+S A+VDL NS +LK ++  DP G+RTIG
Sbjct: 345 VEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIG 403

Query: 259 VITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDI 298
           VITKLDL+D    A  IL+ K YPL +G+VGV+ ++   I
Sbjct: 404 VITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSI 442

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 56/88 (63%), Gaps = 14/88 (15%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQL------NNI 73
           DS    L LP + V+GSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L      NN+
Sbjct: 223 DSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNV 282

Query: 74  SASSPLI--------KENPDLIMSLNNA 93
           +A  P +        KE   ++M LN A
Sbjct: 283 TADFPSMRLYNIKDFKEVKRMLMELNMA 310

>Scas_605.17
          Length = 891

 Score =  123 bits (308), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 142 IPGRRFY---DFSEIRREIESETARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITK 198
            P  R Y   DF E++R I  E        + +S+ PI L I S  + +L+LVDLPG  +
Sbjct: 277 FPSLRTYNLKDFKEVKR-ILMELNMAVPTTEAVSEEPIQLTIKSSSIPDLSLVDLPGYIQ 335

Query: 199 VPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIG 258
           V   +QP +++ +I+ L   Y+  PN IILA+S A+VDL NS +L+ A+  DP G+RTIG
Sbjct: 336 VEAADQPTELKTKIRQLCDKYLNEPN-IILAISAADVDLANSSALRAAKMADPQGLRTIG 394

Query: 259 VITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRS 294
           VITKLDL+ S   A +IL+ + YPLK+G+VGV+ +S
Sbjct: 395 VITKLDLI-SPEAARNILNNRKYPLKMGYVGVITKS 429

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N    +  
Sbjct: 214 DSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTPGVNET 273

Query: 80  IKENPDL 86
             + P L
Sbjct: 274 TADFPSL 280

>Kwal_56.22559
          Length = 800

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 17/82 (20%)

Query: 426 FGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQQCVE 485
           F NTL     TTN+ ++   +AIR                     P++ ++L+P +  V+
Sbjct: 532 FINTLGVTTSTTNIQVVRFESAIRKYLEDN--------------TPRLMMILDPVEVVVD 577

Query: 486 LV---YEELVKICHKCGTPELS 504
            +   YEELVKI ++ GTPE  
Sbjct: 578 NLPDDYEELVKIPYRPGTPEFG 599

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          LD  +++V GSQSSGKS++L  L   +F
Sbjct: 35 LDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>YCR095C (YCR095C) [618] chr3 complement(288166..289254) Member of
           the putative tyrosine phosphatase family, has low
           similarity to uncharacterized C. albicans Orf6.7695p
           [1089 bp, 362 aa]
          Length = 362

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 24/109 (22%)

Query: 21  SGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPLI 80
           S ++TL+L     +G Q   K         +DF  R +     + +VL++++ SA++  +
Sbjct: 27  SFLETLNLKTAIFIGGQEPSK-------FFKDFFTRSS----IKWIVLRMSDFSAAAVPV 75

Query: 81  KENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGASSAIGGSNAT 129
           K            S S S+ N + NNN ST SL +    S+A G  N+T
Sbjct: 76  K------------SSSVSNANLYSNNN-STLSLQEEKKKSTANGSQNST 111

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          LD  +++V GSQSSGKS++L  L    F
Sbjct: 41 LDYHVISVFGSQSSGKSTLLNALFNTKF 68

>ADR018C [1759] [Homologous to ScYIR006C (PAN1) - SH]
           (735263..738874) [3612 bp, 1203 aa]
          Length = 1203

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 561 IQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIEPSIDGTELDSSKDATKSKDT 620
           +Q + R QE  RAQ+    ++Q   QE   A + +K+D           +S+++T+S + 
Sbjct: 837 VQEQARAQEQARAQEQARAQEQARAQEQARAQEQAKAD----------PASRESTRSPEE 886

Query: 621 FLNY 624
           F  +
Sbjct: 887 FARW 890

>CAGL0L04532g 522091..524478 highly similar to sp|P13188
           Saccharomyces cerevisiae YOR168w GLN4, hypothetical
           start
          Length = 795

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 25/86 (29%)

Query: 426 FGNTLKSIDPTTNLTILDIRTAIR----NSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           F NTL     TTN+ ++   +AIR    +ST                  P++ ++L+P +
Sbjct: 528 FINTLGVTTSTTNIQVVRFESAIRKYLEDST------------------PRLMMILDPIE 569

Query: 482 QCVELV---YEELVKICHKCGTPELS 504
             VE +   YEELV I ++ GT E  
Sbjct: 570 VVVENLPEDYEELVTIPYRAGTKEFG 595

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          +D  +++V GSQSSGKS++L  L    F
Sbjct: 37 VDYHVISVFGSQSSGKSTLLNALFNTQF 64

>KLLA0D07898g 675451..678831 similar to sp|P53893 Saccharomyces
           cerevisiae YNL163c translation elongation factor eEF4,
           start by similarity
          Length = 1126

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 91/224 (40%), Gaps = 37/224 (16%)

Query: 418 IYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLL 477
           I+ IY+NI    L   DP T   +  I  A+     PR          D+  K    LL 
Sbjct: 302 IWMIYDNI----LNQHDPDT---LTKITNALNIKIQPR----------DIRSKDYKNLLR 344

Query: 478 EPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVS------DLLR-----ERLF 526
               Q V +    L+ +  K  +P  S+  ++ + L   V       DL+      +++ 
Sbjct: 345 TIMGQWVPVSTAVLLSVVEKLPSPVDSQRERIDTLLGNSVGYELTDKDLIEGVRKCDKIA 404

Query: 527 PTRSYVESLIDIHRAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQK---MLEKEKQN 583
           P  +YV  ++ I +  +         + DA+  I +SRK  +E  +A K   ML+  K+ 
Sbjct: 405 PVCAYVSKMLSIPKDELPLQAAGGPLSIDAV--IARSRKAREEAMKAAKQAEMLDTMKKK 462

Query: 584 EIQENGTASQNSKSDIEPSIDGT---ELDSSK-DATKSKDTFLN 623
            + ++ T  QN     E   D T   ++D  K +A KSK    N
Sbjct: 463 SLDQDETHKQNKDDAFERVFDSTVTPDIDVIKANAIKSKQAVRN 506

>Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement
          Length = 577

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 33  VVGSQSSGKSSILETLVGRDF 53
           VVG  +SGKSS+LE+ +GR F
Sbjct: 364 VVGKPNSGKSSLLESFLGRSF 384

>Scas_657.9
          Length = 811

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 33/120 (27%)

Query: 426 FGNTLKSIDPTTNLTILDIRTAIR----NSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQ 481
           F NTL     TTN+ +     +IR    +ST                  P++  +L+P +
Sbjct: 541 FINTLGVTTSTTNIQVARFENSIRKYLEDST------------------PRLMFILDPIE 582

Query: 482 QCVELV---YEELVKICHKCGTPELS--------RYPKLKSKLIEVVSDLLRERLFPTRS 530
             V+ +   YEE++ I ++ GTPE          R+   +S   EV  D    RL PT++
Sbjct: 583 IVVDNLPEDYEEILSIPYRAGTPEFGDRTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQN 642

>Scas_690.5
          Length = 233

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 44/108 (40%), Gaps = 23/108 (21%)

Query: 324 MSHRCGTR-YLAKLLNQTLISHIKEKLPDIKTRLNTLISQTEQELSQYGDT--------- 373
           + H  G R Y+  LL Q          PD K R+  + + T+QELS  G++         
Sbjct: 134 ICHLSGYREYVLALLPQLETLDFSRVTPDQKERIGKVSTVTKQELSSEGESAKRDKSIEM 193

Query: 374 -----GDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGA 416
                G +T E R  L LQL    +   IS ++        K LSGG 
Sbjct: 194 MNFVVGKMTAERRKELKLQLAQATSLQEISKLE--------KLLSGGV 233

>AGR259C [4570] [Homologous to ScYOR168W (GLN4) - SH]
           (1227069..1229465) [2397 bp, 798 aa]
          Length = 798

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 426 FGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQQCVE 485
           F NTL     TTN+ ++   +AIR         ++ +    L+       +L+P +  V+
Sbjct: 532 FINTLGVTTSTTNIQVVRFESAIRK--------YLEDTTARLM------FVLDPIEVIVD 577

Query: 486 LV---YEELVKICHKCGTPELS--------RYPKLKSKLIEVVSDLLRERLFPTRS 530
            +   YEELV I ++ GTPE          R+   +S   E  SD    RL P +S
Sbjct: 578 NLPEDYEELVSIPYRPGTPEFGERTVPFSKRFYIERSDFSEDTSDKEFFRLTPAQS 633

>Kwal_27.12245
          Length = 767

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 527 PTRSYVESLIDIHRAYINTNHPNFLTATDAMSDIIQSR-----KRNQENQRAQKMLEKEK 581
           P   +VES+  +    I+    +F T      D +Q R     ++ +E Q  + + + EK
Sbjct: 313 PVHKFVESVNKVDSTSISIADGSFKTRQPVDQDAVQRRLEYEERQKKEQQPVEPLQQHEK 372

Query: 582 QNEIQENGTASQNSK 596
            NE QE G +S +++
Sbjct: 373 SNEHQEGGASSSHTE 387

>CAGL0F06347g 625184..627916 similar to sp|P37296 Saccharomyces
           cerevisiae YMR054w STV1, start by similarity
          Length = 910

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%)

Query: 318 HPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLISQTEQELSQYGDTGDIT 377
           H V+R  ++   T  L +   Q L++       +++T  NTL   +E   S+Y     + 
Sbjct: 394 HAVFRRETYIYATLNLFRQETQGLVAEGWIPYEELQTLKNTLKDYSESIGSEYTTVISVI 453

Query: 378 KENRAGLVLQLMNKFATAFISSIDG 402
             NR+      +NKF  AF S +D 
Sbjct: 454 ITNRSPPTYHRVNKFTQAFQSIVDA 478

>Scas_707.11
          Length = 1038

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 341 LISHIKEKLPDIKTRLNTLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSI 400
           L+S+  +   D K +   L++  E  LSQY D   I K+ +A    +  N F TA +S+ 
Sbjct: 512 LVSYAADSSIDSKLKPFHLLNFEEDVLSQY-DFIIIEKDMKA---FEQENTFLTAVVSTT 567

Query: 401 -DGTSSEISTKELSGGARIYYIYNNIFG-NTLKSIDPTTNLTILDIRTAIRNSTGPRPTL 458
            D   + +S  +L+     + + ++I    TL+  +   +L    + T I +S+GP P +
Sbjct: 568 RDEKIAHVSPWKLAVSDIKFKLKSDIVAIETLRFSNLWDSLIAYKLETVISSSSGPDPFI 627

Query: 459 FVP 461
           F P
Sbjct: 628 FEP 630

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,065,142
Number of extensions: 1080263
Number of successful extensions: 5526
Number of sequences better than 10.0: 109
Number of HSP's gapped: 5539
Number of HSP's successfully gapped: 125
Length of query: 764
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 655
Effective length of database: 12,822,747
Effective search space: 8398899285
Effective search space used: 8398899285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)