Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D05786g42341722080.0
YLL002W (RTT109)4364139291e-122
KLLA0F12914g4304258181e-106
Kwal_33.151954284228051e-104
Scas_629.204404057981e-102
AAL173C4203956952e-87
Sklu_2121.275632730.65
Scas_552.472067691.9
Kwal_56.2370732054637.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D05786g
         (417 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   855   0.0  
YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   362   e-122
KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   319   e-106
Kwal_33.15195                                                         314   e-104
Scas_629.20                                                           311   e-102
AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   272   2e-87
Sklu_2121.2 YLL029W, Contig c2121 3265-5535                            33   0.65 
Scas_552.4                                                             31   1.9  
Kwal_56.23707                                                          29   7.5  

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/417 (98%), Positives = 411/417 (98%)

Query: 1   MLQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIKTEHLFCLAYKGRIFY 60
           MLQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIKTEHLFCLAYKGRIFY
Sbjct: 1   MLQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIKTEHLFCLAYKGRIFY 60

Query: 61  GLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYL 120
           GLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYL
Sbjct: 61  GLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYL 120

Query: 121 HRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKEL 180
           HRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKEL
Sbjct: 121 HRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKEL 180

Query: 181 VTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIRI 240
           VTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIRI
Sbjct: 181 VTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIRI 240

Query: 241 PGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRIQ 300
           PGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRIQ
Sbjct: 241 PGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRIQ 300

Query: 301 TTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNYI 360
           TTSLDTFWTELQERQEFKL      MGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNYI
Sbjct: 301 TTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNYI 360

Query: 361 TGEEYDTEEGALESYQNVNDYLSREGTSLLTVTGNADYSKFKQNRTTTSTPVVVNTL 417
           TGEEYDTEEGALESYQNVNDYLSREGTSLLTVTGNADYSKFKQNRTTTSTPVVVNTL
Sbjct: 361 TGEEYDTEEGALESYQNVNDYLSREGTSLLTVTGNADYSKFKQNRTTTSTPVVVNTL 417

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  362 bits (929), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 191/413 (46%), Positives = 263/413 (63%), Gaps = 17/413 (4%)

Query: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLV--NNTSKQNRATTIKTEHLFCLAYKGRIF 59
           L   L  VLP    FE L LQS P E+  +V  N   K+   +TIKT+H F L ++G++F
Sbjct: 3   LNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGKVF 62

Query: 60  YGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYY 119
           + LE+YVY+T   + +    ERL+FVSKADTNGYC+ RV+++ +T  ++ ++LSI+P+YY
Sbjct: 63  FSLEVYVYVTLWDEAD---AERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYY 119

Query: 120 LHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHN------LIEPEIFNAFYTK 173
           L +V P  R YKK     LI+ A+   + L+ILA RL+         +  P      Y  
Sbjct: 120 LQKVKPAIRSYKKIS-PELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLS 178

Query: 174 FHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNK 233
           F   +E++TKI LFTRPA QYLFP+SSKN  KH L+G+ L+KWW  +LD LL+  F  N 
Sbjct: 179 FTCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQ-ND 237

Query: 234 TKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQL 293
           T+AK+RIPGED  R R Y   +K  +W  GDIF+  ++   +  IP+FPDDPK+RF+ QL
Sbjct: 238 TQAKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQL 297

Query: 294 FEENRIQTTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTN--YKPSTDVYRCRSKR 351
            EE+R+   SL +FW ELQERQEFKL      MGISG Y + T   +  S DV   +S++
Sbjct: 298 AEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISG-YSLATPSLFPSSADVIVPKSRK 356

Query: 352 QFHCIKNYITGEEYDTEEGALESYQNVNDY-LSREGTSLLTVTGNADYSKFKQ 403
           QF  IK YITGEEYDTEEGA+E++ N+ D+ L R  T+L ++TG  ++ +  Q
Sbjct: 357 QFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQ 409

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  319 bits (818), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/425 (42%), Positives = 250/425 (58%), Gaps = 14/425 (3%)

Query: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLV---NNTSKQNRAT--TIKTEHLFCLAYKG 56
           L+  +K+ LP    FEI++LQS P E++P+          N  T  TIKT+H   L ++ 
Sbjct: 3   LECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFEE 62

Query: 57  RIFYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINP 116
           ++ + LE+ VY + N  N     ERL+FVSKADTNGYCD+R++I  +T  +I Y+L+I+P
Sbjct: 63  KVVFALEIVVYFSLNSANN-GPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121

Query: 117 DYYLHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIF---NAFYTK 173
            +YL  V P  R  K      +I ++T+ ++AL+IL++R  +   I   +       Y  
Sbjct: 122 GHYLRAVKPLIR--KALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPDQDLYVS 179

Query: 174 FHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNK 233
           F    E+VTK++LFTR   QYLF NSSKNP KH L GD LLKWW  ++D ++V DF+ NK
Sbjct: 180 FPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD-NK 238

Query: 234 TKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQL 293
           TKA ++IPGE+K     Y        WT GDIFS++  D  +  IP+FPDDPK RF+  L
Sbjct: 239 TKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHL 298

Query: 294 FEENRIQTTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTNYKPSTDVYRCRSKRQF 353
             + RI   ++ TFWTELQ RQEF+L      +G+SG Y    N    TD+    SK+ F
Sbjct: 299 ISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNF 358

Query: 354 HCIKNYITGEEYDTEEGALESYQNVNDYLSRE-GTSLLTVTGNADYSKFKQNRTTTSTPV 412
             +KNYITGEEYDTEEGA E+Y N+ D       T ++ V GN  +      R   +T  
Sbjct: 359 KNLKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIGN-HHKIATTKRPEINTIN 417

Query: 413 VVNTL 417
           V+NTL
Sbjct: 418 VINTL 422

>Kwal_33.15195
          Length = 428

 Score =  314 bits (805), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/422 (41%), Positives = 250/422 (59%), Gaps = 21/422 (4%)

Query: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQN-RATTIKTEHLFCLAYKGRIFY 60
           L+ +L++VLPQD   E+ HLQSPP E+ P+V   S+ N +   +K +H F L    ++FY
Sbjct: 6   LEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANGKQQVVKIQHFFGLCTDNKLFY 65

Query: 61  GLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYL 120
           GLE++VY+   H   V+K   ++F+SKADTNGYC  R++IK +T  LI YV S++P YYL
Sbjct: 66  GLEVFVYVVVQHSKVVDK---ILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYL 122

Query: 121 HRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKEL 180
            +VIP  R   +    N ITK+T +++AL+I+ +R        P+I N  YT+F      
Sbjct: 123 VKVIPMNRT--RQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISN-LYTQFEKCDPG 179

Query: 181 VT-KIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIR 239
            T KI LFTR    YLF  SSKNP KH L G+ LL WW S++D +L  +F  + TKA+++
Sbjct: 180 WTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFT-SDTKARLQ 238

Query: 240 IPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRI 299
           IPGE+K    +Y N  K   W  GDIF+   +D  I  IP+FPDDPK RF++QL +ENR 
Sbjct: 239 IPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRA 298

Query: 300 QTTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNY 359
           +   +  FWTELQ +QEF++      +GI G            ++   +S + F+ IK Y
Sbjct: 299 KKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTY 358

Query: 360 ITGEEYDTEEGALESYQNVNDYLS-REGTSLLTVT-----------GNADYSKFKQNRTT 407
           ITGEEYDT +GA E+  N+ D+++ R G SLL V            G+ D+S+   N   
Sbjct: 359 ITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPVNHLN 418

Query: 408 TS 409
           TS
Sbjct: 419 TS 420

>Scas_629.20
          Length = 440

 Score =  311 bits (798), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/405 (42%), Positives = 245/405 (60%), Gaps = 20/405 (4%)

Query: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNT-SKQNRA--TTIKTEHLFCLAYKGRI 58
           L  +L  VLP+   FE+LHLQ  P+++  +V    + Q RA   T+K +H F L +  + 
Sbjct: 9   LDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKKA 68

Query: 59  FYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDY 118
            + LE+YVY+T +  +      +L+FVSKADT+GYCDI++ +  +T   ++Y++S++P +
Sbjct: 69  VFALEIYVYLTLSSLHNT----KLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLH 124

Query: 119 YLHRVIPKER--DYKKSGRTNLITKATNSRKALKILADR--LQNHNLIEPEIFNAFYTKF 174
           YL +V P  R  D+ +S    LI K T+  ++L+ILA R  L  H     + F       
Sbjct: 125 YLRKVKPLRRVNDHDES----LIRKGTSVERSLRILAVRVDLSPHPCQNTDKFYITRNDV 180

Query: 175 HSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKT 234
                 VTKI LFTRPAD YLF  SSKN  KH L+GD LLKWW  ++D L+ +DF+ N  
Sbjct: 181 GGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNV 240

Query: 235 KAKIRIPGEDKYRFRR-YTNA--LKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMK 291
            A++R+PGED  R  R Y N    +   W  GDIF    +D  +  +P+FPDDPKSRF++
Sbjct: 241 SARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIR 300

Query: 292 QLFEENRIQTTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTNYKPS-TDVYRCRSK 350
            L +ENRI  T+L T+W ELQERQEFKL      +G+ G  +   +Y P+  +++ C S+
Sbjct: 301 HLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSR 360

Query: 351 RQFHCIKNYITGEEYDTEEGALESYQNVNDYLS-REGTSLLTVTG 394
           RQF  I++Y+ GEEYD EEG LESY NV DYL  R    LL ++G
Sbjct: 361 RQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSG 405

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  272 bits (695), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/395 (39%), Positives = 220/395 (55%), Gaps = 13/395 (3%)

Query: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIKTEHLFCLAYKGRIFYG 61
           L+ +L E LP    F++LHLQSP +E  PL   +      TTI  +H F L+   ++FY 
Sbjct: 3   LKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCS--PTTIAAQHFFTLSNNSKVFYA 60

Query: 62  LELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYLH 121
           L++ VYI      E    +R++FVSKADTNGYCD+RV+++  T  L++++LSI+P +YL 
Sbjct: 61  LQVVVYICI----EGTSGDRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSIDPSHYLQ 116

Query: 122 RVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNL-IEPEIFNAFYTKFHSGKEL 180
           RV  +      +    LIT ATN+  AL+ILA R +  NL +      A YT F    + 
Sbjct: 117 RV--RRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQY 174

Query: 181 VTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIRI 240
            T++ALFTR    YLF  S++NP KH L GD LL+WW + +D+LLV+ F+   T A + I
Sbjct: 175 TTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFD-PATDAALLI 233

Query: 241 PGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRIQ 300
           PGED      Y   ++   W  G +F  +  D  +  IP FPDDPK RF+  L  E R  
Sbjct: 234 PGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGR-- 291

Query: 301 TTSLDTFWTELQERQEFKLXXXXXXMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNYI 360
             SL  FWTEL  RQEF+L      +G +G+Y          D+    S   +  +K+Y+
Sbjct: 292 NPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTGPCARPAPEDLLCPASPADYVHVKHYV 351

Query: 361 TGEEYDTEEGALESYQNVND-YLSREGTSLLTVTG 394
           T EEY T  GA E+++N+ D  L R G ++  V G
Sbjct: 352 TAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRG 386

>Sklu_2121.2 YLL029W, Contig c2121 3265-5535
          Length = 756

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 280 MFPDDPKSRFMKQLFEENRIQTTSLDTFWTEL 311
           +F DDP +  +KQ FEEN+I   S  + W  L
Sbjct: 381 LFTDDPYNDKIKQYFEENKITVKSYSSIWEAL 412

>Scas_552.4
          Length = 720

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 221 LDNLLVSDFNLNKTKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPM 280
           +DN+ ++  NLNK +  I I  +D   F   T  +K  +  +G+ +SD D  + ++ + +
Sbjct: 511 IDNIDITSINLNKLRRSINIIPQDPTLF---TGTIKSNLDPYGE-YSDEDMFTALRRVNL 566

Query: 281 FPDDPKS 287
            P+D  S
Sbjct: 567 VPEDVSS 573

>Kwal_56.23707
          Length = 320

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 133 SGRTNLITKATNSRKALKILADRLQNHNLIEPEIFNAFYTKFHSGKELVTKIAL 186
           S  T L+ K   S K+L +L+D +Q+H L   + +   +    SGKE VT + L
Sbjct: 164 SNDTKLLMKLKQSTKSLPVLSDPIQHHAL--DDAYKVCWA-LCSGKEAVTALDL 214

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,479,163
Number of extensions: 662057
Number of successful extensions: 1806
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1811
Number of HSP's successfully gapped: 10
Length of query: 417
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 313
Effective length of database: 12,995,837
Effective search space: 4067696981
Effective search space used: 4067696981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)