Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D04202g49949125660.0
Scas_671.1248648916810.0
YIL090W49150216650.0
Sklu_2251.1047948814860.0
Kwal_27.1150047549113660.0
ADL208W50251012491e-169
KLLA0E08173g48649412141e-163
KLLA0F01012g55643673.6
YLR004C52382656.8
YNR056C (BIO5)56129647.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D04202g
         (491 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces c...   993   0.0  
Scas_671.12                                                           652   0.0  
YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknow...   645   0.0  
Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement     577   0.0  
Kwal_27.11500                                                         530   0.0  
ADL208W [1533] [Homologous to ScYIL090W - SH] complement(337120....   485   e-169
KLLA0E08173g complement(740213..741673) similar to sp|P40499 Sac...   472   e-163
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...    30   3.6  
YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member...    30   6.8  
YNR056C (BIO5) [4639] chr14 complement(731615..733300) Transmemb...    29   7.9  

>CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces
           cerevisiae YIL090w, start by similarity
          Length = 499

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/491 (100%), Positives = 491/491 (100%)

Query: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60
           MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120
           ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180
           DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240
           ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300
           FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPS 360
           NRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPS
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPS 360

Query: 361 SIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLL 420
           SIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLL
Sbjct: 361 SIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLL 420

Query: 421 YWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFW 480
           YWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFW
Sbjct: 421 YWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFW 480

Query: 481 TVLVYANELIG 491
           TVLVYANELIG
Sbjct: 481 TVLVYANELIG 491

>Scas_671.12
          Length = 486

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/489 (66%), Positives = 386/489 (78%), Gaps = 10/489 (2%)

Query: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62
           +I+    R IRI SA  YL+ TL+SIPISFKIGGL CGL+FTV+LF LY +STTLS+ AR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122
           +  +R ++  T+ILYY QH +IA LL+LFLSGFSNE+ +  L          P  S  D+
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGN-----KPIDSIADI 115

Query: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182
            K  +  +T A    NW LYYYY++F VQPWQ++LSYSTPFFTL EGFFTILAIQAIGET
Sbjct: 116 FKKNVASSTQA----NWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGET 171

Query: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242
           NKWL YE+NSNTW+I+SLL SGGVIT SLYYLYRIYVTPIW+L++Q+ASLLGF LS+V  
Sbjct: 172 NKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGG 231

Query: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302
           LG+YGI++ KGSVIESS+FFAYIVRCIYEISPKLAT ATEEIL++ K+VWQ HQ NL + 
Sbjct: 232 LGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSP 291

Query: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSI 362
           +NLL+YYHNVVLKN E +WESF +  +  + +    R      P+WK  K FT++VPSSI
Sbjct: 292 NNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSI 351

Query: 363 VELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYW 422
            EL  VTYKMA ES+SPAVIVNLCFR+LIFYSATRIIPALQR    E R+SRRI+K+LYW
Sbjct: 352 NELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYW 411

Query: 423 YSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFWTV 482
           YSPC+LIAMY HLILQYSGELK ELCLWGC S  F S DQP+I+ DSW FWNWCNIF+T+
Sbjct: 412 YSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPS-DQPKIIVDSWGFWNWCNIFFTI 470

Query: 483 LVYANELIG 491
           LVYA+ELIG
Sbjct: 471 LVYASELIG 479

>YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.4010p [1476 bp, 491 aa]
          Length = 491

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/502 (66%), Positives = 397/502 (79%), Gaps = 25/502 (4%)

Query: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60
           M  +++   +S RI +A  YL+ TL+SIPISFK+GGL+CGLSFTVTLF LY I+TTL+VL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120
           ARR   R Y+F T+ LYYSQH +IA LL+LFLSGFSN+E    L     Y E +   SFL
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLK--NKYNESE---SFL 115

Query: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180
           + LK+ +       N  N+ LYYYY++F+VQPWQ++L+ STPFFTL EGFFTILAIQA+G
Sbjct: 116 EALKNSL-----NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVG 170

Query: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240
           ETN+WLS ++NSNTWII+SLL SGGVIT SLYYLYRIYVTPIW L+IQ+ASLLG VLS+V
Sbjct: 171 ETNRWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMV 230

Query: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300
             LGLYGI+S+KGSVIESSLFFAYIVRCIYEISPKLAT AT+EIL+L KDVWQ HQRNL 
Sbjct: 231 CGLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLP 290

Query: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSR-----------SLNAMEKIRFWLDVTPVWK 349
             DNLL Y+HNV+LKNAE++W SFI PR R           S+ + EK+   L   P WK
Sbjct: 291 TADNLLCYFHNVILKNAEVLWGSFI-PRGRKKTGDFHDKLISILSFEKVS--LISKPFWK 347

Query: 350 FFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKE 409
           FFKNFT SVP SI E   VT KMASES+SPA+++NLCFR+L+FYSATRIIPALQR + K+
Sbjct: 348 FFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQ 407

Query: 410 QRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDS 469
            R+SRRI+K LYWYSPC+LIAMYTHLILQYSGELK++LC+WGC+  WFG  DQP I+ DS
Sbjct: 408 LRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGV-DQPEIIVDS 466

Query: 470 WSFWNWCNIFWTVLVYANELIG 491
           W FWNWCNIF T+LVYA ELIG
Sbjct: 467 WGFWNWCNIFCTILVYATELIG 488

>Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement
          Length = 479

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 368/488 (75%), Gaps = 26/488 (5%)

Query: 10  RSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLARRSCNRGY 69
           +SIR      YL+L L++IPISF++GGL CGLSFTVTLFNLY ++TTL +++++  NR Y
Sbjct: 8   QSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKKY-NRLY 66

Query: 70  VFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELD-----PDGSFLDLLK 124
              TS +YY QH +I  LLFLFLSGF+N+E  R         ++D     P  S ++ L+
Sbjct: 67  YSITSFVYYLQHFIIPSLLFLFLSGFNNDELKR---------QIDGDVNLPRESLVNFLR 117

Query: 125 HRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGETNK 184
           ++           +W  YYYY+KF V+PWQ++L +STP+FTLLEGFFT+L IQAIGETNK
Sbjct: 118 NK-------SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNK 170

Query: 185 WLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFCLG 244
           WL Y  NSNTWII SLL+SGGVIT SLYYLYRIYVTP+W+L+IQ+ASLLGF LSIV  LG
Sbjct: 171 WLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLG 230

Query: 245 LYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNRDN 304
           LYGI+S KGSVIESSLFFAYIVRCIYEISP+LAT A +EI  +VKD WQ HQ N L  DN
Sbjct: 231 LYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGN-LPTDN 289

Query: 305 LLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSIVE 364
           LL+YY NVVLKN EM+W++ I+ ++ + +       WL + P+WKF KNFT+SVPSSI E
Sbjct: 290 LLSYYRNVVLKNGEMIWDA-IVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348

Query: 365 LVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYWYS 424
           +  VT KMA+ES++P V++NL FRIL+FYSATRIIPALQ+ +   ++ SRR+++L+YWYS
Sbjct: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDNPNGRKSSRRLMRLIYWYS 408

Query: 425 PCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKD-QPRIVTDSWSFWNWCNIFWTVL 483
           PC++IAMYTHLILQYSGEL  +LCLWGC   W  + D   ++V D+W FWNWCN+F T+ 
Sbjct: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467

Query: 484 VYANELIG 491
           +Y  ELIG
Sbjct: 468 IYGLELIG 475

>Kwal_27.11500
          Length = 475

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/491 (55%), Positives = 362/491 (73%), Gaps = 22/491 (4%)

Query: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62
           +I   + +SIR+   + YL+L L++IPI+F++GGL CGLSFTVTLFNLYLI+TTL + AR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122
               RG+    S  YY+QH  I  LLFLFLSGFSN+E    +          PD S +DL
Sbjct: 61  ---ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQID-----TNTRPDESLIDL 112

Query: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182
           L+       ++ +S+ W  YYYY+ ++V+PWQ+LL  STP+FTLLEGFFT+L IQA+GET
Sbjct: 113 LR-------SSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGET 165

Query: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242
           N+WLS    SN W+I+ L+ SGGVIT +LYYLYRIYVTPIW+L++Q+ASLLGF  SIV  
Sbjct: 166 NRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225

Query: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302
           LG++GI+S +GS IESSLFFAYIVRC+YEISP+LAT A +EI +LVKD W    R+L + 
Sbjct: 226 LGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSS 285

Query: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRF--WLDVTPVWKFFKNFTVSVPS 360
           D  LAYY +++LKN EM+W++ +   + +++    + +  W  V P+WKF K+FT SVPS
Sbjct: 286 DTFLAYYRDIILKNGEMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPS 345

Query: 361 SIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLL 420
           SI E+  +T  MA E+++PAV++NLCFRILIFYSATRIIPALQR   K +R+SRR +++L
Sbjct: 346 SIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQR---KHKRRSRRFMRML 402

Query: 421 YWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFW 480
           YWYSPC++IAMYTHLI+QYSG++  +LCLWGC    +   +  ++V DSW FWNWCNIF 
Sbjct: 403 YWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFP--WSPPEGSKVVVDSWGFWNWCNIFC 460

Query: 481 TVLVYANELIG 491
           T+ +YA+EL G
Sbjct: 461 TMAIYASELFG 471

>ADL208W [1533] [Homologous to ScYIL090W - SH]
           complement(337120..338628) [1509 bp, 502 aa]
          Length = 502

 Score =  485 bits (1249), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 252/510 (49%), Positives = 357/510 (70%), Gaps = 31/510 (6%)

Query: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62
           ++ +G+ RS+R + A+ YL L L+++PISF+IGGL CGLSFTVTLF LY ++TTL + A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFL---SPVGSYQELDPDGSF 119
              +  +    S LYY QH ++  +LFLFLSGF+N++  + L    P G+      DG+ 
Sbjct: 61  TRGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119

Query: 120 LDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAI 179
            + L   + +   + + +    Y +Y++++V+PWQ++L ++TP FTL EGFFT+LAIQ I
Sbjct: 120 NESL---LQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVI 176

Query: 180 GETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSI 239
           GET +WL Y+ NS  W+I+SL+VSG VIT S+YYLYRIYVTPIW L++ +A+LLGF LS+
Sbjct: 177 GETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSL 236

Query: 240 VFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNL 299
           VF LGLYGIIS KGS IESSLFFAY+V CIYEISP+LA  A  EI  +V + WQ  Q+  
Sbjct: 237 VFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQM-QQGT 295

Query: 300 LNRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAME-----------------KIRFWL 342
           L +++LLAYY N +L NAE +W+  +L ++  L+++E                 + ++W 
Sbjct: 296 LPKNSLLAYYKNFIL-NAENLWD-VLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWN 353

Query: 343 DVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPAL 402
               +W F KNF+  +P SI E+  VT  +A ES++ AV+ NL FR+++FYSATRIIPAL
Sbjct: 354 KSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPAL 413

Query: 403 QRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSK-D 461
           QR++     QSR++++++YWYSPC++IAMYTH+IL+YSGEL  ELC+WGC   W  S+ +
Sbjct: 414 QRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEAN 470

Query: 462 QPRIVTDSWSFWNWCNIFWTVLVYANELIG 491
           + R V D+W FWNWCN+F+T+L+YA ELIG
Sbjct: 471 RDRWVVDAWGFWNWCNLFFTLLIYAVELIG 500

>KLLA0E08173g complement(740213..741673) similar to sp|P40499
           Saccharomyces cerevisiae YIL090w singleton, start by
           similarity
          Length = 486

 Score =  472 bits (1214), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 255/494 (51%), Positives = 335/494 (67%), Gaps = 53/494 (10%)

Query: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60
           M LI + V +++RI    +YL L L++IPISF++GGL CGLSFTVTLF LY +STT  ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120
                +RG   +T ++YY QHL+I  +LF+FLS F N               +D D    
Sbjct: 100 L---LDRGSALST-LIYYLQHLLIPSILFMFLSYFEN---------------IDSDTVDS 140

Query: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180
           +  K                    ++  +V+PWQ  L +STP FTLLEG FTILAIQAIG
Sbjct: 141 EYFK-------------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIG 181

Query: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240
           ET +WL     SN W+I SLL+SGG+IT SL+Y YRIYVTP+W+L+  SASLLGF  SIV
Sbjct: 182 ETERWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIV 241

Query: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300
             +GLYG I+  GSV+ESSLFFAY+VR +YEISPK+A  A +EI D+VK+ W+ HQ NL 
Sbjct: 242 CGIGLYG-INGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300

Query: 301 NRDNLLAYYHNVVLKNAEMVWESFI--LPRSRS-LNAMEKIRFWLDVTPVWKFFKNFTVS 357
            +DNLL     ++ KN   +W   +   PR+   +  M++ ++ L+  P+W   KNFT S
Sbjct: 301 KKDNLL----ELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILN--PLWNSVKNFTKS 354

Query: 358 VPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRIL 417
           VP SI E+  VT+KMA ESL PAV++NL FR+LIFYSATRIIP LQR++ KE+R  RRI+
Sbjct: 355 VPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNT-KERRSFRRIM 413

Query: 418 KLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCN 477
             +YWYSPC++IAMYTHLIL+YSG+LK +LC+WGC    F  + +P+IV DSWSFWNWCN
Sbjct: 414 NFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCN 469

Query: 478 IFWTVLVYANELIG 491
           I+ T+L+YA EL+G
Sbjct: 470 IYSTMLIYALELMG 483

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 348 WKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRIL 390
           W FF N+TV +P  I  + S+T    +E+++P+++V LC+ ++
Sbjct: 125 WLFFLNWTVVLPLEIC-VASMTINFWNENINPSIVVALCYSLV 166

>YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS), has similarity to Dal5p [1572 bp, 523
           aa]
          Length = 523

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 20/82 (24%)

Query: 18  ALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR----RSCN-RGY--- 69
           A+   + L+S+P+S KIG           LF+LYL+ +   V+       SCN  GY   
Sbjct: 383 AIIGCIVLISLPLSHKIG----------NLFSLYLLYSGSCVITNIYIWNSCNTSGYTKR 432

Query: 70  VF--ATSILYYSQHLVIAPLLF 89
           VF  A +++ Y+   +IAP +F
Sbjct: 433 VFRNAITMIVYNVSCIIAPQMF 454

>YNR056C (BIO5) [4639] chr14 complement(731615..733300)
           Transmembrane regulator of KAPA/DAPA transport, involved
           in biotin biosynthesis, member of the amino acid
           permease family of membrane transporters [1686 bp, 561
           aa]
          Length = 561

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (75%)

Query: 232 LLGFVLSIVFCLGLYGIISRKGSVIESSL 260
           ++GFV S ++C+GL+  I+ + +V+ES L
Sbjct: 327 IVGFVTSFIYCVGLFFCITDQTAVVESIL 355

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,586,456
Number of extensions: 664669
Number of successful extensions: 2348
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2385
Number of HSP's successfully gapped: 22
Length of query: 491
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 385
Effective length of database: 12,926,601
Effective search space: 4976741385
Effective search space used: 4976741385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)