Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D04180g70068931840.0
YIL091C72155921680.0
Scas_671.1372356320830.0
Kwal_27.1150372756020030.0
KLLA0E08195g70456419640.0
ADL209C70469619440.0
KLLA0C01738g19790740.50
KLLA0E22561g72455750.62
YGL015C13073700.84
KLLA0A01001g53343731.1
Scas_690.42762139693.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D04180g
         (689 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D04180g complement(411498..413600) similar to sp|P40498 Sac...  1231   0.0  
YIL091C (YIL091C) [2584] chr9 complement(191027..193192) Protein...   839   0.0  
Scas_671.13                                                           806   0.0  
Kwal_27.11503                                                         776   0.0  
KLLA0E08195g 742066..744180 similar to sp|P40498 Saccharomyces c...   761   0.0  
ADL209C [1532] [Homologous to ScYIL091C - SH] (334819..336933) [...   753   0.0  
KLLA0C01738g complement(138679..139272) similar to sp|P14306 Sac...    33   0.50 
KLLA0E22561g complement(2001004..2003178) similar to sp|P46673 S...    33   0.62 
YGL015C (YGL015C) [1958] chr7 complement(465046..465438) Protein...    32   0.84 
KLLA0A01001g 94392..95993 similar to sp|P43616 Saccharomyces cer...    33   1.1  
Scas_690.42                                                            31   3.9  

>CAGL0D04180g complement(411498..413600) similar to sp|P40498
           Saccharomyces cerevisiae YIL091c, hypothetical start
          Length = 700

 Score = 1231 bits (3184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/689 (88%), Positives = 612/689 (88%)

Query: 1   MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYN 60
           MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPA                  YN
Sbjct: 1   MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQVYN 60

Query: 61  ALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXXXXXX 120
           ALLTILKSEHKEDKVKTHRDH                YN                     
Sbjct: 61  ALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFADGESDDEDDDEDEQAQE 120

Query: 121 XXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA 180
                     KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA
Sbjct: 121 QEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA 180

Query: 181 IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY 240
           IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY
Sbjct: 181 IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY 240

Query: 241 KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK 300
           KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK
Sbjct: 241 KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK 300

Query: 301 VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTN 360
           VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYD            QHIFKGNTN
Sbjct: 301 VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTN 360

Query: 361 DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ 420
           DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ
Sbjct: 361 DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ 420

Query: 421 FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA 480
           FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA
Sbjct: 421 FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA 480

Query: 481 NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF 540
           NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF
Sbjct: 481 NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF 540

Query: 541 TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT 600
           TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT
Sbjct: 541 TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT 600

Query: 601 LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL 660
           LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL
Sbjct: 601 LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL 660

Query: 661 NISTVRCCYSKLDGLALEKIVGTKRTGVL 689
           NISTVRCCYSKLDGLALEKIVGTKRTGVL
Sbjct: 661 NISTVRCCYSKLDGLALEKIVGTKRTGVL 689

>YIL091C (YIL091C) [2584] chr9 complement(191027..193192) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.5616p [2166 bp, 721 aa]
          Length = 721

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/559 (69%), Positives = 470/559 (84%), Gaps = 7/559 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN +   K  + L NA K   ++YKS+K  +  +      E  I++ P + GE
Sbjct: 159 QDPFESHFN-QVPEKFVDKLSNAFKTKSVKYKSVKGSLSDS------ESYIYAKPVVIGE 211

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +E P    S+ SYFLK+RL++QN LLD +++ LT LQ+K+VDPM QYKDILYEYD+Y
Sbjct: 212 EALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSY 271

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            KDEDEYRDLY LHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTR+ 
Sbjct: 272 EKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 331

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY++V K+I KSG+DQVDKKGKF DQF D            QHIF+GNTND+FV+G+KFT
Sbjct: 332 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFT 391

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 392 RKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 451

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+FTIFDHLNKIP +QH+ADFSRIRMWYIN+QAK FRQTM+FTKYISP ANSL+N +CRN
Sbjct: 452 HIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRN 511

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
           + GRWKNHK++ SE+SS+G  GLK+RQIFQRF+++GNS+ +EPDYRFKFFTSV+I  I K
Sbjct: 512 MAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVK 571

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG LIYIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 572 STGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVM 631

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHH+RRYE+KGVK+VVFYKPP++PEFY EVVR+IGK  FLG+ DLNISTVRC YS
Sbjct: 632 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYS 691

Query: 671 KLDGLALEKIVGTKRTGVL 689
           KLDGL+LE+IVGTKR  VL
Sbjct: 692 KLDGLSLERIVGTKRAAVL 710

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 3  KRGRKELRSIRRAK------RTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXX 56
          KRGR+ELR I+R+        T+   +    ++      E                    
Sbjct: 18 KRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDEEGKKE 77

Query: 57 XXYNALLTILKSEHKEDK 74
            Y+ALLTILKSEH E K
Sbjct: 78 KVYDALLTILKSEHPEPK 95

>Scas_671.13
          Length = 723

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/563 (67%), Positives = 460/563 (81%), Gaps = 12/563 (2%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEG- 189
           +DPF++HFN + + K  + L  A     ++YKS K  +G        +  I S+P I G 
Sbjct: 158 QDPFESHFN-QVSEKTADDLNTAFNTGSVKYKSTKSVIGD------NKTVISSIPTIIGK 210

Query: 190 ---ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYE 246
              E  K   PK   S+ SYFLK+RLR+ N++LD++ + L  LQ+++VDPM QY+DIL E
Sbjct: 211 ENTEEEKDSAPK-SSSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCE 269

Query: 247 YDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAP 306
           Y +Y KDEDEYRDLY LH LNHVYKTRD+I+K+N +LQDN D+E+ DQGFTRPKVLI+ P
Sbjct: 270 YSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVP 329

Query: 307 TRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLG 366
           TRD+AY++++K+I KSGLDQVDKKGKF DQF+D            QHIFKGNTND+FVLG
Sbjct: 330 TRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLG 389

Query: 367 VKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEY 426
           VKFTRKAIKLYSNFYQSDIIVCSPLG+QMIVENTDKKKRQDDFLSS+EV IIDQ HSIEY
Sbjct: 390 VKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIEVLIIDQLHSIEY 449

Query: 427 QNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNI 486
           QN  H+FTIFDHLNKIP++QH+ADFSRIRMWYINDQA+ FRQTMIFTKY++P AN+L+N 
Sbjct: 450 QNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINN 509

Query: 487 KCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVIS 546
           +CRN  GRWKNH+I+  E S++  +GLKV+Q FQRF+++G SV DEPDYRFK F+SV+I 
Sbjct: 510 RCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIP 569

Query: 547 NITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGR 606
           +I KST Y DG LIYIP+Y+DYVR+RNY+KEKT++LFGDINEYSEQR L SNR+LF QGR
Sbjct: 570 SIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGR 629

Query: 607 LKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVR 666
           +KVLLYTERLHH+RRYELKGVK+VVFYKPP++PEFY EVVRYIGK+ FLG+ADLNISTVR
Sbjct: 630 VKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVR 689

Query: 667 CCYSKLDGLALEKIVGTKRTGVL 689
             Y KLDGL+LE+IVG+KR G+L
Sbjct: 690 TLYCKLDGLSLERIVGSKRAGIL 712

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSGSV----LEAGPAXXXXXXXXXXXXXXXXXX 58
          KRGR+ELR+IRR+   K+  +    V +S  V     E   +                  
Sbjct: 16 KRGRQELRTIRRSAGAKVSSQE---VFNSSIVDDEEQELNESNESEQEEDIDEEEKKNKV 72

Query: 59 YNALLTILKSEHKE 72
          Y ALLTILKSEH E
Sbjct: 73 YGALLTILKSEHPE 86

>Kwal_27.11503
          Length = 727

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/560 (65%), Positives = 453/560 (80%), Gaps = 12/560 (2%)

Query: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVP--YIEG 189
           DP + HFN     K  +AL  A K  ++RY+S K+K+         E+ I+S P   +E 
Sbjct: 167 DPLEAHFNSV-PEKDTDALDQAFKTKQVRYRSSKIKISK------NEEFIYSRPDLNLES 219

Query: 190 ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDT 249
            TP I+ P+   SLS YF+K+RL+IQN+LLD+++N LT LQ+KIVDP+ QY+D+LYEY+ 
Sbjct: 220 RTP-IQVPQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYEN 277

Query: 250 YGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRD 309
           Y + E EYRDLY LH L+H+YKTRD+I+KNNQ+LQDNPD E LDQGFTRPKVLI+ PTRD
Sbjct: 278 YDQ-ETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRD 336

Query: 310 SAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKF 369
            AY +++K+IEKSGLDQVDKK KFRDQFY             Q +FKGNTND+FVLG KF
Sbjct: 337 VAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKF 396

Query: 370 TRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNY 429
           TRK IKLYSNFYQSDIIVCSPLG+Q+I+ENTDKKKRQDDFLSS+E+ +IDQ HSIE+QN 
Sbjct: 397 TRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNV 456

Query: 430 THLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCR 489
            HL +IF+H+NKIPQ+QHDADFSRI+MWYINDQAK FRQT+IFT++ +P ANSL+N KCR
Sbjct: 457 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCR 516

Query: 490 NLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNIT 549
           N  GRWKNH IV +E SS+  +G++ R +FQRF+V G +  DEPD+RFK F SV++ NI 
Sbjct: 517 NYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIV 576

Query: 550 KSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKV 609
           +STGY+DG L+YIP+Y+D++RVRNY++EKT+ILFGDI+EYSEQR LT+NR LF QGR+KV
Sbjct: 577 QSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKV 636

Query: 610 LLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCY 669
           LLYTERLHHFRRYE+KGVK V+FYKPP++PEF++E VRY+ K+ FLG ADLNIS VRC Y
Sbjct: 637 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLY 696

Query: 670 SKLDGLALEKIVGTKRTGVL 689
           SKLDGLALE+IVGT+R  +L
Sbjct: 697 SKLDGLALERIVGTERAAIL 716

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%)

Query: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYNAL 62
          K GRK+LRSIR+A R   +   D  VE+    +                       Y AL
Sbjct: 21 KGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVEDVHEERTEVSRKQESNGEAYAAL 80

Query: 63 LTILKSEHKEDKVK 76
          LT+LK+EH   K K
Sbjct: 81 LTLLKAEHGTGKKK 94

>KLLA0E08195g 742066..744180 similar to sp|P40498 Saccharomyces
           cerevisiae YIL091c singleton, start by similarity
          Length = 704

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/564 (64%), Positives = 454/564 (80%), Gaps = 23/564 (4%)

Query: 132 DPFDTHFNGEEAAKHGE----ALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYI 187
           DPF++HF     +K+ E    A     KD  ++YKS K  V        +E  I+S P +
Sbjct: 147 DPFESHF-----SKYSESRLYAFDKGFKDKTVKYKSSKTDVSE------EESLIYSKPCL 195

Query: 188 EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNAL--TDLQRKIVDPMMQYKDILY 245
           + E  ++   K K +LSSYF+K++L++ N   D ++N L  T++Q+++VDPM QYKD+LY
Sbjct: 196 DDE--EVLPVKGKQTLSSYFIKQKLKLAN---DFQNNGLPLTEIQKELVDPMFQYKDMLY 250

Query: 246 EYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIA 305
           EYD Y  DED+YRDLY+LH LNHVYKTRD+I+KNNQKLQ+N D E LDQGFTRPKVLI+ 
Sbjct: 251 EYDDYA-DEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVV 309

Query: 306 PTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVL 365
           PTRD+A++IV K++EKSGLDQ DKK KF DQF++            QHIF+GNTND+FVL
Sbjct: 310 PTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVL 369

Query: 366 GVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIE 425
           G+KFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+EV IIDQ HSIE
Sbjct: 370 GLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIE 429

Query: 426 YQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLN 485
           YQN  H+ TIF H+NKIP++Q +ADFSRIRMWYIN+QAKFFRQT++FTKYISP ANS+LN
Sbjct: 430 YQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILN 489

Query: 486 IKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVI 545
            KCRNL GRWKNH+ +  E SS+G +GLKVRQIFQRF++ G +  DEPDYRFKFFTSV++
Sbjct: 490 GKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIV 549

Query: 546 SNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQG 605
            +I KSTGY+DG L+YIP+Y+D++RVRNY+KEKT+I+FG+INEYS Q+ LTSNR  F  G
Sbjct: 550 PSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHG 609

Query: 606 RLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTV 665
           ++KVLLYTERLHHFRRYE+K VK+V+FYKPP +PEFY EVVR IGK VFLG+ D+NISTV
Sbjct: 610 KVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTV 669

Query: 666 RCCYSKLDGLALEKIVGTKRTGVL 689
           RC YSK+DGL+LE++VG+KR  VL
Sbjct: 670 RCIYSKMDGLSLERVVGSKRAAVL 693

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 3  KRGRKELRSIRRA--KRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYN 60
          K GRK+LR I RA  KR + + EA     +  +  ++  A                  YN
Sbjct: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAYN 68

Query: 61 ALLTILKSEHKE 72
          ALLT+LKSEH E
Sbjct: 69 ALLTLLKSEHPE 80

>ADL209C [1532] [Homologous to ScYIL091C - SH] (334819..336933)
           [2115 bp, 704 aa]
          Length = 704

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/696 (55%), Positives = 473/696 (67%), Gaps = 24/696 (3%)

Query: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXX------XX 56
           KRGRK+LR+I R  R     E +A      +V EA                         
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72

Query: 57  XXYNALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXX 116
             Y ALLT+L +EH + + K  R                                     
Sbjct: 73  QSYGALLTLLSAEHGKQRKKRLR----KAEAEAAEAAEAGEDPEEAITAALENSAQDAED 128

Query: 117 XXXXXXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQV 176
                         +D FD HFN   AA   + L  A K+ + +Y+  K       E + 
Sbjct: 129 AEDAFDDSGESDEEQDHFDVHFNRVSAADVAQ-LDAAFKNGRAQYRVQK-------EARG 180

Query: 177 QEDAIFSVPYI--EGETPKIEDPKLKCSLSSYFLKKRLRIQNNL-LDTESNALTDLQRKI 233
           +E+ ++S P    EG    +  P    SL  Y +K+RLR+ N L  D     LT  Q+ +
Sbjct: 181 EEEILYSKPVASSEGTEGPVRVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVL 238

Query: 234 VDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLD 293
           +DPM QY+DILYEY+ Y + E EYR+LYTLH+LNHVYKTRD+I+KNNQKLQDNPD E LD
Sbjct: 239 LDPMFQYQDILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLD 297

Query: 294 QGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQH 353
           QGFTRPK L++ PTR +AY +V  L+++SG++QVDKK KF+DQFYD            QH
Sbjct: 298 QGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQH 357

Query: 354 IFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSV 413
           +FKGNTND+FVLG+KFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+ENTDKKKRQDDFLSS+
Sbjct: 358 VFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSI 417

Query: 414 EVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFT 473
           EV ++DQ HSIE+QN  H+  IF H+NKIPQ+Q DADFSRIRMWYI DQAK FRQTM+FT
Sbjct: 418 EVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFT 477

Query: 474 KYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEP 533
           +YISP AN+LLN KC N  GR K+H++VS+E S +G +GLK+RQIFQRF VLG S  DEP
Sbjct: 478 RYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEP 537

Query: 534 DYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQR 593
           D+RFKFFTSVV+  I K+TGYD G L+YIPEY+D++RVRNY+K+KT ILFGDINEYS+QR
Sbjct: 538 DFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQR 597

Query: 594 SLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTV 653
            LTSNR LF  GR+KVLLYTERLHHFRR+ELKGVK+V+ YKPPS+PEFY+E++RYIGK+ 
Sbjct: 598 QLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSA 657

Query: 654 FLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVL 689
           FLG ADLNI+TVRC YSK+D LALE+IVGTKR  VL
Sbjct: 658 FLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVL 693

>KLLA0C01738g complement(138679..139272) similar to sp|P14306
           Saccharomyces cerevisiae YLR178c TFS1 CDC25-dependent
           nutrient- and ammonia-response cell-cycle regulator,
           start by similarity
          Length = 197

 Score = 33.1 bits (74), Expect = 0.50,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 141 EEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLK 200
           E A+KH  ALGN L  +  + K  ++KV   ++ Q+  DA++S+   + + P   D K  
Sbjct: 39  EYASKHPVALGNTLSIDGTQEKP-EIKVAGGNDAQLDTDALYSLCLTDPDAPSNSDNKW- 96

Query: 201 CSLSSYFLKKRLRIQNNLLDTESNALTDLQ 230
            S   ++L+  +++    LD ++    DL+
Sbjct: 97  -SEYCHYLETNIKLS---LDPDTPMSLDLK 122

>KLLA0E22561g complement(2001004..2003178) similar to sp|P46673
           Saccharomyces cerevisiae YJR042w NUP85 nuclear pore
           protein singleton, start by similarity
          Length = 724

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 613 TERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRC 667
           T RL HF       + N+ F+   ++ EFY E ++Y  K   +GD +  +S + C
Sbjct: 130 TSRLEHF------SIVNLAFHALVTELEFYIESIKYTNKLQRIGDLEECLSILNC 178

>YGL015C (YGL015C) [1958] chr7 complement(465046..465438) Protein of
           unknown function [393 bp, 130 aa]
          Length = 130

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 567 DYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKG 626
           D +R  NY   +TS   G IN      +L S+   F+Q      +  ER+HHFR+++ K 
Sbjct: 3   DTIRPLNYADIETS---GPINLLETTNNLKSSLKKFSQKAKGSHISRERIHHFRKWKNKT 59

Query: 627 VK-NVVFYKPPSD 638
              +    KPP D
Sbjct: 60  ESLSENHLKPPPD 72

>KLLA0A01001g 94392..95993 similar to sp|P43616 Saccharomyces
           cerevisiae YFR044c, start by similarity
          Length = 533

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 212 LRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDE 254
           +++ + L+DT+ N L D  +++V P+++ +D LY+   Y  DE
Sbjct: 301 VQVMSTLVDTKGNILIDGIKEMVAPVLETEDALYDKIDYSVDE 343

>Scas_690.42
          Length = 762

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 61/139 (43%), Gaps = 31/139 (22%)

Query: 186 YIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNA----LTDLQRKIVDPMMQYK 241
           YIE    KIE+   K + +++F  K L I N  L   S A    LTD+QR+ +   ++  
Sbjct: 22  YIEDLNNKIENYDPKTAKTTFF--KDLPISNATLKGLSEAAFLKLTDIQRESIPVSLKGY 79

Query: 242 DILYEYDT-YGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK 300
           D+L    T  GK        + + VL  +Y+ R               +EF   G     
Sbjct: 80  DVLGSAKTGSGKTL-----AFLIPVLEKLYRERW--------------TEFDGLG----- 115

Query: 301 VLIIAPTRDSAYQIVTKLI 319
            LII+PTR+ A QI   LI
Sbjct: 116 ALIISPTRELAMQIYEVLI 134

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,289,584
Number of extensions: 950263
Number of successful extensions: 2970
Number of sequences better than 10.0: 35
Number of HSP's gapped: 3057
Number of HSP's successfully gapped: 40
Length of query: 689
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 580
Effective length of database: 12,822,747
Effective search space: 7437193260
Effective search space used: 7437193260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)